—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Substance Use Recovery

12 Wikipedia bridge articles confirmed in both vertical ledgers. 256 deterministic cross-vertical edges. 7,181 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
256 Cross Edges
7,181 External Sources
280 Wikipedia Articles
15 🌲 Evergreen
188 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Substance Use Recovery
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
256
External Sources Harvested
7,181
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.1300  ·  type: exact_title_cross  ·  14 shared tokens
QID Bridge Titles (12)
Idaho State PoliceIdahoTreasure ValleyBoise State UniversityEmergency medical servicesAmericans with Disabilities Act of 1990Boise, IdahoNampa, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanpubliccapitaladawesterncollegehomecanyonbegandepartmentlawpresentapproximatelyeasternnationaltechnologyhistorically
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:43:39 UTC
Content Hash
5577715189e60235
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.130
QID OVERLAP: Q5987459 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (14): "agency", "began", "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
agencybegancreatedcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepresentpublicstatewide
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (27): "approximately", "boise", "capital", "contains", "distinct", "divided", "early", "eastern", "idaho", "methods", "national", "official", "people", "population", "products", "restricted", "sector", "separate", "significant", "small".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in substance_use_recovery: "Idaho".
approximatelyboisecapitalcontainsdistinctdividedearlyeasternidahomethodsnationalofficialpeoplepopulationproductsrestrictedsectorseparatesignificantsmallsouthsuppliestechnologyunionuseswesternzone
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
The most parsimonious explanation we think is that people came down the Pacific Coast, and as they encountered the mouth of the Columbia River, they essentially found an off-ramp from this coastal migration and also found their first viable interior route to the areas that are south of the ice sheet. An early presence of French-Canadian trappers is visible in names and toponyms: Nez Percé, Cœur d'Alène, Boisé, Payette. Some of these names appeared prior to the Lewis and Clark and Astorian expeditions, which included significant numbers of French and Métis guides recruited for their familiarity with the terrain. Idaho, as part of the Oregon Country, was claimed by both the United States and Great Britain until the United States gained undisputed jurisdiction in 1846. From 1843 to 1859, present-day Idaho was under the de facto jurisdiction of the Provisional Government of Oregon. When Oregon became a state in 1859, what is now Idaho was situated in what remained of the original Oregon Territory, designated as the Washington Territory. Between 1849 and the creation of the Idaho Territory in 1863, parts of present-day Idaho were included in the Oregon, Washington, and Dakota Territories. The new Idaho territory included present-day Idaho, Montana, and most of Wyoming. The Lewis and Clark expedition crossed Idaho in 1805 on the way to the Pacific, and in 1806, on the return trip, largely following the Clearwater River in both directions, making it one the last states settled by European Americans. The first non-indigenous settlement was Kullyspell House, established on the shore of Lake Pend Oreille in 1809 by David Thompson of the North West Company for fur trading. In 1812 Donald Mackenzie, working for the Pacific Fur Company at the time, established a post on the lower Clearwater River near present-day Lewiston. This post, known as "MacKenzie's Post" or "Clearwater", operated until the Pacific Fur Company was bought out by the North West Company in 1813, after which the post was abandoned. The first organized non-indigenous communities within the present borders of Idaho were established by Mormon pioneers in 1860. The first permanent, substantial incorporated community was Lewiston, in 1861. Early in its history, Idaho saw a large influx of Chinese immigrants, who by 1870 made up about 28.5% of the territory's population. Idaho achieved statehood in 1890, following a difficult start as a territory, including the transfer of the territorial capital from Lewiston to Boise, disenfranchisement of Mormon polygamists upheld by the U.S. Supreme Court in 1890, and a federal attempt to split the territory between Washington Territory, which gained statehood in 1889, a year before Idaho, and the state of Nevada which had been a state since 1864. Idaho was one of the hardest hit of the Pacific Northwest states during the Great Depression. Prices plummeted for Idaho's major crops: in 1932 a bushel of potatoes brought only ten cents compared to 1919 for $1.51, while Idaho farmers saw their annual income of $685 in 1929 drop to $250 by 1932. Between 1991 and 2002, Idaho expanded its commercial base to include the science and technology sector which accounted for over 25% of its gross state product in 2001. During the COVID-19 pandemic, Idaho enacted statewide crisis standards of care as COVID-19 patients overwhelmed hospitals.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (15): "association", "boise", "eastern", "historically", "idaho", "local", "lower", "metropolitan", "opportunities", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in substance_use_recovery: "Treasure Valley".
associationboiseeasternhistoricallyidaholocallowermetropolitanopportunitiesregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (21): "activity", "among", "boise", "business", "college", "compete", "division", "education", "fiscal", "founded", "health", "idaho", "independent", "master", "program", "programs", "public", "reported", "research", "school".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in substance_use_recovery: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationfiscalfoundedhealthidahoindependentmasterprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Emergency medical services
Q860447 EXACT TITLE 1.000
QID OVERLAP: Q860447 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (35): "agencies", "ambulance", "began", "care", "contact", "department", "dispatch", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "patient", "personnel", "present", "primary", "providing", "public".... | EXACT TITLE in substance_use_recovery: "Emergency medical services".
agenciesambulancebegancarecontactdepartmentdispatchemergencyfacilitieshistoricallyhospitalmedicalmodeloperatepatientpersonnelpresentprimaryprovidingpublicqualifiedremainsresourcessearchskillssupportsystemstechnicaltechniciansthem+5
ill then dispatch suitable resources for the call. Ambulances are the primary vehicles for delivering EMS, though squad cars, motorcycles, aircraft, boats, fire apparatus, and others may be used. EMS agencies may also operate a non-emergency patient transport service, and some have rescue squads to provide technical rescue or search and rescue services. When EMS is dispatched, they will initiate medical care upon arrival on scene. If it is deemed necessary or a patient requests transport, the unit is then tasked with transferring the patient to the next point of care, typically an emergency department of a hospital. Historically, ambulances only transported patients to care, and this remains the case in parts of the developing world. The term "emergency medical service" was popularised when these services began to emphasise emergency treatment at the scene. In some countries, a substantial portion of EMS calls do not result in a patient being taken to hospital. Training and qualification levels for members and employees of emergency medical services vary widely throughout the world. In some systems, members may be present who are qualified only to drive ambulances, with no medical training. In contrast, most systems have personnel who retain at least basic life support (BLS) certifications.
Advances in the 1960s, especially the development of CPR and defibrillation as the standard form of care for out-of-hospital cardiac arrest, along with new pharmaceuticals, led to changes in the tasks of the ambulances. In Belfast, Northern Ireland the first experimental mobile coronary care ambulance successfully resuscitated patients using these technologies. Freedom House Ambulance Service was the first civilian emergency medical service in the United States to be staffed by paramedics, all of whom were African-American. One well-known report in the US during that time was Accidental Death and Disability: The Neglected Disease of Modern Society, also known as The White Paper. The report concluded that ambulance services in the US varied widely in quality and were often unregulated and unsatisfactory. These studies placed pressure on governments to improve emergency care in general, including the care provided by ambulance services. The government reports resulted in the creation of standards in ambulance construction concerning the internal height of the patient care area (to allow for an attendant to continue to care for the patient during transport), and the equipment (and thus weight) that an ambulance had to carry, and several other factors. In 1971 a progress report was published at the annual meeting, by the then president of American Association of Trauma, Sawnie R. Gaston M.D. Dr. Gaston reported the study was a "superb white paper" that "jolted and wakened the entire structure of organized medicine." This report is created as a "prime mover" and made the "single greatest contribution of its kind to the improvement of emergency medical services". Since this time a concerted effort has been undertaken to improve emergency medical care in the pre-hospital setting. Such advancements included Dr. R Adams Cowley creating the country's first statewide EMS program, in Maryland. The developments were paralleled in other countries. In the United Kingdom, a 1973 law merged the municipal ambulance services into larger agencies and set national standards. In France, the first official SAMU agencies were founded in the 1970s. Organization Depending on country, area within country, or clinical need, emergency medical services may be provided by one or more different types of organization. This variation may lead to large differences in levels of care and expected scope of practice.
Operating separately from (although alongside) the fire and police services of the area, these ambulances are funded by local, provincial or national governments. In some countries, these only tend to be found in big cities, whereas in countries such as the United Kingdom, almost all emergency ambulances are part of a national health system. In the United States, ambulance services provided by a local government are often referred to as "third service" EMS (the fire department, police department, and EMS department forming an emergency services trio) by the members of said service, as well as other city officials and residents. The most notable examples of this model in the United States are Pittsburgh Bureau of Emergency Medical Services, Boston EMS, New Orleans Emergency Medical Services, and Cleveland EMS. Government ambulance services also have to take civil service exams just like government fire departments and police. In the United States, certain federal government agencies employ emergency medical technicians at the basic and advanced life support levels, such as the National Park Service and the Federal Bureau of Prisons. Fire- or police-linked service In countries such as the United States, Japan, France, South Korea and parts of India, ambulances can be operated by the local fire or police services. Fire-based EMS is the most common model in the United States, where nearly all urban fire departments provide EMS and a majority of emergency transport ambulance services in large cities are part of fire departments. Examples of this model are the New York City Fire Department (FDNY) and the Baltimore City Fire Department. It is rare for a police department in the United States to provide EMS or ambulance services, although many police officers have basic medical training (such as Nalaxone use and CPR).
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (24): "act", "ada", "against", "broad", "business", "changes", "coalition", "costs", "council", "covered", "disability", "employers", "final", "house", "individuals", "later", "law", "national", "protections", "public"....
actadaagainstbroadbusinesschangescoalitioncostscouncilcovereddisabilityemployersfinalhouseindividualslaterlawnationalprotectionspublicrecommendedrequirementsrequiresrights
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (16): "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaannualblockboisecapitalcountiesemployershomeidaholocallymajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegehomeidahomeaningmeridianmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (10): "ada", "boise", "capital", "district", "home", "idaho", "local", "metropolitan", "population", "private".
adaboisecapitaldistricthomeidaholocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
244 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP244 edges
🌲 EVERGREEN3 edges
0.650
acquisitionagencyboardbroadcreatedeconomicfederalgovernmentindependentindustrymattersoversightpowersregulationregulatoryrelevantservessubjecttransportation
SHARED TOKENS (19): "acquisition", "agency", "board", "broad", "created", "economic", "federal", "government", "independent", "industry", "matters", "oversight", "powers", "regulation", "regulatory", "relevant", "serves", "subject", "transportation". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationcommercialcostsfederalfiscalfundingfundsgeneralgrantgrantsimprovepercentplanningprogrampublicrevenuesafetysold
SHARED TOKENS (19): "acquisition", "administration", "commercial", "costs", "federal", "fiscal", "funding", "funds", "general", "grant", "grants", "improve", "percent", "planning", "program", "public", "revenue", "safety", "sold". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaagenciesamonganotherauthorityboisecanyoncapacitycapitalcentercostcostsdemanddestinationdistrictdriverseagleearlyemployersenvironmental
SHARED TOKENS (67): "ada", "agencies", "among", "another", "authority", "boise", "canyon", "capacity", "capital", "center", "cost", "costs", "demand", "destination", "district", "drivers", "eagle", "early", "employers", "environmental".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH188 edges
0.500
businesscostenvironmentfinancialgrouphouseindependentlaterlivingmodeloperatingorganizationrecoveryrehabilitationresidentsrulessystemtreatment
SHARED TOKENS (18): "business", "cost", "environment", "financial", "group", "house", "independent", "later", "living", "model", "operating", "organization", "recovery", "rehabilitation", "residents", "rules", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
buildingbuildingsbuiltdesigndevelopmenteconomicequivalentexpandfacilitiesfinancingimproveindustryinfrastructuremaintenancepercentplanningprocessproductswork
SHARED TOKENS (19): "building", "buildings", "built", "design", "development", "economic", "equivalent", "expand", "facilities", "financing", "improve", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in substance_use_recovery: "Construction".
0.500
academicamongbecomecareconditioncoordinationcriticaldecadesdepartmentsdirectlyearlyemergencygeneralhospitalimprovinginternationallimitedmedicalmodelmodels
SHARED TOKENS (33): "academic", "among", "become", "care", "condition", "coordination", "critical", "decades", "departments", "directly", "early", "emergency", "general", "hospital", "improving", "international", "limited", "medical", "model", "models".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
accessambulancebecomebroadcarecenterdepartmentdepartmentsemergencyentryfacilityhospitalhospitalsmeansmedicaloperatepatientpointspresentprimary
SHARED TOKENS (22): "access", "ambulance", "become", "broad", "care", "center", "department", "departments", "emergency", "entry", "facility", "hospital", "hospitals", "means", "medical", "operate", "patient", "points", "present", "primary".... | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
anotherapplyassistancecapacityemergencyfailintendedlawlegalmedicalneedoperatepeopleprofessionalreducerequiresrightssystemsystemstreatment
SHARED TOKENS (21): "another", "apply", "assistance", "capacity", "emergency", "fail", "intended", "law", "legal", "medical", "need", "operate", "people", "professional", "reduce", "requires", "rights", "system", "systems", "treatment".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
applicablebuildingcentercenterscommercialconsumersdemanddirectlydistributionfacilityfunctionhandlinglaborlogisticsmarketnetworkoperateoperatesoperationorganizations
SHARED TOKENS (30): "applicable", "building", "center", "centers", "commercial", "consumers", "demand", "directly", "distribution", "facility", "function", "handling", "labor", "logistics", "market", "network", "operate", "operates", "operation", "organizations".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingbuildingscompatibledeterminedevelopeddevelopmentdifferentformgovernmentgovernmentsland-uselocalplanningpolicyregulationsregulatoryresidentialrulesscaleshape
SHARED TOKENS (25): "building", "buildings", "compatible", "determine", "developed", "development", "different", "form", "government", "governments", "land-use", "local", "planning", "policy", "regulations", "regulatory", "residential", "rules", "scale", "shape".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in substance_use_recovery: "Zoning".
0.500
accessactcomprehensivecontinuingcreatedfederalfederallyformationfundingfundsfuturegovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplans
SHARED TOKENS (28): "access", "act", "comprehensive", "continuing", "created", "federal", "federally", "formation", "funding", "funds", "future", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
alongsideamongapprovedclinicaldeterminefederalformfurtherhealthhealthcareinvolvinglistlocalmakesmanagementmedicalnationalorganizationprimaryreduce
SHARED TOKENS (26): "alongside", "among", "approved", "clinical", "determine", "federal", "form", "further", "health", "healthcare", "involving", "list", "local", "makes", "management", "medical", "national", "organization", "primary", "reduce".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
broadercomprehensivecoveringdevelopmenteconomicenvironmentalindividualinfrastructureland-usemanagementnationalneedsnetworkplacementplanningplanspracticesregionregionalrequire
SHARED TOKENS (31): "broader", "comprehensive", "covering", "development", "economic", "environmental", "individual", "infrastructure", "land-use", "management", "national", "needs", "network", "placement", "planning", "plans", "practices", "region", "regional", "require".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescommunityconditionscreateddevelopmentdifferentdistincteconomicemergencyenforcementenvironmentenvironmentalfacilitiesfrequentlyfunctionfunctioninggeneralhealthindustry
SHARED TOKENS (44): "access", "agencies", "community", "conditions", "created", "development", "different", "distinct", "economic", "emergency", "enforcement", "environment", "environmental", "facilities", "frequently", "function", "functioning", "general", "health", "industry".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in substance_use_recovery: "Infrastructure".
0.500
accessamongbeganbehavioralcarecommunitiescommunitycomprehensivecontroldesigneddevelopeddevelopmentdifferentdisabilitydistributioneducationenvironmentalevenhealthhealthcare
SHARED TOKENS (53): "access", "among", "began", "behavioral", "care", "communities", "community", "comprehensive", "control", "designed", "developed", "development", "different", "disability", "distribution", "education", "environmental", "even", "health", "healthcare".... | EXACT TITLE in transportation_infrastructure: "Public health".
0.500
alongsidedevelopeddevelopmentdirectenvironmentenvironmentalfreegroupimpactimproveincreaseindividualindividualsinternationallimitedlivingmedicalpeoplepolicypopulation
SHARED TOKENS (32): "alongside", "developed", "development", "direct", "environment", "environmental", "free", "group", "impact", "improve", "increase", "individual", "individuals", "international", "limited", "living", "medical", "people", "policy", "population".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
analysisanotherapplicationbehaviorclinicalcommunitycontrolfailframeworkhealthmanagementmodelplanproceduresproduceprogramregulationsrulestrainingtreatment
SHARED TOKENS (21): "analysis", "another", "application", "behavior", "clinical", "community", "control", "fail", "framework", "health", "management", "model", "plan", "procedures", "produce", "program", "regulations", "rules", "training", "treatment".... | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
administrationanalysisbackconcerningcostcostsdifferenteconomicestablishedfallsfundingimpactimplementinginformationintendedlawmanagementmarketmethodspeople
SHARED TOKENS (43): "administration", "analysis", "back", "concerning", "cost", "costs", "different", "economic", "established", "falls", "funding", "impact", "implementing", "information", "intended", "law", "management", "market", "methods", "people".... | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
activityaffectsalreadyamongapprovedchangesclassificationcontrolleddifferentfullfurtherhealthhistoryhourincreaselistmedicalorganizationpotentialproduce
SHARED TOKENS (26): "activity", "affects", "already", "among", "approved", "changes", "classification", "controlled", "different", "full", "further", "health", "history", "hour", "increase", "list", "medical", "organization", "potential", "produce".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
articlebehaviorcentralchangesclinicaldescribeddescriptiondevelopedinfluencemakingproblemproceduresratherrelationshiptreatment
SHARED TOKENS (15): "article", "behavior", "central", "changes", "clinical", "described", "description", "developed", "influence", "making", "problem", "procedures", "rather", "relationship", "treatment". | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
accommodationapproximatelychangesconditionconsequentlydesignedemergencyformgovernmenthousehousingidentifyingindividualslegallivingneedspeoplepermanentplacepopulations
SHARED TOKENS (29): "accommodation", "approximately", "changes", "condition", "consequently", "designed", "emergency", "form", "government", "house", "housing", "identifying", "individuals", "legal", "living", "needs", "people", "permanent", "place", "populations".... | EXACT TITLE in substance_use_recovery: "Homelessness".
0.500
boundariescertificationcompetencecompletecontinuedformallaborleadinglicensemasterpeoplepermanentplacementpotentialpracticepractitionersprofessionalregulatedstudysystem
SHARED TOKENS (22): "boundaries", "certification", "competence", "complete", "continued", "formal", "labor", "leading", "license", "master", "people", "permanent", "placement", "potential", "practice", "practitioners", "professional", "regulated", "study", "system".... | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
communitydescribesdevelopmenteconomicfrequentlyhistoricallyimproveindividualinfrastructurelocalmarketpeoplepoliciespolicyprocessqualityreductionregionterms
SHARED TOKENS (19): "community", "describes", "development", "economic", "frequently", "historically", "improve", "individual", "infrastructure", "local", "market", "people", "policies", "policy", "process", "quality", "reduction", "region", "terms". | EXACT TITLE in transportation_infrastructure: "Economic development". | EXACT TITLE in substance_use_recovery: "Economic development".
0.500
Pharmacy ↗ EXACT TITLE
becomecareclinicalcommunitydirecthealthinformationinstitutionallinksmonitoringofficepatientpharmacypracticeprimaryproducingproductsprofessionalprovidingsafe
SHARED TOKENS (26): "become", "care", "clinical", "community", "direct", "health", "information", "institutional", "links", "monitoring", "office", "patient", "pharmacy", "practice", "primary", "producing", "products", "professional", "providing", "safe".... | EXACT TITLE in transportation_infrastructure: "Pharmacy". | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
ageamongcarechangesclinicalcollectionconditionsdatadecadesdesigneddifferentdigitalhealthhealthcarehistoryidentifyimproveincreasinginformationlong-term
SHARED TOKENS (39): "age", "among", "care", "changes", "clinical", "collection", "conditions", "data", "decades", "designed", "different", "digital", "health", "healthcare", "history", "identify", "improve", "increasing", "information", "long-term".... | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
articleconsumerconsumerscreatingdirectdirectlydistributionfacilitiesindependentlogisticsmanagementmaterialsnetworkproductsstructuresupplysystemsystemsthemvalue
SHARED TOKENS (20): "article", "consumer", "consumers", "creating", "direct", "directly", "distribution", "facilities", "independent", "logistics", "management", "materials", "network", "products", "structure", "supply", "system", "systems", "them", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyauthoritycertificationcommercialcontrolcreateddepartmentfederalgovernmentinternationalorganizationpersonnelpowersregulatessettingspacestandardstransportation
SHARED TOKENS (19): "administration", "agency", "authority", "certification", "commercial", "control", "created", "department", "federal", "government", "international", "organization", "personnel", "powers", "regulates", "setting", "space", "standards", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
clinicalconnectioncontinuingcontroldistincteducationemergencyknowledgemedicalmeetorganizationspeoplepersonnelpositionproblemsrelationshiprelevantsourcespecialistssupport
SHARED TOKENS (25): "clinical", "connection", "continuing", "control", "distinct", "education", "emergency", "knowledge", "medical", "meet", "organizations", "people", "personnel", "position", "problems", "relationship", "relevant", "source", "specialists", "support".... | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
acceptedactadministrationagenciesapplicationclassificationcomprehensivecontrolcontrolledcreateddecisionsdeterminedistributionenforcementestablishingfederalfoodimplementinginternationallaw
SHARED TOKENS (30): "accepted", "act", "administration", "agencies", "application", "classification", "comprehensive", "control", "controlled", "created", "decisions", "determine", "distribution", "enforcement", "establishing", "federal", "food", "implementing", "international", "law".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
actagainstageamongbroaderconflictscontextcontrolcreatedirectdocumentationearlyestablishedfinancialformerhealthhomelegallylimitedoffice
SHARED TOKENS (38): "act", "against", "age", "among", "broader", "conflicts", "context", "control", "create", "direct", "documentation", "early", "established", "financial", "former", "health", "home", "legally", "limited", "office".... | EXACT TITLE in substance_use_recovery: "Domestic violence".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsannualbecomecarecostcostscoveragecovereddividedeconomiceligibilityestablishedexpandexpandedfederalfinancialfundinggeneral
SHARED TOKENS (51): "access", "act", "adults", "annual", "become", "care", "cost", "costs", "coverage", "covered", "divided", "economic", "eligibility", "established", "expand", "expanded", "federal", "financial", "funding", "general".... | EXACT TITLE in transportation_infrastructure: "Medicaid". | EXACT TITLE in substance_use_recovery: "Medicaid".
0.500
Social work ↗ Q205398 EXACT TITLE
academicadministrationadvocacyagenciesbecomebegancommunitiescommunitydevelopeddevelopmentdirectlydividededucationfunctioninggovernmentgrouphealthindividualindividualsinterdisciplinary
SHARED TOKENS (41): "academic", "administration", "advocacy", "agencies", "become", "began", "communities", "community", "developed", "development", "directly", "divided", "education", "functioning", "government", "group", "health", "individual", "individuals", "interdisciplinary".... | EXACT TITLE in substance_use_recovery: "Social work".
0.500
academicageagenciesbeyondcollegecontinuingdevelopmentdifferentdivisioneconomiceducationformalfrequentlygeneralgovernmentinstitutionalintendedoperationprofessionalprograms
SHARED TOKENS (30): "academic", "age", "agencies", "beyond", "college", "continuing", "development", "different", "division", "economic", "education", "formal", "frequently", "general", "government", "institutional", "intended", "operation", "professional", "programs".... | EXACT TITLE in substance_use_recovery: "Continuing education".
0.500
administrationagencyapproximatelyauthoritybudgetcombinedconnectingcreateddatadepartmentenforcementfacilitiesfederalfiscalgovernmentidentificationimprovelawlocalmission
SHARED TOKENS (39): "administration", "agency", "approximately", "authority", "budget", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "fiscal", "government", "identification", "improve", "law", "local", "mission".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
anothercollectioncostsfacilityfoodinformationlogisticsmaintainingmanagementmaterialmaterialsmodelmovementneedsoperationalplanningproblemsproductionproductsprofessional
SHARED TOKENS (26): "another", "collection", "costs", "facility", "food", "information", "logistics", "maintaining", "management", "material", "materials", "model", "movement", "needs", "operational", "planning", "problems", "production", "products", "professional".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in substance_use_recovery: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentgrantsimprovelocalofficeoperateoperatorspeopleprogramsprovidersproviding
SHARED TOKENS (29): "administration", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "grants", "improve", "local", "office", "operate", "operators", "people", "programs", "providers", "providing".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
actadministrationagencycommunitycontrolleddepartmentdistributionenforcementestablishedfederalgovernmentinvolvinglawnationaloperationsratherreportsuses
SHARED TOKENS (18): "act", "administration", "agency", "community", "controlled", "department", "distribution", "enforcement", "established", "federal", "government", "involving", "law", "national", "operations", "rather", "reports", "uses". | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
0.500
bodybroadbroaderbuildingscapitalcategorycommunitydirectlyeconomicemploymentenvironmentalfacilitiesgovernmenthealthhospitalsinfrastructurelong-termmunicipaloperatorprivate
SHARED TOKENS (29): "body", "broad", "broader", "buildings", "capital", "category", "community", "directly", "economic", "employment", "environmental", "facilities", "government", "health", "hospitals", "infrastructure", "long-term", "municipal", "operator", "private".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Methadone ↗ Q179996 EXACT TITLE
amongapproveddailydevelopedfrequentlyfunctionhealthinvolvinglistlong-termmaintenancemanagementorganizationpatientpeopleriskssidesinglesoldtreatment
SHARED TOKENS (20): "among", "approved", "daily", "developed", "frequently", "function", "health", "involving", "list", "long-term", "maintenance", "management", "organization", "patient", "people", "risks", "side", "single", "sold", "treatment". | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Probation ↗ Q13961 EXACT TITLE
behaviorcommunityconditionscontactformerlawlimitedmeansmovementpermitplacepotentialprogramremainrulessubjecttreatment
SHARED TOKENS (17): "behavior", "community", "conditions", "contact", "former", "law", "limited", "means", "movement", "permit", "place", "potential", "program", "remain", "rules", "subject", "treatment". | EXACT TITLE in substance_use_recovery: "Probation".
0.500
accessarrangementsassociationcontractingcoordinationcostsdevelopmenteconomicestatefinancialfrequentlyfundinggeneralgovernmenthistoricalindustryinfrastructureintendedinternationalinvestment
SHARED TOKENS (47): "access", "arrangements", "association", "contracting", "coordination", "costs", "development", "economic", "estate", "financial", "frequently", "funding", "general", "government", "historical", "industry", "infrastructure", "intended", "international", "investment".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
Drug court ↗ Q5308883 EXACT TITLE
combinedcommunitiesdriversenforcementhealthlawleadinglong-termmodelmonitoringprocesspublicrecoveryreducespecializedtestingtreatmentwork
SHARED TOKENS (18): "combined", "communities", "drivers", "enforcement", "health", "law", "leading", "long-term", "model", "monitoring", "process", "public", "recovery", "reduce", "specialized", "testing", "treatment", "work". | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
contextcontroldescribeddesignedfrequentlyfunctionsimplementinformationinvolvinglaboroperationspeopleprimarysourcestructuresystemsuses
SHARED TOKENS (17): "context", "control", "described", "designed", "frequently", "functions", "implement", "information", "involving", "labor", "operations", "people", "primary", "source", "structure", "systems", "uses". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
associationbehaviorbehavioralcombinedconditionconditionsdesigneddevelopeddevelopmentformhealthidentifiedimproveindividuallimitedmaintenancemedicalmovementnationaloriginating
SHARED TOKENS (34): "association", "behavior", "behavioral", "combined", "condition", "conditions", "designed", "developed", "development", "form", "health", "identified", "improve", "individual", "limited", "maintenance", "medical", "movement", "national", "originating".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
approveddepartmentfacilitiesfederalfundsidentifiedimprovingindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningsafetyservingstrategicsystem
SHARED TOKENS (22): "approved", "department", "facilities", "federal", "funds", "identified", "improving", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "strategic", "system".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
Psychology ↗ Q9418 EXACT TITLE
academicactivityanotherbehaviorbehavioralboundariesbroadclinicaldevelopmenteducationfunctioningfunctionsgrouphealthhospitalsindividualindividualsinterdisciplinaryknowledgelinking
SHARED TOKENS (38): "academic", "activity", "another", "behavior", "behavioral", "boundaries", "broad", "clinical", "development", "education", "functioning", "functions", "group", "health", "hospitals", "individual", "individuals", "interdisciplinary", "knowledge", "linking".... | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
authoritybeganboundariesconsolidatedcountiesdifferentdistrictdividedequivalentformformerfurthergovernmentgovernmentsindependentlawlegallylocallocallymultiple
SHARED TOKENS (29): "authority", "began", "boundaries", "consolidated", "counties", "different", "district", "divided", "equivalent", "form", "former", "further", "government", "governments", "independent", "law", "legally", "local", "locally", "multiple".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in substance_use_recovery: "County (United States)".
0.500
accessactivityagainstanotherassistedcarechangesdesigneddifferentdriverseducationenvironmentfacilitiesfoodfreehealthinformationlegallegallymedia
SHARED TOKENS (41): "access", "activity", "against", "another", "assisted", "care", "changes", "designed", "different", "drivers", "education", "environment", "facilities", "food", "free", "health", "information", "legal", "legally", "media".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariesdevelopmentdigitalenvironmentestablishgovernmenthistorylawlegalownershipplanningpointsprofessionalresearchthemtransportationwork
SHARED TOKENS (18): "analysis", "boundaries", "development", "digital", "environment", "establish", "government", "history", "law", "legal", "ownership", "planning", "points", "professional", "research", "them", "transportation", "work". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
amongapprovedcareclinicalcommunitydifferenteducationgovernmenthealthhealthcarehospitalindustryknowledgelegallegislationlicensingmanagementmastermechanismmonitoring
SHARED TOKENS (40): "among", "approved", "care", "clinical", "community", "different", "education", "government", "health", "healthcare", "hospital", "industry", "knowledge", "legal", "legislation", "licensing", "management", "master", "mechanism", "monitoring".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectedaffectsamongbehavioralclinicalcontextcontinuedcontrolledcostcostsdefinitionsdependencedevelopmentdirectlyenvironmentenvironmentalevidencefurthergrouphealth
SHARED TOKENS (45): "affected", "affects", "among", "behavioral", "clinical", "context", "continued", "controlled", "cost", "costs", "definitions", "dependence", "development", "directly", "environment", "environmental", "evidence", "further", "group", "health".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
adaboisecentercombinedcommercialdepartmentfacilityfallsfunctionsgeneralidahoincreaseinteragencyinternationalnationaloperatedoperatesrequiringrightssouth
SHARED TOKENS (23): "ada", "boise", "center", "combined", "commercial", "department", "facility", "falls", "functions", "general", "idaho", "increase", "interagency", "international", "national", "operated", "operates", "requiring", "rights", "south".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
actadministeradministrationagenciesagencyassistancecreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramspublicregulationsrehabilitation
SHARED TOKENS (25): "act", "administer", "administration", "agencies", "agency", "assistance", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "public", "regulations", "rehabilitation".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationapplicationsbridgebroadcareclinicalconditionscontinuousdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcare
SHARED TOKENS (43): "access", "administration", "another", "application", "applications", "bridge", "broad", "care", "clinical", "conditions", "continuous", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare".... | EXACT TITLE in substance_use_recovery: "Telehealth".
0.500
actaddressingadministeredagencyassistancechangescontrolcoordinationdirectlyenactedenvironmentalfederalformfundinggoverninggovernmentsimplementinginvolvinglawlegislation
SHARED TOKENS (36): "act", "addressing", "administered", "agency", "assistance", "changes", "control", "coordination", "directly", "enacted", "environmental", "federal", "form", "funding", "governing", "governments", "implementing", "involving", "law", "legislation".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
bridgebuiltcommunityconnectingconnectioncreatedesigndesignedearlyenvironmentfrequentlyintendedlocalmajormeetnetworkprovidingrequirementssatisfyserve
SHARED TOKENS (26): "bridge", "built", "community", "connecting", "connection", "create", "design", "designed", "early", "environment", "frequently", "intended", "local", "major", "meet", "network", "providing", "requirements", "satisfy", "serve".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in substance_use_recovery: "Bridge".
0.500
agreementamongapproximatelyconcerningdesigneddevelopmentgeneralgrouphealthincorporatedindividuallong-termmedicalorganizationsoversightpathwaypeopleprimarypublicrecovery
SHARED TOKENS (31): "agreement", "among", "approximately", "concerning", "designed", "development", "general", "group", "health", "incorporated", "individual", "long-term", "medical", "organizations", "oversight", "pathway", "people", "primary", "public", "recovery".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
Irrigation ↗ Q11453 EXACT TITLE
applicationcentralchangescollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributionenvironmentalformfullmanagementmethodsnetworkoperationoperations
SHARED TOKENS (34): "application", "central", "changes", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distribution", "environmental", "form", "full", "management", "methods", "network", "operation", "operations".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
adultsagebehavioralcategorydependencedirectdirectlyhealthindividualoperatingpatternpeoplepercentproblemsqualifiedreducetermsvarywomen
SHARED TOKENS (19): "adults", "age", "behavioral", "category", "dependence", "direct", "directly", "health", "individual", "operating", "pattern", "people", "percent", "problems", "qualified", "reduce", "terms", "vary", "women". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.500
adultsamongbehavioralcentralcombinedconcerningconditionscontrolleddepartmentdependenceenvironmentexposurefacilitiesfrequentlygovernmenthealthlistlong-termmajormedical
SHARED TOKENS (36): "adults", "among", "behavioral", "central", "combined", "concerning", "conditions", "controlled", "department", "dependence", "environment", "exposure", "facilities", "frequently", "government", "health", "list", "long-term", "major", "medical".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
accessbegandatadecadesdevelopmentdigitaldividedearlyformfurtherindependentindividualinformationmeansmediamediumreducedsingletechnologyusers
SHARED TOKENS (20): "access", "began", "data", "decades", "development", "digital", "divided", "early", "form", "further", "independent", "individual", "information", "means", "media", "medium", "reduced", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
activeaddressescomprehensivedailydischargefacilitiesfacilitygrouphealthhospitalindividualoperatesparticipationprogramprogramsrequireresidentialscalesmallstrategies
SHARED TOKENS (25): "active", "addresses", "comprehensive", "daily", "discharge", "facilities", "facility", "group", "health", "hospital", "individual", "operates", "participation", "program", "programs", "require", "residential", "scale", "small", "strategies".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcarecertificationclinicalcredentialsdemandeducationfunctioninghealthhealthcareimproveplanpracticepractitionersproblemsprovidersprovidingpublicqualifiedquality
SHARED TOKENS (28): "act", "care", "certification", "clinical", "credentials", "demand", "education", "functioning", "health", "healthcare", "improve", "plan", "practice", "practitioners", "problems", "providers", "providing", "public", "qualified", "quality".... | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
Private equity ↗ EXACT TITLE
activebusinesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancialfinancingfundsgeneralinvestmentlimitedlong-termmanagementoperationalownershipprivate
SHARED TOKENS (30): "active", "business", "capital", "category", "changes", "control", "described", "development", "expansion", "financial", "financing", "funds", "general", "investment", "limited", "long-term", "management", "operational", "ownership", "private".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
agenciesbuildingsbuiltdepartmentsdesigndistinguishenvironmentgovernmentinfrastructurelocallymaintenancemunicipalnationalplaceprivateprofessionalpublicsectorsystems
SHARED TOKENS (19): "agencies", "buildings", "built", "departments", "design", "distinguish", "environment", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "place", "private", "professional", "public", "sector", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
approximatelyblockboardbusinessdailydirectlyexecutivefederalfiscalfoundedlimitedmetropolitannationalnetworkoperateoperatesoperatororganizationownedreporting
SHARED TOKENS (27): "approximately", "block", "board", "business", "daily", "directly", "executive", "federal", "fiscal", "founded", "limited", "metropolitan", "national", "network", "operate", "operates", "operator", "organization", "owned", "reporting".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicadaboardboisecanyoncollegecommunitycomprehensivecountiesdevelopmenteasterneducationgovernedidahonampapopulationprimaryprogramspublicreported
SHARED TOKENS (29): "academic", "ada", "board", "boise", "canyon", "college", "community", "comprehensive", "counties", "development", "eastern", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
absenceacademicaccessagenciesagreementalonearchivecodecommunityconstitutedatadevelopmentestablishedfailfullfundingfurthergoverninggovernmentshistory
SHARED TOKENS (47): "absence", "academic", "access", "agencies", "agreement", "alone", "archive", "code", "community", "constitute", "data", "development", "established", "fail", "full", "funding", "further", "governing", "governments", "history".... | EXACT TITLE in transportation_infrastructure: "Data sharing".
0.500
careconsumerscontrolcreatesdistributionenvironmentalevenhealthhealthcareindividualsinformationmanagementmedicalopportunitiesorganizationspeopleremainsafescalesystem
SHARED TOKENS (24): "care", "consumers", "control", "creates", "distribution", "environmental", "even", "health", "healthcare", "individuals", "information", "management", "medical", "opportunities", "organizations", "people", "remain", "safe", "scale", "system".... | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
accessadministrationaffectedapproximatelycannotconditiondependdependenceincreasingindividualindividualsindustrypartlypeoplepermanentprovidingrecommendedreducesafesmall
SHARED TOKENS (24): "access", "administration", "affected", "approximately", "cannot", "condition", "depend", "dependence", "increasing", "individual", "individuals", "industry", "partly", "people", "permanent", "providing", "recommended", "reduce", "safe", "small".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.500
agenciesapplycomprehensivedesignfacilitiesfuturegovernmentinfluencemovementneedspeopleplanningpoliciesprivateprocesspublicsitingsystemtransporttransportation
SHARED TOKENS (20): "agencies", "apply", "comprehensive", "design", "facilities", "future", "government", "influence", "movement", "needs", "people", "planning", "policies", "private", "process", "public", "siting", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcommunitydailydesigneddestinationdevelopeddischargedriverseconomicextendsformformalgovernmentlocalmetropolitanoperateoperatedoperates
SHARED TOKENS (37): "access", "agencies", "beyond", "community", "daily", "designed", "destination", "developed", "discharge", "drivers", "economic", "extends", "form", "formal", "government", "local", "metropolitan", "operate", "operated", "operates".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
Culvert ↗ Q4168092 EXACT TITLE
designedembeddedfrequentlyitselfmaterialneedperformanceplacingpracticeprocessrequirementsselectionshapestructure
SHARED TOKENS (14): "designed", "embedded", "frequently", "itself", "material", "need", "performance", "placing", "practice", "process", "requirements", "selection", "shape", "structure". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.480
canyonemergencygeneralhomeidahomissionmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (14): "canyon", "emergency", "general", "home", "idaho", "mission", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.480
carecommunitycoordinationgeneralhealthindividualslawlegalmanagementmedicalplansspecificsystemtreatment
SHARED TOKENS (14): "care", "community", "coordination", "general", "health", "individuals", "law", "legal", "management", "medical", "plans", "specific", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Case management".
0.480
acquisitionsextendsformformationhistoryindependentinternationallatermajornetworkoperatesoperatingprincipalregional
SHARED TOKENS (14): "acquisitions", "extends", "form", "formation", "history", "independent", "international", "later", "major", "network", "operates", "operating", "principal", "regional". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.480
demandeconomicemergencyformalgovernmenthomehousingindexlocalmarketsnationalownershipresponsesupply
SHARED TOKENS (14): "demand", "economic", "emergency", "formal", "government", "home", "housing", "index", "local", "markets", "national", "ownership", "response", "supply". | EXACT TITLE in substance_use_recovery: "Affordable housing".
0.480
blockbodyfederalgeneralgovernmentgrantgrantsimplementingoversightprogramsregionalrevenuespecifiedterms
SHARED TOKENS (14): "block", "body", "federal", "general", "government", "grant", "grants", "implementing", "oversight", "programs", "regional", "revenue", "specified", "terms". | EXACT TITLE in substance_use_recovery: "Block grant".
0.480
controldefinitionsdifferenteducationformincreasinginformationlegallylicensemeaningmedicalpatientpotentialrequiring
SHARED TOKENS (14): "control", "definitions", "different", "education", "form", "increasing", "information", "legally", "license", "meaning", "medical", "patient", "potential", "requiring". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.460
activecommunitydepartmentsdevelopeddifferentfundinghealthhousingindividualsintendedpeopleprofessionalwork
SHARED TOKENS (13): "active", "community", "departments", "developed", "different", "funding", "health", "housing", "individuals", "intended", "people", "professional", "work". | EXACT TITLE in substance_use_recovery: "Supportive housing".
0.460
Naltrexone ↗ Q409587 EXACT TITLE
amongapprovedlistmedicalmodelpeoplerecommendedsafesidesoldthemthoughtreatment
SHARED TOKENS (13): "among", "approved", "list", "medical", "model", "people", "recommended", "safe", "side", "sold", "them", "though", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.440
communitydistinctformfreegrouppeopleprogramsreceivingrequirementsschoolwayswork
SHARED TOKENS (12): "community", "distinct", "form", "free", "group", "people", "programs", "receiving", "requirements", "school", "ways", "work". | EXACT TITLE in substance_use_recovery: "Community service".
0.440
administrationagencydepartmentdivisionfederalmajorofficeprogramprogramspublicroletransportation
SHARED TOKENS (12): "administration", "agency", "department", "division", "federal", "major", "office", "program", "programs", "public", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.420
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlocalmovementplaceprimaryprivatepublicwhose
SHARED TOKENS (11): "access", "another", "design", "distinction", "local", "movement", "place", "primary", "private", "public", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in substance_use_recovery: "Road".
0.420
associationcreatedenvironmentalfrequentlymultiplepeoplerightsruralserveservesusers
SHARED TOKENS (11): "association", "created", "environmental", "frequently", "multiple", "people", "rights", "rural", "serve", "serves", "users". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.420
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalimplementationmediumnetworkrequirementstechnologyuses
SHARED TOKENS (11): "access", "context", "data", "different", "digital", "implementation", "medium", "network", "requirements", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.420
articlecontrolsdesigndifferentmajormeetpracticereflectsseparatespecifieduses
SHARED TOKENS (11): "article", "controls", "design", "different", "major", "meet", "practice", "reflects", "separate", "specified", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.400
Utility ↗ Q466707 EXACT TITLE
amongbehaviorcontextdevelopeddistinctfunctionfunctionsmaintainingrelationshipsource
SHARED TOKENS (10): "among", "behavior", "context", "developed", "distinct", "function", "functions", "maintaining", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.400
Pedestrian ↗ Q221488 EXACT TITLE
creatingearlyhistoricallynetworkpeopleprofessionalrecordruralsafetytransport
SHARED TOKENS (10): "creating", "early", "historically", "network", "people", "professional", "record", "rural", "safety", "transport". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.400
Relapse ↗ Q2292472 EXACT TITLE
activitybehaviorconditiondependencedevelopedformindividualsmedicalmultiplerecovery
SHARED TOKENS (10): "activity", "behavior", "condition", "dependence", "developed", "form", "individuals", "medical", "multiple", "recovery". | EXACT TITLE in substance_use_recovery: "Relapse".
0.400
Warehouse ↗ Q181623 EXACT TITLE
buildingbuildingsdesigneddirectlyfacilityfunctionmaterialsproductionstandardtransport
SHARED TOKENS (10): "building", "buildings", "designed", "directly", "facility", "function", "materials", "production", "standard", "transport". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.360
bodycapableevidencelimitedlivinglong-termpractitionerssupporting
SHARED TOKENS (8): "body", "capable", "evidence", "limited", "living", "long-term", "practitioners", "supporting". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.360
movementpermitroutesstandardsystemthoughtransportuses
SHARED TOKENS (8): "movement", "permit", "routes", "standard", "system", "though", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.360
boiseeasternexpansionformeridahooperatingservethough
SHARED TOKENS (8): "boise", "eastern", "expansion", "former", "idaho", "operating", "serve", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.360
emergencyhousinglong-termpeoplepermanentpopulationresidentssupport
SHARED TOKENS (8): "emergency", "housing", "long-term", "people", "permanent", "population", "residents", "support". | EXACT TITLE in substance_use_recovery: "Transitional housing".
0.340
Floodplain ↗ Q193110 EXACT TITLE
bodycontroldevelopeddischargefrequentlyincreasingvalley
SHARED TOKENS (7): "body", "control", "developed", "discharge", "frequently", "increasing", "valley". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare".
0.300
administeredamonganotherdependenceenvironmentalfunctioningindividuallowermaintenancepeopleprogramsqualityratesreductionretentiontreatment
SHARED TOKENS (16): "administered", "among", "another", "dependence", "environmental", "functioning", "individual", "lower", "maintenance", "people", "programs", "quality", "rates", "reduction", "retention", "treatment".
0.300
accesscostsdestinationdirectgeneralgroupintendedinternationalitselflogisticsmaterialoperatingpracticepracticesregionrollingspecializedtransporttransportationunion
SHARED TOKENS (21): "access", "costs", "destination", "direct", "general", "group", "intended", "international", "itself", "logistics", "material", "operating", "practice", "practices", "region", "rolling", "specialized", "transport", "transportation", "union"....
0.300
agreementbegancannotcaredirecthealthhealthcaremedicalmodelplanspracticepractitionerpresentprincipalproviderprovidersqualifiedrequiringservesignificant
SHARED TOKENS (25): "agreement", "began", "cannot", "care", "direct", "health", "healthcare", "medical", "model", "plans", "practice", "practitioner", "present", "principal", "provider", "providers", "qualified", "requiring", "serve", "significant"....
0.300
Family therapy ↗ Q870449 KW CROSS HIGH
behaviordevelopeddevelopmentdifferentdirectearlyindividualinfluenceinteractioninvolvinglong-termparticipationpeopleproblemrelationshipsschoolsskillsstudysupportsystem
SHARED TOKENS (22): "behavior", "developed", "development", "different", "direct", "early", "individual", "influence", "interaction", "involving", "long-term", "participation", "people", "problem", "relationships", "schools", "skills", "study", "support", "system"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaffectsbehaviorbehavioralchangesclinicalcommunityconditioncontextdifferentdisabilityearlyfunctioningfunctionshealthhospitalsincreaseindividualleadingmajor
SHARED TOKENS (36): "affect", "affects", "behavior", "behavioral", "changes", "clinical", "community", "condition", "context", "different", "disability", "early", "functioning", "functions", "health", "hospitals", "increase", "individual", "leading", "major"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencybecomebuildingcommercialcostsdescribeddevelopmentenvironmentenvironmentalexpansionformhousinginfrastructuremaintainingpeopleplanningpopulationprivateratesrequire
SHARED TOKENS (27): "agency", "become", "building", "commercial", "costs", "described", "development", "environment", "environmental", "expansion", "form", "housing", "infrastructure", "maintaining", "people", "planning", "population", "private", "rates", "require"....
0.300
adoptedanotherapplyarticleauthorityauthorizedboardcapacityclinicalconditionsdecisionsdefinitionsdisabilityevidenceformfreehealthcareimpactindividualinformation
SHARED TOKENS (49): "adopted", "another", "apply", "article", "authority", "authorized", "board", "capacity", "clinical", "conditions", "decisions", "definitions", "disability", "evidence", "form", "free", "healthcare", "impact", "individual", "information"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actbecomecarecontractingcontrollingcontrolscostcostsdividedearlyeconomicgrouphealthhealthcareimpactimplementationimprovinginsuranceintendedmaintenance
SHARED TOKENS (34): "act", "become", "care", "contracting", "controlling", "controls", "cost", "costs", "divided", "early", "economic", "group", "health", "healthcare", "impact", "implementation", "improving", "insurance", "intended", "maintenance"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activityadultsarticleassistedcannotcareconditionearlyfacilitiesfacilitygrouphealthhomehouseindividualslivingmedicalmodelneedneeds
SHARED TOKENS (28): "activity", "adults", "article", "assisted", "cannot", "care", "condition", "early", "facilities", "facility", "group", "health", "home", "house", "individuals", "living", "medical", "model", "need", "needs"....
0.300
Cocaine ↗ Q41576 KW CROSS HIGH
administrationaffectbackbegancentralcompetecontrolcostdependencedevelopmentexposurehistoricallyinternationallegallimitedlocalmarketmedicalpotentialproducing
SHARED TOKENS (31): "administration", "affect", "back", "began", "central", "compete", "control", "cost", "dependence", "development", "exposure", "historically", "international", "legal", "limited", "local", "market", "medical", "potential", "producing"....
0.300
accessactivebodyburdencapacitycommunitycreateeducationenforcementhealthhealthcareimpactindexinternationalmeasuresproblemproductsqualityreduceregulations
SHARED TOKENS (33): "access", "active", "body", "burden", "capacity", "community", "create", "education", "enforcement", "health", "healthcare", "impact", "index", "international", "measures", "problem", "products", "quality", "reduce", "regulations"....
0.300
actcaredevelopedemployersenactedfacilityhealthincreaseinstitutionsinsurancemaintainingmanagementmedicalpatientpeoplepracticeprovidersrecordsreducesecurity
SHARED TOKENS (22): "act", "care", "developed", "employers", "enacted", "facility", "health", "increase", "institutions", "insurance", "maintaining", "management", "medical", "patient", "people", "practice", "providers", "records", "reduce", "security"....
0.300
behavioralconditionsdependencefinancialgenerallegalmedicalparticipationpatientpeoplepresentprocessrecoveryrehabilitationtrainedtreatment
SHARED TOKENS (16): "behavioral", "conditions", "dependence", "financial", "general", "legal", "medical", "participation", "patient", "people", "present", "process", "recovery", "rehabilitation", "trained", "treatment".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
becomecentraldesignenvironmentfullincreaseintegrationlowermakesneedreducereducedrequireresearchrulessafetysignificantthemwork
SHARED TOKENS (19): "become", "central", "design", "environment", "full", "increase", "integration", "lower", "makes", "need", "reduce", "reduced", "require", "research", "rules", "safety", "significant", "them", "work".
0.300
creatingdemanddisabilityformfunctionsmedicalmovementneedsnetworkolderpeopleprivateprogramspublicratherrelevantroutesruraltechnologytransit
SHARED TOKENS (22): "creating", "demand", "disability", "form", "functions", "medical", "movement", "needs", "network", "older", "people", "private", "programs", "public", "rather", "relevant", "routes", "rural", "technology", "transit"....
0.300
acceptedactadministrationagainstagenciesagencyanotherassociationauthorityauthorizedbackcommunitycompletecomprehensiveconsolidationcontrolcontrolledcreatesdatadepartment
SHARED TOKENS (64): "accepted", "act", "administration", "against", "agencies", "agency", "another", "association", "authority", "authorized", "back", "community", "complete", "comprehensive", "consolidation", "control", "controlled", "creates", "data", "department"....
0.300
administeredavailabilitybehaviordifferentenforcementformfutureintendedlawleadingoperationsprogramrehabilitationsystemsystems
SHARED TOKENS (15): "administered", "availability", "behavior", "different", "enforcement", "form", "future", "intended", "law", "leading", "operations", "program", "rehabilitation", "system", "systems".
0.300
Heroin ↗ Q60168 KW CROSS HIGH
administrationamongapproximatelybehavioralclinicalcontextcontrolledformfunctionhistorylicenselong-termpeoplepercentpossessproductionsidesinglesoldtreatment
SHARED TOKENS (21): "administration", "among", "approximately", "behavioral", "clinical", "context", "controlled", "form", "function", "history", "license", "long-term", "people", "percent", "possess", "production", "side", "single", "sold", "treatment"....
0.300
ageassociationbehavioralconditioncontinuedcurrentdailydependencedifferentgrouphealthhistoryhomeindividuallivinglong-termmedicalpeopleproblemsprofessional
SHARED TOKENS (29): "age", "association", "behavioral", "condition", "continued", "current", "daily", "dependence", "different", "group", "health", "history", "home", "individual", "living", "long-term", "medical", "people", "problems", "professional"....
0.300
administeredagencyagreementamongassociationbusinesscarecentralcommunitycostscoveragecoveredcoveringdisabilityentityevidencegovernmenthealthindividualindividuals
SHARED TOKENS (35): "administered", "agency", "agreement", "among", "association", "business", "care", "central", "community", "costs", "coverage", "covered", "covering", "disability", "entity", "evidence", "government", "health", "individual", "individuals"....
0.300
awaybuiltcenterscentralchangesconsequencedevelopmenteconomicenvironmentalexpansionformationmodelmovementpatternsperipheralpopulationpopulationsprocessresidentsrural
SHARED TOKENS (23): "away", "built", "centers", "central", "changes", "consequence", "development", "economic", "environmental", "expansion", "formation", "model", "movement", "patterns", "peripheral", "population", "populations", "process", "residents", "rural"....
0.300
anotherapprovedauthoritybecomecareclinicalcompetencecontrolcontrolleddirecteducationevidenceexaminedfinancialformalgeneralhealthhealthcareinvestmentmaintaining
SHARED TOKENS (45): "another", "approved", "authority", "become", "care", "clinical", "competence", "control", "controlled", "direct", "education", "evidence", "examined", "financial", "formal", "general", "health", "healthcare", "investment", "maintaining"....
0.300
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongapprovedcontrolleddevelopedequivalentformitselfmedicalproductionrecommendedrequiresidesoldsupplywork
SHARED TOKENS (15): "among", "approved", "controlled", "developed", "equivalent", "form", "itself", "medical", "production", "recommended", "require", "side", "sold", "supply", "work".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcommunitiesconnectingdifferenthourmediummetropolitanmultipleoperateoperatesregionalsystemstransittransportzone
SHARED TOKENS (16): "business", "central", "communities", "connecting", "different", "hour", "medium", "metropolitan", "multiple", "operate", "operates", "regional", "systems", "transit", "transport", "zone".
0.300
accessaffectagenciesarticlebeyondcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationenvironmentenvironmentalevenfreefuture
SHARED TOKENS (65): "access", "affect", "agencies", "article", "beyond", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "environment", "environmental", "even", "free", "future"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
behaviorcontrolcriticaldriversenforcementhealthidentifiedimpactimproveimprovingmeasuresmethodsoccupationalpracticesproduceprovidingpublicreductionremainrequiring
SHARED TOKENS (32): "behavior", "control", "critical", "drivers", "enforcement", "health", "identified", "impact", "improve", "improving", "measures", "methods", "occupational", "practices", "produce", "providing", "public", "reduction", "remain", "requiring"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisapplicationclinicalcollectionconditionconditionsdatadecisionsdescriptiondesigndistinctiondistributionenvironmentalexaminedexposurefunctiongeneralhealthhealthcare
SHARED TOKENS (42): "among", "analysis", "application", "clinical", "collection", "condition", "conditions", "data", "decisions", "description", "design", "distinction", "distribution", "environmental", "examined", "exposure", "function", "general", "health", "healthcare"....
0.300
blockbuildingbusinesscentercentraldesigneddevelopmentformincreasenetworkplanningprivateproblempublicrelationshipresidentialscaleservingspacetransit
SHARED TOKENS (21): "block", "building", "business", "center", "central", "designed", "development", "form", "increase", "network", "planning", "private", "problem", "public", "relationship", "residential", "scale", "serving", "space", "transit"....
0.300
academicacquisitionapplicationapplicationsbehaviorcarecontextdatadesigndevelopmentembeddedhealthhealthcarehospitalsimplementationimproveinformationinstitutionslibrarymanagement
SHARED TOKENS (28): "academic", "acquisition", "application", "applications", "behavior", "care", "context", "data", "design", "development", "embedded", "health", "healthcare", "hospitals", "implementation", "improve", "information", "institutions", "library", "management"....
0.300
actauthorizedcareconcerningcoveragecoveredemployersenactedentityfederalgrouphealthhealthcareindividualsinformationinsurancelawlimitedmedicalnational
SHARED TOKENS (32): "act", "authorized", "care", "concerning", "coverage", "covered", "employers", "enacted", "entity", "federal", "group", "health", "healthcare", "individuals", "information", "insurance", "law", "limited", "medical", "national"....
0.300
activityadultsaffectedagainstamongcentralcontainingcontainsdependencedistinctdividedgrouphealthindustrylegallong-termmovementnewsorganizationproduce
SHARED TOKENS (24): "activity", "adults", "affected", "against", "among", "central", "containing", "contains", "dependence", "distinct", "divided", "group", "health", "industry", "legal", "long-term", "movement", "news", "organization", "produce"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
administeradministeredadministrationaffectamongapproximatelybegancentraldependencedevelopeddirectlyfrequentlyhealthincreaselaborlistlong-termmarketingmethodsmultiple
SHARED TOKENS (28): "administer", "administered", "administration", "affect", "among", "approximately", "began", "central", "dependence", "developed", "directly", "frequently", "health", "increase", "labor", "list", "long-term", "marketing", "methods", "multiple"....
0.300
agenciesauthorizedcarecontrolleddatadatabaseenforcementestablishedevidencefederallyhealthidentifyinglawlicensingmonitoringmultiplepractitionersprogramprogramsproviders
SHARED TOKENS (29): "agencies", "authorized", "care", "controlled", "data", "database", "enforcement", "established", "evidence", "federally", "health", "identifying", "law", "licensing", "monitoring", "multiple", "practitioners", "program", "programs", "providers"....
0.300
accessibleadministrationageagencyanotherawaybuildingcenterscommercialdepartmentdistributiondivisiondriverseducationenvironmentalfederalgoverninghandlinghealthhome
SHARED TOKENS (44): "accessible", "administration", "age", "agency", "another", "away", "building", "centers", "commercial", "department", "distribution", "division", "drivers", "education", "environmental", "federal", "governing", "handling", "health", "home"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecreateddifferentestatefacilityfullgovernmentlegallocaloperateownershippeopleprivaterealrestrictedrightsroutesspecificthem
SHARED TOKENS (22): "authority", "capable", "created", "different", "estate", "facility", "full", "government", "legal", "local", "operate", "ownership", "people", "private", "real", "restricted", "rights", "routes", "specific", "them"....
0.300
analysiscareclinicalcollectioncurrentdatadecisionsevidencehealthhealthcareimprovingindividualinformationmakingmanagementmeanspatientpracticepublicresearch
SHARED TOKENS (21): "analysis", "care", "clinical", "collection", "current", "data", "decisions", "evidence", "health", "healthcare", "improving", "individual", "information", "making", "management", "means", "patient", "practice", "public", "research"....
0.300
addressingadministeredauthorizedconcerningcreateddepartmenteducationexecutivefederalfundinggeneralgovernmenthealthhealthcaremattersmedicalmissionprimaryprivateproviding
SHARED TOKENS (25): "addressing", "administered", "authorized", "concerning", "created", "department", "education", "executive", "federal", "funding", "general", "government", "health", "healthcare", "matters", "medical", "mission", "primary", "private", "providing"....
0.300
acceptedactapplicableassociationauthoritybehaviorcentralchangescommunitiescommunitycomprehensiveconditionsconflictscostscreatingdependdependsdesigndevelopmenteconomic
SHARED TOKENS (53): "accepted", "act", "applicable", "association", "authority", "behavior", "central", "changes", "communities", "community", "comprehensive", "conditions", "conflicts", "costs", "creating", "depend", "depends", "design", "development", "economic"....
0.300
conditionsenvironmentfacilitieshousehousinglivingpeopleprogramprogramsrecoveryrehabilitationsafeservesocietystructured
SHARED TOKENS (15): "conditions", "environment", "facilities", "house", "housing", "living", "people", "program", "programs", "recovery", "rehabilitation", "safe", "serve", "society", "structured".
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecommunitiesconditioncreatecreatescurrentdecadesdescribesdevelopeddevelopmenteconomiceducationenvironmentalequivalenthealthimpactincreaseincreasing
SHARED TOKENS (50): "approximately", "architecture", "become", "communities", "condition", "create", "creates", "current", "decades", "describes", "developed", "development", "economic", "education", "environmental", "equivalent", "health", "impact", "increase", "increasing"....
0.300
addinganotherarticlebecomecapacityconditiondemanddepartmentsdriversincreasinginteractionplanningpublictransporttransportation
SHARED TOKENS (15): "adding", "another", "article", "become", "capacity", "condition", "demand", "departments", "drivers", "increasing", "interaction", "planning", "public", "transport", "transportation".
0.300
accessadministrationagencyannouncedassociationcapacitycenterschangescontroldepartmentdesigneddisabilityenvironmentalfederalfoodgovernmenthealthimproveinformationinstitute
SHARED TOKENS (36): "access", "administration", "agency", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "disability", "environmental", "federal", "food", "government", "health", "improve", "information", "institute"....
0.300
alongsidecapacitycapitalconnectingcostdailydesigndesignedlowernetworkpublicqualityreducesinglesystemsystemstransittransportation
SHARED TOKENS (18): "alongside", "capacity", "capital", "connecting", "cost", "daily", "design", "designed", "lower", "network", "public", "quality", "reduce", "single", "system", "systems", "transit", "transportation".
0.300
adoptedapplicationcapacitychangescollectionconditionscoordinateddifferentemergencyimproveincreaseinformationinfrastructuremanagementreducesafetysystemsystemstechnologytransport
SHARED TOKENS (23): "adopted", "application", "capacity", "changes", "collection", "conditions", "coordinated", "different", "emergency", "improve", "increase", "information", "infrastructure", "management", "reduce", "safety", "system", "systems", "technology", "transport"....
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
adultsbehaviorclinicalconditionconditionscontrolleddesigneddifferentdriversgeneralhealthimproveincreaseindividualinteractioninvolvingitselfleadinglegallylicensed
SHARED TOKENS (40): "adults", "behavior", "clinical", "condition", "conditions", "controlled", "designed", "different", "drivers", "general", "health", "improve", "increase", "individual", "interaction", "involving", "itself", "leading", "legally", "licensed"....
0.300
actageapplicantsbackbudgetcannotcarechangesconditionscostscoveragecoverededucationeligibilityenactedexpandedexpansionfederalfundinghealth
SHARED TOKENS (55): "act", "age", "applicants", "back", "budget", "cannot", "care", "changes", "conditions", "costs", "coverage", "covered", "education", "eligibility", "enacted", "expanded", "expansion", "federal", "funding", "health"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthorityauthorizedbecomeconditionsevenevidencegovernmentitselflawmovementopenpeopleplaceplacingpolicepositionprovisionsratesrights
SHARED TOKENS (20): "against", "authority", "authorized", "become", "conditions", "even", "evidence", "government", "itself", "law", "movement", "open", "people", "place", "placing", "police", "position", "provisions", "rates", "rights".
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
adultsageauthoritybehaviorbroadcapacitychangesconcerningcontextcreatedatadevelopmentearlyfurthergeneralimplementationimplementinginternationallegallocally
SHARED TOKENS (37): "adults", "age", "authority", "behavior", "broad", "capacity", "changes", "concerning", "context", "create", "data", "development", "early", "further", "general", "implementation", "implementing", "international", "legal", "locally"....
0.300
activeactivityamongavailabilitybeyondcentralchangescontrolleddependencedistributionfreefunctionincreaseinvolvingliabilitylimitsplacementpossesspotentialproduction
SHARED TOKENS (30): "active", "activity", "among", "availability", "beyond", "central", "changes", "controlled", "dependence", "distribution", "free", "function", "increase", "involving", "liability", "limits", "placement", "possess", "potential", "production"....
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
affectedbecomecriticaldevelopedhealthidentificationidentifyingimplementinformationlaterlegallylimitslocalnationalpeopleprogramspublicreducereductionrisks
SHARED TOKENS (29): "affected", "become", "critical", "developed", "health", "identification", "identifying", "implement", "information", "later", "legally", "limits", "local", "national", "people", "programs", "public", "reduce", "reduction", "risks"....
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
accommodationaddressesaffectagainstcarecommunitycomprehensivecostdecadesdifferenteducationemergencyemploymentevidenceformgovernmenthealthcarehospitalshousehousing
SHARED TOKENS (48): "accommodation", "addresses", "affect", "against", "care", "community", "comprehensive", "cost", "decades", "different", "education", "emergency", "employment", "evidence", "form", "government", "healthcare", "hospitals", "house", "housing"....
0.300
adultsaffectedapplicationcarecostdecisionsdisabilityeducationenvironmentalevenhealthhealthcarehomeidentifyincreaseindexindividualindividualsinformationleading
SHARED TOKENS (33): "adults", "affected", "application", "care", "cost", "decisions", "disability", "education", "environmental", "even", "health", "healthcare", "home", "identify", "increase", "index", "individual", "individuals", "information", "leading"....
0.300
approvalassociationcontextdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactindividualsinternationalmajormakingmanagementparticipationplanplanspolicies
SHARED TOKENS (33): "approval", "association", "context", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "individuals", "international", "major", "making", "management", "participation", "plan", "plans", "policies"....
0.300
acquisitionacquisitionsactactivityanotherbusinesscapitalcentralcombinedconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentityexpandfederal
SHARED TOKENS (43): "acquisition", "acquisitions", "act", "activity", "another", "business", "capital", "central", "combined", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entity", "expand", "federal"....
0.300
accessbuiltcapacitycentralchangesconflictsconnectconnectedconnectingcontainingdecadesdesignedevenfreeincreasinglimitsnetworkparkingplansregulated
SHARED TOKENS (27): "access", "built", "capacity", "central", "changes", "conflicts", "connect", "connected", "connecting", "containing", "decades", "designed", "even", "free", "increasing", "limits", "network", "parking", "plans", "regulated"....
0.300
agencyapprovedbegandecemberdepartmenteducationenforcementenvironmentalequivalentestablishingexecutivefederalfederallyfinancialgovernmentgovernmentshouseindependentinformationlegal
SHARED TOKENS (35): "agency", "approved", "began", "december", "department", "education", "enforcement", "environmental", "equivalent", "establishing", "executive", "federal", "federally", "financial", "government", "governments", "house", "independent", "information", "legal"....
0.300
associationbehaviorbehavioralcannotcodecontroldevelopedfoundedmakingorganizationsproblemsprocessprogramprogramsrecoverysupporting
SHARED TOKENS (16): "association", "behavior", "behavioral", "cannot", "code", "control", "developed", "founded", "making", "organizations", "problems", "process", "program", "programs", "recovery", "supporting".
0.300
applybehavioralfederalgovernmenthealthimproveindividualinstituteknowledgemissionnationalpublicresearchstudysupplywhose
SHARED TOKENS (16): "apply", "behavioral", "federal", "government", "health", "improve", "individual", "institute", "knowledge", "mission", "national", "public", "research", "study", "supply", "whose".
0.300
Snake River ↗ Q272074 KW CROSS HIGH
ageagenciescanyoncentralcommercialcontrolcoveredcreateddecadesdevelopedeasternfallsfurthergovernmentshistoryidaholeadinglimitedlowermajor
SHARED TOKENS (34): "age", "agencies", "canyon", "central", "commercial", "control", "covered", "created", "decades", "developed", "eastern", "falls", "further", "governments", "history", "idaho", "leading", "limited", "lower", "major"....
0.300
departmentdepartmentsdirectlyexecutivefederalfiscalgovernmentleadingmissionmovementpeopleplanreportssafeservingstrategicsystemtransportation
SHARED TOKENS (18): "department", "departments", "directly", "executive", "federal", "fiscal", "government", "leading", "mission", "movement", "people", "plan", "reports", "safe", "serving", "strategic", "system", "transportation".
0.300
actapplicablecodeconcerningdevelopmentdifferentenactedenforcementexpandedfederalfinancingfundinghousinglawlegislationmakesnationalpeopleprivateprograms
SHARED TOKENS (26): "act", "applicable", "code", "concerning", "development", "different", "enacted", "enforcement", "expanded", "federal", "financing", "funding", "housing", "law", "legislation", "makes", "national", "people", "private", "programs"....
0.300
combinedconnectsconsumerscurrentdirectdirectlydistinctdistributioneasternevenformhandlinghistoricallyincreaseindustrylocallowermajormarketmovement
SHARED TOKENS (29): "combined", "connects", "consumers", "current", "direct", "directly", "distinct", "distribution", "eastern", "even", "form", "handling", "historically", "increase", "industry", "local", "lower", "major", "market", "movement"....
0.300
Snowplow ↗ Q14976 EXACT TITLE
frequentlyintendedservingspecifictransportation
SHARED TOKENS (5): "frequently", "intended", "serving", "specific", "transportation". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.300
buildingconditionscontainingcreatesenvironmentevenhealthidentificationmaterialspeoplepersonnelpublicregulationsriskssafetyspecificsubjectsystemthemtrained
SHARED TOKENS (21): "building", "conditions", "containing", "creates", "environment", "even", "health", "identification", "materials", "people", "personnel", "public", "regulations", "risks", "safety", "specific", "subject", "system", "them", "trained"....
0.300
announcedapprovedcentercreatefoundeditselflaternetworkoperatesoperatingplansprincipalreportingroutessystemtransportationunionwestern
SHARED TOKENS (18): "announced", "approved", "center", "create", "founded", "itself", "later", "network", "operates", "operating", "plans", "principal", "reporting", "routes", "system", "transportation", "union", "western".
0.300
accessactadministrationadoptedapproximatelybeganbuiltcollectioncompletecontinuedcontrolledcostcreatingdecadesdesigndesigneddevelopedequivalentestablishedexpand
SHARED TOKENS (45): "access", "act", "administration", "adopted", "approximately", "began", "built", "collection", "complete", "continued", "controlled", "cost", "creating", "decades", "design", "designed", "developed", "equivalent", "established", "expand"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationadoptedanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycodescommunitiescommunitycreatingdesigndevelopmentdifferentdistributionearly
SHARED TOKENS (62): "administration", "adopted", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "codes", "communities", "community", "creating", "design", "development", "different", "distribution", "early"....
0.300
administrationbehavioralcentralclinicclinicaldevelopeddevelopmentdifferentequivalentfallshealthidahoincreaseintegrationknowledgemastermedicalmethodsmodelmodels
SHARED TOKENS (35): "administration", "behavioral", "central", "clinic", "clinical", "developed", "development", "different", "equivalent", "falls", "health", "idaho", "increase", "integration", "knowledge", "master", "medical", "methods", "model", "models"....
0.300
activityanalysisbecomesboundariesdesigndocumentationenvironmentestablishedgeneralgovernmentlegallegislationlicenselicensedlicensurelocalmaintenanceplanspracticepractitioners
SHARED TOKENS (39): "activity", "analysis", "becomes", "boundaries", "design", "documentation", "environment", "established", "general", "government", "legal", "legislation", "license", "licensed", "licensure", "local", "maintenance", "plans", "practice", "practitioners"....
0.300
academiccollegecommunitydifferenteducationforminstitutionsleadingopenpolicyprogramsschoolseniorstudentsuniversityworkforce
SHARED TOKENS (16): "academic", "college", "community", "different", "education", "form", "institutions", "leading", "open", "policy", "programs", "school", "senior", "students", "university", "workforce".
0.300
behavioralbuiltcommunitydevelopedestablishedfreeinternationalmedicalmethodsmodelorganizationpeopleprofessionalrecoveryseekingsupporttrainedtraining
SHARED TOKENS (18): "behavioral", "built", "community", "developed", "established", "free", "international", "medical", "methods", "model", "organization", "people", "professional", "recovery", "seeking", "support", "trained", "training".
0.300
actadministeradministersadministrationagencycarecenterscertificationclinicaldepartmentfacilitiesfederalfinancinggovgovernmentshealthhealthcarehomeinsurancelong-term
SHARED TOKENS (31): "act", "administer", "administers", "administration", "agency", "care", "centers", "certification", "clinical", "department", "facilities", "federal", "financing", "gov", "governments", "health", "healthcare", "home", "insurance", "long-term"....
0.300
academicapplicationcompatibledesignfacilitiesmanagementmovementoccupationaloperationpeopleplanningsafetechnologytransporttransportation
SHARED TOKENS (15): "academic", "application", "compatible", "design", "facilities", "management", "movement", "occupational", "operation", "people", "planning", "safe", "technology", "transport", "transportation".
0.300
actactiveadministeredagenciesapproximatelyauthorityauthorizedbudgetbuildingbusinesscapacitycombinedconstitutecontroldepartmentdesigndirectdirectlyenvironmentenvironmental
SHARED TOKENS (54): "act", "active", "administered", "agencies", "approximately", "authority", "authorized", "budget", "building", "business", "capacity", "combined", "constitute", "control", "department", "design", "direct", "directly", "environment", "environmental"....
0.300
accessaddressesaffectbeganboardcarecostcostsdevelopedfinancinghealthhealthcareindividualsinformationinstitutionsknowledgemedicalmethodsorganizationorganizational
SHARED TOKENS (36): "access", "addresses", "affect", "began", "board", "care", "cost", "costs", "developed", "financing", "health", "healthcare", "individuals", "information", "institutions", "knowledge", "medical", "methods", "organization", "organizational"....
0.300
administrationannouncedavailabilitybuildingcostdepartmentdirectlydisabilityhealthimprovingqualityreducereportssocietytreatment
SHARED TOKENS (15): "administration", "announced", "availability", "building", "cost", "department", "directly", "disability", "health", "improving", "quality", "reduce", "reports", "society", "treatment".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedbuildingsconnectdevelopmentevenexpandedfinalfullfunctionsgovernmentimpactlaterlegalownershippaymentprivatepublic
SHARED TOKENS (25): "acquisition", "another", "application", "authorized", "buildings", "connect", "development", "even", "expanded", "final", "full", "functions", "government", "impact", "later", "legal", "ownership", "payment", "private", "public"....
0.300
actadministrationannouncedappropriationsauthorizedauthorizesavailabilitycommunitycomprehensiveeducationfederalfundinggrantshealthincreaseintendedlawmajororganizationsprocess
SHARED TOKENS (25): "act", "administration", "announced", "appropriations", "authorized", "authorizes", "availability", "community", "comprehensive", "education", "federal", "funding", "grants", "health", "increase", "intended", "law", "major", "organizations", "process"....
0.300
businesscaredefinesdepartmentfacilityhealthindividualinsurancelicensedmedicalorganizationpaymentsprofessionalproviderproviderstreatment
SHARED TOKENS (16): "business", "care", "defines", "department", "facility", "health", "individual", "insurance", "licensed", "medical", "organization", "payments", "professional", "provider", "providers", "treatment".
0.300
Sidewalk ↗ Q177749 EXACT TITLE
buildingsdesignedprivatesidesouth
SHARED TOKENS (5): "buildings", "designed", "private", "side", "south". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.300
adoptedbeyondcommunitydemonstratingdependencedevelopeddevelopmentdifferentevenexplicitlyhealthindividualslivingmeaningmeasuresmodelmodelsmovementoriginatingpeople
SHARED TOKENS (35): "adopted", "beyond", "community", "demonstrating", "dependence", "developed", "development", "different", "even", "explicitly", "health", "individuals", "living", "meaning", "measures", "model", "models", "movement", "originating", "people"....
0.300
administrationaffectconditionconditionsconsequencedependencedevelopeddifferentevenformgroupindividualslegalmedicalratherrolethemvary
SHARED TOKENS (18): "administration", "affect", "condition", "conditions", "consequence", "dependence", "developed", "different", "even", "form", "group", "individuals", "legal", "medical", "rather", "role", "them", "vary".
0.300
behaviorcontroldemandfederalfoodfundinghealthinvolvingknowledgelegalmedicalpeopleprivatepublicresearchsectortreatment
SHARED TOKENS (17): "behavior", "control", "demand", "federal", "food", "funding", "health", "involving", "knowledge", "legal", "medical", "people", "private", "public", "research", "sector", "treatment".
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdecemberdefinesdepartmentdesigndesigneddevelopeddocumentdriversfederallawlocalnational
SHARED TOKENS (31): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "december", "defines", "department", "design", "designed", "developed", "document", "drivers", "federal", "law", "local", "national"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotcombinedconnectdesigndesigneddestinationevenfallsinfrastructuremunicipalparkingpublicrequireresidentialsmallsystemsvary
SHARED TOKENS (19): "bodies", "buildings", "cannot", "combined", "connect", "design", "designed", "destination", "even", "falls", "infrastructure", "municipal", "parking", "public", "require", "residential", "small", "systems", "vary".
0.300
accessbehavioralcarecenterconditionscontrolleddailydischargeeasternfacilitiesfacilityhealthhealthcarelimitedmakespatientpeoplepopulationspracticeproblems
SHARED TOKENS (33): "access", "behavioral", "care", "center", "conditions", "controlled", "daily", "discharge", "eastern", "facilities", "facility", "health", "healthcare", "limited", "makes", "patient", "people", "populations", "practice", "problems"....
0.300
businesscommunityentityfurtherhospitalslocalmeaningmissionnonprofitoperatedoperatesoperationsorganizationorganizationsprivateprogrampublicratherrevenueschools
SHARED TOKENS (21): "business", "community", "entity", "further", "hospitals", "local", "meaning", "mission", "nonprofit", "operated", "operates", "operations", "organization", "organizations", "private", "program", "public", "rather", "revenue", "schools"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdefinitionsdifferentequivalentformindividuallowermeaningmultipleoperateoperatesoperatingoperationsrollingsystemsystemstechnologytransit
SHARED TOKENS (22): "broader", "capacity", "conditions", "definitions", "different", "equivalent", "form", "individual", "lower", "meaning", "multiple", "operate", "operates", "operating", "operations", "rolling", "system", "systems", "technology", "transit"....
0.300
actadministrationagencyassistedauthoritybegancontrolcurrentdepartmentdirectlyfederalfoodformerhealthmedicalprimaryproductspublicregulatedregulations
SHARED TOKENS (24): "act", "administration", "agency", "assisted", "authority", "began", "control", "current", "department", "directly", "federal", "food", "former", "health", "medical", "primary", "products", "public", "regulated", "regulations"....
0.300
administeredaloneamonganotherconstitutecontrolleddifferenteducationindividualindividualsintendedinvolvinglegallegallymedicalprofessionalprogramprogramsrehabilitationsystem
SHARED TOKENS (20): "administered", "alone", "among", "another", "constitute", "controlled", "different", "education", "individual", "individuals", "intended", "involving", "legal", "legally", "medical", "professional", "program", "programs", "rehabilitation", "system".
0.300
activeassistancecontinuedcontinuouscontrolcostdistinctfreegoverninggrouphealthcareinstitutionslaterneedopenorganizationsprimaryprogrampublicrates
SHARED TOKENS (25): "active", "assistance", "continued", "continuous", "control", "cost", "distinct", "free", "governing", "group", "healthcare", "institutions", "later", "need", "open", "organizations", "primary", "program", "public", "rates"....
0.300
changescommunitiescommunitydecisionsdesignededucationenvironmentalformhealthimproveimprovingindividualindividualsinfluenceinformationinvolvingknowledgenationalopportunitiesorganization
SHARED TOKENS (28): "changes", "communities", "community", "decisions", "designed", "education", "environmental", "form", "health", "improve", "improving", "individual", "individuals", "influence", "information", "involving", "knowledge", "national", "opportunities", "organization"....
0.300
accesscommunitycompletedesigndesignedeconomicenvironmentalhealthhomelivingoperatedpolicypractitionerspublicrequiressafesafetytransportationusers
SHARED TOKENS (19): "access", "community", "complete", "design", "designed", "economic", "environmental", "health", "home", "living", "operated", "policy", "practitioners", "public", "requires", "safe", "safety", "transportation", "users".
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
absenceassociationbehaviorclassificationclinicalcommunityconditionscontrolemploymenthealthhistoricalhistoryindividualindustryinfluenceinstituteinterdisciplinaryinternationalmattersmeasures
SHARED TOKENS (29): "absence", "association", "behavior", "classification", "clinical", "community", "conditions", "control", "employment", "health", "historical", "history", "individual", "industry", "influence", "institute", "interdisciplinary", "international", "matters", "measures"....
🫐 BERRY53 edges
0.280
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedconditionsdeterminedigitalindependentmaintenanceneedsproblemrepairrolespecificwork
SHARED TOKENS (14): "already", "approval", "approved", "conditions", "determine", "digital", "independent", "maintenance", "needs", "problem", "repair", "role", "specific", "work".
0.280
adaboisecanyoncombinedcountieshomeidahomeridianmetropolitannampapercentpopulationtreasurevalley
SHARED TOKENS (14): "ada", "boise", "canyon", "combined", "counties", "home", "idaho", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley".
0.280
alonecategoryconditiongroupindividualsitselfmakingneedspeopleprimaryproblemsratesrestrictedsingle
SHARED TOKENS (14): "alone", "category", "condition", "group", "individuals", "itself", "making", "needs", "people", "primary", "problems", "rates", "restricted", "single".
0.280
carecoordinationhealthmedicalneedspatientplanspracticepractitionerproviderregisteredtrainedtrainingtreatment
SHARED TOKENS (14): "care", "coordination", "health", "medical", "needs", "patient", "plans", "practice", "practitioner", "provider", "registered", "trained", "training", "treatment".
0.280
becomedescribesdevelopedfoundeditselfmajormodelnonprofitorganizationpeopleproblemsocietyuseswomen
SHARED TOKENS (14): "become", "describes", "developed", "founded", "itself", "major", "model", "nonprofit", "organization", "people", "problem", "society", "uses", "women".
0.280
buildingdecisionsidahopresent
SHARED TOKENS (4): "building", "decisions", "idaho", "present". | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
0.280
aggregateconflictscreatingdepartmentdesigneddifferentdividedevenmovementpathwaypermitprimarytransportusers
SHARED TOKENS (14): "aggregate", "conflicts", "creating", "department", "designed", "different", "divided", "even", "movement", "pathway", "permit", "primary", "transport", "users".
0.280
assistanceawaycombinedcreatedevenfacilitieslowerplacepointsrulessafetyschoolseparateusers
SHARED TOKENS (14): "assistance", "away", "combined", "created", "even", "facilities", "lower", "place", "points", "rules", "safety", "school", "separate", "users".
0.280
Traffic light ↗ Q8004 KW CROSS HIGH
capacitycontroldecemberinformationlocalnationalneedpolicereducesouthsystemsystemstechnologyusers
SHARED TOKENS (14): "capacity", "control", "december", "information", "local", "national", "need", "police", "reduce", "south", "system", "systems", "technology", "users".
0.280
Support group ↗ Q3117735 KW CROSS HIGH
advocacyburdencommunityestablishingformgroupinformationpeopleprovidingpublicrelevantstrategiessupportwork
SHARED TOKENS (14): "advocacy", "burden", "community", "establishing", "form", "group", "information", "people", "providing", "public", "relevant", "strategies", "support", "work".
0.260
becomesbehaviorbehavioralexpandedfinancialformframeworkidentifiedindividualprocessrathersolelysystem
SHARED TOKENS (13): "becomes", "behavior", "behavioral", "expanded", "financial", "form", "framework", "identified", "individual", "process", "rather", "solely", "system".
0.260
actcommunitiesenactedfederalhistorylawlegislationmedicalpdfrecoverysinglesupporttreatment
SHARED TOKENS (13): "act", "communities", "enacted", "federal", "history", "law", "legislation", "medical", "pdf", "recovery", "single", "support", "treatment".
0.260
involvingnetworktransportation
SHARED TOKENS (3): "involving", "network", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.240
communitiescommunitydependencedifferentgrouplivinglong-termpatientproblemsrehabilitationresidentialtreatment
SHARED TOKENS (12): "communities", "community", "dependence", "different", "group", "living", "long-term", "patient", "problems", "rehabilitation", "residential", "treatment".
0.240
becomedesigneddistinctinfluenceinformationmarketingprimaryprocessreferralreferralsstrategiessubsequent
SHARED TOKENS (12): "become", "designed", "distinct", "influence", "information", "marketing", "primary", "process", "referral", "referrals", "strategies", "subsequent".
0.240
Oxycodone ↗ Q407535 KW CROSS HIGH
amongdependenceequivalentformhealthlaterlistorganizationproductssidesoldtreatment
SHARED TOKENS (12): "among", "dependence", "equivalent", "form", "health", "later", "list", "organization", "products", "side", "sold", "treatment".
0.220
createuses
SHARED TOKENS (2): "create", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.220
Parole ↗ Q5357120 KW CROSS HIGH
behavioralcomplianceconditionsearlyformoriginatingpeopleplaceratherservingsystem
SHARED TOKENS (11): "behavioral", "compliance", "conditions", "early", "form", "originating", "people", "place", "rather", "serving", "system".
0.210
rehabilitation
SHARED TOKENS (1): "rehabilitation". | EXACT TITLE in transportation_infrastructure: "Rehabilitation". | EXACT TITLE in substance_use_recovery: "Rehabilitation".
0.210
specific
SHARED TOKENS (1): "specific". | EXACT TITLE in substance_use_recovery: "Crisis intervention".
0.200
becomechangesdesigndriversimprovemeasuresrulesafetystrategiesuses
SHARED TOKENS (10): "become", "changes", "design", "drivers", "improve", "measures", "rule", "safety", "strategies", "uses".
0.200
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasterngeneralidahomajornationalofficialparallelruleswestern
SHARED TOKENS (10): "caldwell", "eastern", "general", "idaho", "major", "national", "official", "parallel", "rules", "western".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitannampapopulationruralwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahometropolitanpopulationschoolschools
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "population", "school", "schools".
0.200
awayboisefallshomeidahomajormetropolitanroutesservestwin
SHARED TOKENS (10): "away", "boise", "falls", "home", "idaho", "major", "metropolitan", "routes", "serves", "twin".
0.180
adaboisecanyoncountiesidahometropolitanregiontreasurevalley
SHARED TOKENS (9): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "region", "treasure", "valley".
0.180
Park and ride ↗ Q738031 KW CROSS HIGH
connectionsmarketingmetropolitanparkingpeoplepublicsystemtransittransport
SHARED TOKENS (9): "connections", "marketing", "metropolitan", "parking", "people", "public", "system", "transit", "transport".
0.180
activitybehavioralchangesdependenceenvironmentalexposureforminvolvingrequiring
SHARED TOKENS (9): "activity", "behavioral", "changes", "dependence", "environmental", "exposure", "form", "involving", "requiring".
0.180
designfuturemaintenancematerialsoperationplanningprofessionalstandardstransportation
SHARED TOKENS (9): "design", "future", "maintenance", "materials", "operation", "planning", "professional", "standards", "transportation".
0.180
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeinfrastructurelegallimitsordinaryspecifiedstandardtransporttransportation
SHARED TOKENS (9): "bridge", "infrastructure", "legal", "limits", "ordinary", "specified", "standard", "transport", "transportation".
0.160
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
Recidivism ↗ Q1420643 KW CROSS HIGH
actbehaviorformerfrequentlyindividualmodelrecurringtrained
SHARED TOKENS (8): "act", "behavior", "former", "frequently", "individual", "model", "recurring", "trained".
0.160
Cannabis ↗ Q79817 KW CROSS HIGH
acceptedhistoryoriginatingprincipalproduceproductssingleterms
SHARED TOKENS (8): "accepted", "history", "originating", "principal", "produce", "products", "single", "terms".
0.160
bodycountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "body", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.160
accessconnectingdesignedformerlocalmajorresidentialserves
SHARED TOKENS (8): "access", "connecting", "designed", "former", "local", "major", "residential", "serves".
0.160
costshandlingitselfmultiplereducedsecuritytransporttransportation
SHARED TOKENS (8): "costs", "handling", "itself", "multiple", "reduced", "security", "transport", "transportation".
0.160
agebeganconditiondependencedisabilityemploymentindividualpattern
SHARED TOKENS (8): "age", "began", "condition", "dependence", "disability", "employment", "individual", "pattern".
0.140
improvingplacepolicerightsstatedsystemsystems
SHARED TOKENS (7): "improving", "place", "police", "rights", "stated", "system", "systems".
0.140
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedeasternidaholimitedsouthsystemwestern
SHARED TOKENS (7): "continued", "eastern", "idaho", "limited", "south", "system", "western".
0.140
carecomprehensiveconditionhospitalrequiresrequiringwhose
SHARED TOKENS (7): "care", "comprehensive", "condition", "hospital", "requires", "requiring", "whose".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
commercialenvironmentinternationallogisticsprocessproductstransport
SHARED TOKENS (7): "commercial", "environment", "international", "logistics", "process", "products", "transport".
0.140
Bike lane ↗ Q1378400 KW CROSS HIGH
economicentryimproveresearchrestrictedsafetyshows
SHARED TOKENS (7): "economic", "entry", "improve", "research", "restricted", "safety", "shows".
0.140
canyonconnectingeagleidahomeridiannampavalley
SHARED TOKENS (7): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "valley".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpercentpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "metropolitan", "percent", "population".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
costprogramprovidingreducereductionusers
SHARED TOKENS (6): "cost", "program", "providing", "reduce", "reduction", "users".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
combinedconditiondependenceindividualmedical
SHARED TOKENS (5): "combined", "condition", "dependence", "individual", "medical".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
controlinfluencemultipleoperatingterms
SHARED TOKENS (5): "control", "influence", "multiple", "operating", "terms".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Substance Use Recovery — Treasure Valley
HAIKU · HIGH GATE
How do public transit options in Boise and Nampa affect access to treatment facilities for people in substance use recovery?
Limited public transportation in Ada County and Canyon County creates barriers for individuals traveling to recovery programs, particularly those without personal vehicles. Emergency medical services and treatment centers in Boise often rely on Idaho State Police and EMS networks to reach patients in crisis, yet gaps in regional transit infrastructure delay timely interventions across the metropolitan area.
What role does the Americans with Disabilities Act of 1990 play in ensuring recovery program accessibility across Treasure Valley transportation networks?
The ADA requires public transportation systems serving Boise, Meridian, Caldwell, and Nampa to accommodate individuals with disabilities, including those with mobility challenges related to substance use recovery. Boise State University and Ada County health departments coordinate with transit providers to ensure recovery participants can reliably reach counseling, medical appointments, and support services.
Why is transportation infrastructure investment in Canyon County critical for expanding substance use recovery services?
Canyon County's geographic spread across rural areas surrounding Caldwell and Nampa limits recovery program reach when transportation options remain inadequate. Idaho State Police and emergency medical services data show that improved road access and public transit directly correlate with increased treatment enrollment and reduced crisis interventions in western Treasure Valley communities.
How do Idaho's capital region transportation patterns influence recovery program location decisions in Ada County?
Treatment facilities and recovery services in Boise concentrate near established transit corridors and highways managed by Idaho Department of Transportation, making access unequal for residents in outlying Ada County neighborhoods. Boise State University research identifies transportation deserts as predictive of lower recovery program utilization rates among the metropolitan population.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Substance Use Recovery 12 QID bridges 256 edges 7,181 ext links 2026-07-17 23:43:39 UTC db8d9f57dfad27ae
Transportation Infrastructure corridor ↗ Substance Use Recovery corridor ↗ Substance Use Recovery × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals