—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Wedding Events

21 Wikipedia bridge articles confirmed in both vertical ledgers. 300 deterministic cross-vertical edges. 7,781 external source links harvested. Every edge provenance-stamped. Every claim auditable.

21 QID Bridge Articles
300 Cross Edges
7,781 External Sources
342 Wikipedia Articles
24 🌲 Evergreen
218 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Wedding Events
QID Bridge Articles
21
confirmed Wikipedia overlap
Total Cross Edges
300
External Sources Harvested
7,781
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.1300  ·  type: exact_title_cross  ·  14 shared tokens
QID Bridge Titles (20)
Idaho State PoliceTreasure ValleyBoise, IdahoWarehouseZoningApprenticeshipLogisticsBoise State UniversityBoise AirportCollege of Western IdahoLand-use planningNampa, IdahoRight of wayUnion Pacific RailroadInterstate 84 in IdahoAda County, IdahoCaldwell, IdahoMeridian, IdahoKuna, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadawesternpubliclandlocaldowntownhomecitiesfacilitycollegewestcanyonsecondresourcesrivertreasure
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:44:25 UTC
Content Hash
d42c9438bc89dfcf
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
21 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.130
QID OVERLAP: Q5987459 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (14): "created", "creating", "department", "enforcement", "idaho", "isp", "law", "legislature", "municipal", "organization", "police", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police". | EXACT TITLE in wedding_events: "Idaho State Police".
createdcreatingdepartmentenforcementidahoisplawlegislaturemunicipalorganizationpolicepresentpublicstatewide
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Other duties The Idaho State Police has two regional communications centers staffed with dispatchers who provide support to officers in the field. The Idaho State Police is tasked with the physical protection of the governor of the state as well as other dignitaries who may need protection. Rank structure See also List of law enforcement agencies in Idaho State police State patrol Highway patrol References External links Official ISP website
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (18): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "lower", "metropolitan", "name", "opportunities", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in wedding_events: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocallowermetropolitannameopportunitiesregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and wedding_events (tier:evergreen). | SHARED TOKENS (21): "ada", "annual", "block", "boise", "capital", "counties", "downtown", "east", "employers", "estimated", "feet", "home", "idaho", "level", "major", "metropolitan", "population", "river", "technology", "treasure".... | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualblockboisecapitalcountiesdowntowneastemployersestimatedfeethomeidaholevelmajormetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Warehouse
Q181623 EXACT TITLE 1.000
QID OVERLAP: Q181623 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (21): "agriculture", "associated", "building", "buildings", "businesses", "cities", "designed", "directly", "facility", "function", "large", "loading", "materials", "moving", "parks", "parts", "production", "standard", "transport", "warehouse".... | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in wedding_events: "Warehouse".
agricultureassociatedbuildingbuildingsbusinessescitiesdesigneddirectlyfacilityfunctionlargeloadingmaterialsmovingparkspartsproductionstandardtransportwarehousewarehouses
are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
ng goods, which are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
A warehouse is a building for storing goods. Warehouses are used by manufacturers, importers, exporters, wholesalers, transport businesses, customs, etc. For a warehouse to function efficiently, the facility must be properly slotted. They are usually large plain buildings, often in industrial parks on the outskirts of cities, towns, or villages. Warehouses usually have loading docks to load and unload goods from trucks. Sometimes warehouses are designed for the loading and unloading of goods directly from railways, airports, or seaports. They often have cranes and forklifts for moving goods, which are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (31): "allowing", "building", "buildings", "certain", "determine", "developed", "development", "different", "form", "govern", "government", "growth", "land", "land-use", "local", "municipality", "planning", "policy", "property", "regulations".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in wedding_events: "Zoning".
allowingbuildingbuildingscertaindeterminedevelopeddevelopmentdifferentformgoverngovernmentgrowthlandland-uselocalmunicipalityplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesizesystemsurbanuses+1
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:branch). | SHARED TOKENS (23): "boundaries", "certification", "complete", "extend", "field", "formal", "labor", "level", "license", "master", "people", "period", "permanent", "placement", "potential", "practice", "practitioners", "professional", "reach", "regulated".... | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
boundariescertificationcompleteextendfieldformallaborlevellicensemasterpeopleperiodpermanentplacementpotentialpracticepractitionersprofessionalreachregulatedstudysystemtraining
eship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Logistics
Q177777 EXACT TITLE 1.000
QID OVERLAP: Q177777 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (32): "according", "apart", "chain", "costs", "customers", "dedicated", "deliveries", "equipment", "facility", "field", "food", "information", "logistics", "managed", "management", "material", "materials", "model", "moving", "needs".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in wedding_events: "Logistics".
accordingapartchaincostscustomersdedicateddeliveriesequipmentfacilityfieldfoodinformationlogisticsmanagedmanagementmaterialmaterialsmodelmovingneedsoperationalpartsphysicalplanningproductionproductsprofessionalpublicresourcessupply+2
ogistics is the part of supply chain management that deals with the efficient forward and reverse flow of goods, services, and related information from the point of origin to the point of consumption according to the needs of customers, and a logistician is a professional working in the field of logistics management. Logistics management is a component that holds the supply chain together. The resources managed in logistics include physical goods such as materials, equipment, and foodstuffs, and also intangible items such as time and information. Military logistics is concerned with maintaining army supply lines with food, armaments, ammunition, and spare parts, apart from the transportation of troops themselves. Civil logistics deals with acquiring, moving, and storing raw materials, semi-finished goods, and finished goods. For organisations that provide garbage collection, mail deliveries, public utilities, and after-sales services, logistical problems must be addressed. Logistics deals with the movement of materials or products from one facility to another; it does not include material flow within production or assembly plants, such as production planning or single-machine scheduling. Logistics accounts for a significant amount of the operational costs of an organisation or country. Dedicated simulation software can model, analyse, visualise, and optimize logistic complexities.
The Oxford English Dictionary defines logistics as "the branch of military science relating to procuring, maintaining and transporting material, personnel and facilities". However, the New Oxford American Dictionary defines logistics as "the detailed coordination of a complex operation involving many people, facilities, or supplies", and the Oxford Dictionary on-line defines it as "the detailed organization and implementation of a complex operation". As such, logistics is commonly seen as a branch of engineering that creates "people systems" rather than "machine systems". According to the Council of Supply Chain Management Professionals (previously the Council of Logistics Management), logistics is the process of planning, implementing and controlling procedures for the efficient and effective transportation and storage of goods including services and related information from the point of origin to the point of consumption for the purpose of conforming to customer requirements and includes inbound, outbound, internal and external movements. Academics and practitioners traditionally refer to the terms operations or production management when referring to physical transformations taking place in a single business location (factory, restaurant or even bank clerking) and reserve the term logistics for activities related to distribution, that is, moving products on the territory. Managing a distribution center is seen, therefore, as pertaining to the realm of logistics since, while in theory, the products made by a factory are ready for consumption they still need to be moved along the distribution network according to some logic, and the distribution center aggregates and processes orders coming from different areas of the territory. That being said, from a modeling perspective, there are similarities between operations management and logistics, and companies sometimes use hybrid professionals, with for example a "Director of Operations" or a "Logistics Officer" working on similar problems.
Procurement logistics, which consists of market research, requirements planning, make-or-buy decisions, supplier management, ordering, and order control. The targets in procurement logistics might be contradictory: maximizing efficiency by concentrating on core competencies, outsourcing while maintaining the company's autonomy, or minimizing procurement costs while maximizing security within the supply process. Advance logistics involves the activities required to set up or establish a supply base in advance of other resources arriving. The term is used, for example, in military logistics for the assembly of resources ahead of troop arrival or the delivery of infrastructure components. Global logistics is technically the process of managing the "flow" of goods through a supply chain from its place of production to other parts of the world. This often requires an intermodal transport system via ocean, air, rail, and truck. The effectiveness of global logistics is measured in the Logistics Performance Index. Distribution logistics has, as its main task, the delivery of the finished products to the customer. It consists of order processing, warehousing, and transportation. Modern distribution often includes the use of a vehicle tracking system to monitor shipments by collecting real-time vehicle location data. Distribution logistics is necessary because production time, place, and quantity differ with the time, place, and quantity of consumption. Disposal logistics has the function of reducing logistics cost(s) and enhancing service(s) related to the disposal of waste produced during a business's operation. Reverse logistics denotes all operations related to the reuse of products and materials. The reverse logistics process includes the management and the sale of surpluses, as well as products being returned to vendors from buyers. It is "the process of planning, implementing, and controlling the efficient, cost-effective flow of raw materials, in-process inventory, finished goods, and related information from the point of consumption to the point of origin to recapture value or proper disposal". More precisely, reverse logistics is the process of moving goods from their typical final destination for the purpose of capturing value, or proper disposal. The opposite of reverse logistics is forward logistics. Green logistics describes all attempts to measure and minimize the ecological impact of logistics activities, including all activities of the forward and reverse flows. This can be supported by fleet digitalization initiatives aimed at optimizing routes and reducing fuel consumption. RAM logistics (see also Logistic engineering) combines both business logistics and military logistics since it concerns highly complicated technological systems for which reliability, availability and maintainability are essential, e.g., weapon system and military supercomputers. Asset control logistics: companies in the retail channels, both organized retailers and suppliers, often deploy assets required for the display, preservation, and promotion of their products. This can involve using a tracking system to monitor the location and status of these assets. Humanitarian logistics or emergency logistics: these terms are used by the logistics, supply chain, and manufacturing industries to denote specific time-critical modes of transport used to move goods rapidly in the event of an emergency. The reason for enlisting emergency logistics services could be a production delay or anticipated production delay, or an urgent need for specialized equipment to prevent events such as aircraft being grounded (also known as "aircraft on ground"—AOG), ships being delayed, or telecommunications failure. Humanitarian logistics involves governments, the military, aid agencies, donors, non-governmental organizations, and emergency logistics services are typically sourced from a specialist provider. In addition, the term production logistics describes logistic processes within a value-adding system (e.g., a factory or a mine). Production logistics aims to ensure that each machine and workstation receives the right product in the correct quantity and quality at the right time. The concern is with production, testing, transportation, storage, and supply. Production logistics can operate in existing as well as new plants. Since manufacturing in an existing plant is a constantly changing process, machines are exchanged and new ones added, which allows for improving the production logistics system accordingly. Production logistics provides the means to achieve customer response and capital efficiency. Track and trace solutions, which provide visibility of products through the production line, are an important part of modern production logistics, especially in the automotive and medical industries. The term construction logistics has also been employed by civilizations for thousands of years. Now, construction logistics is an important part of the sector. In recent years, it has emerged as a distinct field of study within supply chain management and logistics.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (22): "activity", "among", "boise", "business", "college", "compete", "division", "education", "engineering", "health", "idaho", "independent", "master", "million", "program", "programs", "public", "reported", "research", "school".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in wedding_events: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationengineeringhealthidahoindependentmastermillionprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:branch). | SHARED TOKENS (29): "ada", "air", "airport", "base", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "facility", "falls", "field", "functions", "general", "idaho", "increase", "million", "national".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
adaairairportbaseboisecentercombinedcommercialcommissiondepartmentdowntownfacilityfallsfieldfunctionsgeneralidahoincreasemillionnationaloperatedoperatesreceiverequiringrightssupporttimesuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (31): "academic", "ada", "board", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in wedding_events: "College of Western Idaho".
academicadaboardboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentsservedsouthweststudentsthroughouttransfertreasurevalleywestern+1
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (55): "applicable", "applied", "association", "attractive", "authority", "behavior", "central", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depend", "depends", "design", "development", "districts"....
applicableappliedassociationattractiveauthoritybehaviorcentralchangescitiescommunitiescommunitycomprehensiveconditionscostscreatingdependdependsdesigndevelopmentdistrictseconomicexposurefacilitiesfunctionfurtherfuturegoalhealthjurisdictionsland+25
ul, efficient, and attractive environments for present and future generations. Land-use planning in England and Wales is founded on the Town and Country Planning Act 1947, with comparable legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
n used interchangeably, and will depend on the state, county, and/or project in question. Despite confusing nomenclature, the essential function of land use planning remains the same whatever term is applied. The Canadian Institute of Planners offers a definition that land use planning means the scientific, aesthetic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
sposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (17): "according", "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "name", "nampa", "population", "principal", "second", "university", "west", "western".
accordingboisecanyoncollegehomeidahointerstatemeridianmetropolitannamenampapopulationprincipalseconduniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Right of way
Q17128254 QID OVERLAP 0.800
QID OVERLAP: Q17128254 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (32): "authority", "capable", "certain", "created", "different", "estate", "facility", "full", "government", "land", "legal", "local", "operate", "otherwise", "ownership", "parts", "people", "physical", "private", "real"....
authoritycapablecertaincreateddifferentestatefacilityfullgovernmentlandlegallocaloperateotherwiseownershippartspeoplephysicalprivaterealrestrictedright-of-wayrightsroadroadsrouteroutesthemtraffictransportation+2
In England and Wales, other than in the 12 Inner London boroughs and the City of London, public rights of way are paths on which the public have a legally protected right to pass and re-pass. The law in England and Wales differs from that in Scotland in that rights of way only exist where they are so designated (or are able to be designated if not already) whereas in Scotland any route that meets certain conditions is defined as a right of way, and in addition there is a general presumption of access to the countryside. Private rights of way or easements also exist. Footpaths, bridleways and other rights of way in most of England and Wales are shown on definitive maps. A definitive map is a record of public rights of way in England and Wales. In law it is the definitive record of where a right of way is located.
Scotland In Scotland, a right of way is a route over which the public has been able to pass unhindered for at least 20 years. The route must link two "public places", such as villages, churches or roads. Unlike in England and Wales there is no obligation on Scottish local authorities to signpost rights of way. However the charity Scotways, formed in 1845 to protect rights of way, records and signs the routes. The Land Reform (Scotland) Act 2003 codified in law traditional, non-motorised, access practices on land and water. Under the 2003 act a plain language explanation of rights is published by Scottish Natural Heritage: the Scottish Outdoor Access Code. Certain categories of land are excluded from this presumption of open access, such as railway land, airfields and private gardens. Section 4 of the access code explains how land managers are permitted to request the public to avoid certain areas for a limited period in order to undertake management tasks, however longer term restrictions must be approved by the local authority. The ability to temporarily restrict public access is commonly exercised without notice by shooting, forestry or wind farm operators, but does not extend to public rights of way. In Scotland the public have a higher degree of freedom on rights of way than on open land. Blocking a right of way in Scotland is a criminal obstruction under the Highways Act, just as in England and Wales, but the lack of publicly accessible rights of way maps in Scotland makes it very difficult to enforce. The unofficial National Catalogue of Rights of Way (CROW), compiled by the Scottish Rights of Way and Access Society (Scotways), in partnership with Scottish Natural Heritage, and the help of local authorities.
the sense of "main way" to mean any public-use road or any public-use road or path. Some are restricted as to mode of use (for example, pedestrians only, pedestrians, horse and cycle riders, vehicles capable of a minimum speed). Rights-of-way in the legal sense (the right to pass through or to operate a transportation facility) can be created in a number of different ways. In some cases, a government, transportation company, or conservation non-profit purchases the full ownership of real estate, including everything above and below the ground. Many rights-of-way are created instead by easement, which is a right to cross that does not include full ownership of the land.
Union Pacific Railroad
Q725793 QID OVERLAP 0.800
QID OVERLAP: Q725793 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (25): "announced", "approved", "center", "create", "itself", "later", "network", "operates", "operating", "pacific", "plans", "principal", "project", "rail", "railroad", "reach", "reporting", "road", "route", "routes"....
announcedapprovedcentercreateitselflaternetworkoperatesoperatingpacificplansprincipalprojectrailrailroadreachreportingroadrouteroutessystemtransportationunionwestwestern
d. The Union Pacific Railroad Company is the principal operating company of Union Pacific Corporation, which are both headquartered at the Union Pacific Center, in Omaha, Nebraska. Union Pacific has announced plans to acquire the Norfolk Southern Railway in a deal worth $85 billion.
Union Pacific in the 20th century In the early 20th century, Union Pacific's focus shifted from expansion to internal improvement. Recognizing that farmers in the Central and Salinas Valleys of California grew produce far in excess of local markets, Union Pacific worked with its rival Southern Pacific to develop a spoilage-resistant rail-based transport system. These efforts culminated in the 1906 founding of Pacific Fruit Express, soon to be the world's largest lessee of refrigerated railcars. Meanwhile, Union Pacific worked to construct a faster, and more direct substitute for the original climb to Promontory Summit. In 1904, the Lucin cutoff opened, reducing curvature and grades. The original route would eventually be stripped of track in 1942 to provide war scrap. To attract customers during the Great Depression, Union Pacific's chairman W. Averell Harriman simultaneously sought to "spruce up" the quality of its rolling stock and to make its unique locations more desirable travel destinations. The first effort resulted in the purchase of the first streamlined train: the M-10000. The latter resulted in the Sun Valley ski resort in central Idaho; it opened in 1936 and finally was sold in 1964. Despite the fact that the M-10000 and its successors were among the first diesel locomotives, Union Pacific completed dieselization relatively late. In 1944, UP finally received delivery of its last steam locomotive: Union Pacific 844. As the 20th century waned, Union Pacific recognized—like most railroads—that remaining a regional railroad would only lead to bankruptcy. On December 31, 1925, UP and its subsidiaries operated 9,834 miles (15,826 km) routes and 15,265 miles (24,567 km) tracks; in 1980, these numbers had remained roughly constant (9,266 route-miles and 15,647 track-miles). But in 1982, UP acquired the Missouri Pacific and Western Pacific railroads, and 1988, the Missouri–Kansas–Texas. By 1993, Union Pacific had doubled its system to 17,385 miles (27,978 km) routes. By then, few large (class I) railroads remained. The same year that Union Pacific merged with the Chicago and North Western (1995), Burlington Northern and ATSF announced merger plans. The impending BNSF amalgamation would leave one mega-railroad in control of the west. To compete, UP merged with Southern Pacific, thereby incorporating D&RGW and Cotton Belt, and forming a duopoly in the West. The merged railroad took the Union Pacific name.
In March 2024, Union Pacific layoffs caused concern at the Federal Railroad Administration to the extent that the FRA, in a letter to UP's CEO, said "safety of railroad operations is paramount ... decisions that comprise that fundamental ... are unacceptable. You must ensure that highly trained and experienced personnel perform critical inspections and repairs .... Your railroad (layoffs) are far outpacing any of your Class 1 peers." In 2024, the railway celebrated 150 years of having its headquarters in Omaha. The railway's Big Boy #4014, the world's largest operating steam locomotive, visited 14 states throughout the Midwest in 2024. Twenty-five Big Boys were built during World War II, with only eight surviving and #4014 the only operable one, restored by the railroad to join its Heritage Fleet. Its "Heartland of America" tour began in August 2024 in Cheyenne, Wyoming, and travelled through Arkansas, Colorado, Illinois, Iowa, Kansas, Missouri, Nebraska, Oklahoma and Texas through October. Three commemorative locomotives honor U.S. Presidents, including UP No. 4141, named in honor of George H. W. Bush, the 41st President. It is exhibited at the George H. W. Bush Presidential Center at Texas A&M University in College Station, Texas. The locomotive is custom painted in the colors of GWH Bush's Air Force One. The engine also pulled the president's funeral train on his final journey to College Station in 2018. UP No. 1616, honoring railroad founder President Abraham Lincoln, was unveiled on Presidents Day 2025. The Lincoln Locomotive will serve as a traveling ambassador on the rails. The third locomotive, UP No. 4547 honoring President Donald J. Trump, was created to celebrate America’s 250th anniversary in 2026. The locomotive began its first mission hauling Space Launch System solid rocket motor segments for NASA’s Artemis III lunar exploration program . Proposed merger On July 29, 2025, Union Pacific and Norfolk Southern announced an $85 billion agreement to create a transcontinental railroad. The boards of both companies unanimously approved the transaction, which remains subject to review by the Surface Transportation Board.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.800
QID OVERLAP: Q843258 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (17): "boise", "cities", "designated", "downtown", "falls", "home", "idaho", "interstate", "line", "major", "metropolitan", "near", "river", "route", "routes", "serves", "twin".
boisecitiesdesignateddowntownfallshomeidahointerstatelinemajormetropolitannearriverrouteroutesservestwin
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and wedding_events (tier:branch). | SHARED TOKENS (17): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "local", "metropolitan", "pacific", "population", "private", "roads", "second", "streets".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlocalmetropolitanpacificpopulationprivateroadssecondstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidahometropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahometropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "population".
adaboisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
279 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP279 edges
🌲 EVERGREEN3 edges
0.650
acquisitionboardcommissioncreatedeconomicfederalgovernmentindependentindustryinterstatejurisdictionmattersrailrailroadregulationregulatoryrelevantservedservessubject
SHARED TOKENS (23): "acquisition", "board", "commission", "created", "economic", "federal", "government", "independent", "industry", "interstate", "jurisdiction", "matters", "rail", "railroad", "regulation", "regulatory", "relevant", "served", "serves", "subject".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationairportcommercialcostsfederalfuelfundfundinggenerallandlightingmanagedpercentplanningprogrampublicrevenuesafetysignage
SHARED TOKENS (26): "acquisition", "administration", "airport", "commercial", "costs", "federal", "fuel", "fund", "funding", "general", "land", "lighting", "managed", "percent", "planning", "program", "public", "revenue", "safety", "signage".... | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesairamongauthoritiesauthorityautomobilebaseboisecanyoncapacitycapitalcentercitiesconventionalcostcostsdemanddestination
SHARED TOKENS (82): "ada", "additional", "agencies", "air", "among", "authorities", "authority", "automobile", "base", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "cost", "costs", "demand", "destination".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH218 edges
0.590
accommodateboisecentercompleteddistrictdowntowneventexpansionfeetidahooperatingspace
SHARED TOKENS (12): "accommodate", "boise", "center", "completed", "district", "downtown", "event", "expansion", "feet", "idaho", "operating", "space". | URL->B (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.500
Road ↗ Q34442 EXACT TITLE
accessdesigndistinctionlandlocalplaceprimaryprivatepublicroadroadsroutestreetstreetstrafficurbanwhose
SHARED TOKENS (17): "access", "design", "distinction", "land", "local", "place", "primary", "private", "public", "road", "roads", "route", "street", "streets", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in wedding_events: "Road".
0.500
assetassociatedbuildingbuildingsbuiltdesigndevelopmenteconomicequivalentextendfacilitiesfinancingindustryinfrastructuremaintenancepercentplanningprocessproductsuntil
SHARED TOKENS (21): "asset", "associated", "building", "buildings", "built", "design", "development", "economic", "equivalent", "extend", "facilities", "financing", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "products", "until".... | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingdesignedfrequentlyitselfmaterialneednoisepedestrianperformancepracticeprocessrequirementsroadroadsroadsideselectionshapeshapesstructuretraffic
SHARED TOKENS (21): "allowing", "designed", "frequently", "itself", "material", "need", "noise", "pedestrian", "performance", "practice", "process", "requirements", "road", "roads", "roadside", "selection", "shape", "shapes", "structure", "traffic".... | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistinctearlyeasteconomyidahoincorporateslandlinkedmethodsmillionnationalofficialpacific
SHARED TOKENS (37): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "early", "east", "economy", "idaho", "incorporates", "land", "linked", "methods", "million", "national", "official", "pacific".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in wedding_events: "Idaho".
0.500
agenciesassetsauthoritiesauthoritybehaviorbusinessesdepartmentsdirectlyeligibilityemergencyequipmentfunctiongovernedgovernmenthazardshousingindividualjurisdictionlegallicenses
SHARED TOKENS (39): "agencies", "assets", "authorities", "authority", "behavior", "businesses", "departments", "directly", "eligibility", "emergency", "equipment", "function", "governed", "government", "hazards", "housing", "individual", "jurisdiction", "legal", "licenses".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Kitchen ↗ Q43164 EXACT TITLE
accordingcommercialcompletedesigndevelopedequipmentfacilitiesfoodfunctionshealthhotlargelargerlawmarketpublicrequirementsresidentialsmallspace
SHARED TOKENS (23): "according", "commercial", "complete", "design", "developed", "equipment", "facilities", "food", "functions", "health", "hot", "large", "larger", "law", "market", "public", "requirements", "residential", "small", "space".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
associationcreatedfrequentlylandlandscapemobilitymultipleparkparkspeoplerightsruralserveservesurban
SHARED TOKENS (15): "association", "created", "frequently", "land", "landscape", "mobility", "multiple", "park", "parks", "people", "rights", "rural", "serve", "serves", "urban". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
airairportcanyonemergencygeneralhangarhomeidahointegratedmissionmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (19): "air", "airport", "canyon", "emergency", "general", "hangar", "home", "idaho", "integrated", "mission", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
applicationbrandbuildingbusinesscorporatedesigndevelopmentdifferentemergencyenvironmenteventeventsformalfrequentlyidentifyingindustryknowledgelogisticsmanagementmarket
SHARED TOKENS (37): "application", "brand", "building", "business", "corporate", "design", "development", "different", "emergency", "environment", "event", "events", "formal", "frequently", "identifying", "industry", "knowledge", "logistics", "management", "market".... | EXACT TITLE in transportation_infrastructure: "Event management". | EXACT TITLE in wedding_events: "Event management".
0.500
airapplicablebuildingcentercenterscommercialconsumerscoordinatededicateddeliverydemanddestinationsdirectlydistributionequipmentfacilityfirmsfunctionhandlinginventory
SHARED TOKENS (46): "air", "applicable", "building", "center", "centers", "commercial", "consumers", "coordinate", "dedicated", "delivery", "demand", "destinations", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "inventory".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
adaboisecanyoncitiescombinedcountiesdesignatedhomeidaholargermeridianmetropolitannampapacificpercentpopulationportlandseattletreasurevalley
SHARED TOKENS (21): "ada", "boise", "canyon", "cities", "combined", "counties", "designated", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "pacific", "percent", "population", "portland", "seattle", "treasure", "valley".... | EXACT TITLE in wedding_events: "Boise metropolitan area".
0.500
Food safety ↗ Q909821 EXACT TITLE
affectsavoidcannotcertificationchainconsumerconsumerscreatesdeliverydescribingdevelopedenforcementestimatedfoodgrowthhandlinghazardshealthindustryinspection
SHARED TOKENS (39): "affects", "avoid", "cannot", "certification", "chain", "consumer", "consumers", "creates", "delivery", "describing", "developed", "enforcement", "estimated", "food", "growth", "handling", "hazards", "health", "industry", "inspection".... | EXACT TITLE in wedding_events: "Food safety".
0.500
accessagenciesclimatecommunityconditionsconnectivitycreateddevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentfacilitiesfirmsfrequentlyfunction
SHARED TOKENS (48): "access", "agencies", "climate", "community", "conditions", "connectivity", "created", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "facilities", "firms", "frequently", "function".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in wedding_events: "Infrastructure".
0.500
Commissary ↗ Q5152616 EXACT TITLE
associatedbuildingcontextdeliveryequivalentextensionfinancialgovernmentjurisdictionnationalofficeofficialorganizationpolicestandardsuppliestermstitleuses
SHARED TOKENS (19): "associated", "building", "context", "delivery", "equivalent", "extension", "financial", "government", "jurisdiction", "national", "office", "official", "organization", "police", "standard", "supplies", "terms", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbuiltbusinessescustomersdesignedearlyeventeventsformalhistoryholdinginsidelargelaterlevelpeopleprimaryprivate
SHARED TOKENS (24): "annual", "building", "buildings", "built", "businesses", "customers", "designed", "early", "event", "events", "formal", "history", "holding", "inside", "large", "later", "level", "people", "primary", "private".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
businessescategorycertaincreatedevelopedeconomicindividualinformationlandlawlegallimitedlowerownershippeopleperiodplaceprimarypropertyrights
SHARED TOKENS (24): "businesses", "category", "certain", "create", "developed", "economic", "individual", "information", "land", "law", "legal", "limited", "lower", "ownership", "people", "period", "place", "primary", "property", "rights".... | EXACT TITLE in wedding_events: "Intellectual property".
0.500
behaviorbeyondcomplianceenvironmentevidenceformgroupidentificationidentifiedinfluenceinformationmarketingneedneedspeoplepressureprivatepublicpubliclyresponse
SHARED TOKENS (26): "behavior", "beyond", "compliance", "environment", "evidence", "form", "group", "identification", "identified", "influence", "information", "marketing", "need", "needs", "people", "pressure", "private", "public", "publicly", "response".... | EXACT TITLE in wedding_events: "Social influence".
0.500
administrationairairportapproximatelyauthoritycertaincombinedconnectingcreateddatadepartmentenforcementfacilitiesfederalgovernmentidentificationlawlocalmissionoperated
SHARED TOKENS (35): "administration", "air", "airport", "approximately", "authority", "certain", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "government", "identification", "law", "local", "mission", "operated".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
administrationagenciesdepartmentdistrictexistingfederalfinancialfunctionsgovernmentlocalofficeoperateoperatorspeopleprogramsproviderspublicrailregionalrequirements
SHARED TOKENS (26): "administration", "agencies", "department", "district", "existing", "federal", "financial", "functions", "government", "local", "office", "operate", "operators", "people", "programs", "providers", "public", "rail", "regional", "requirements".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbroaderbuildingscapitalcategorycommunitydirectlyeconomicelectricalemploymentfacilitiesgovernmenthealthinfrastructurelong-termmunicipaloperatorparksphysicalpreservation
SHARED TOKENS (33): "assets", "broader", "buildings", "capital", "category", "community", "directly", "economic", "electrical", "employment", "facilities", "government", "health", "infrastructure", "long-term", "municipal", "operator", "parks", "physical", "preservation".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Marketing ↗ Q39809 EXACT TITLE
advertisingaffectedagriculturalassociationbusinessbusinessesconcerningconsumerscreatingcustomersdedicateddestinationdirectlyenvironmentfirmsfoodgovernmentindustrymanagementmarket
SHARED TOKENS (34): "advertising", "affected", "agricultural", "association", "business", "businesses", "concerning", "consumers", "creating", "customers", "dedicated", "destination", "directly", "environment", "firms", "food", "government", "industry", "management", "market".... | EXACT TITLE in transportation_infrastructure: "Marketing". | EXACT TITLE in wedding_events: "Marketing".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstcertainconditionsdesignatedestablishedeventfeefinancialformhealthinsuranceinsurerlargemanagementmeansownershippaymentpolicyprimaryprocessing
SHARED TOKENS (25): "against", "certain", "conditions", "designated", "established", "event", "fee", "financial", "form", "health", "insurance", "insurer", "large", "management", "means", "ownership", "payment", "policy", "primary", "processing".... | EXACT TITLE in transportation_infrastructure: "Insurance". | EXACT TITLE in wedding_events: "Insurance".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
associatedcitiescreatingdesignatedearlyhistoricallymobilitynetworkpedestrianpeopleprofessionalrecordroadsruralsafetystreetstraffictransporturbanvehicles
SHARED TOKENS (22): "associated", "cities", "creating", "designated", "early", "historically", "mobility", "network", "pedestrian", "people", "professional", "record", "roads", "rural", "safety", "streets", "traffic", "transport", "urban", "vehicles".... | EXACT TITLE in transportation_infrastructure: "Pedestrian". | EXACT TITLE in wedding_events: "Pedestrian".
0.500
approveddepartmentfacilitiesfederalidentifiedindividualinterstatelocalmajormetropolitannationalnetworkpipelineplanningrailroadssafetyservingstationsstrategic
SHARED TOKENS (23): "approved", "department", "facilities", "federal", "identified", "individual", "interstate", "local", "major", "metropolitan", "national", "network", "pipeline", "planning", "rail", "roads", "safety", "serving", "stations", "strategic".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingauthorityboundariescertaincitiesconcentratedconsolidatedcountiesdifferentdistrictdistrictsentitiesequivalentexistingformfurthergovernmentindependentlawlegally
SHARED TOKENS (30): "according", "authority", "boundaries", "certain", "cities", "concentrated", "consolidated", "counties", "different", "district", "districts", "entities", "equivalent", "existing", "form", "further", "government", "independent", "law", "legally".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in wedding_events: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescommunicationsdesignateddeterminingdevelopmentdigitalengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalownershipplanningprofessionalproperty
SHARED TOKENS (27): "analysis", "boundaries", "communications", "designated", "determining", "development", "digital", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Rodeo ↗ Q207703 EXACT TITLE
associationcertaincompetitivedecemberdesignedequipmenteventeventsfederalgoverngovernedindustrylaterlocalnationalofficialorganizationpracticesprofessionalpublic
SHARED TOKENS (29): "association", "certain", "competitive", "december", "designed", "equipment", "event", "events", "federal", "govern", "governed", "industry", "later", "local", "national", "official", "organization", "practices", "professional", "public".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesallowingalreadybusinessescollegecurrentdetermineemployersemploymenteventfieldfuturegovernmentindustryinvestmentlargelimitedmedicalnetworkopportunities
SHARED TOKENS (40): "agencies", "allowing", "already", "businesses", "college", "current", "determine", "employers", "employment", "event", "field", "future", "government", "industry", "investment", "large", "limited", "medical", "network", "opportunities".... | EXACT TITLE in wedding_events: "Internship".
0.500
administrationagenciescreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramspublicrailrailroadregulationsresearchrightssafety
SHARED TOKENS (22): "administration", "agencies", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "public", "rail", "railroad", "regulations", "research", "rights", "safety".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
addressingchangescontrolcoordinationdirectlyfederalformfundinggoverninginvolvinglawmajornameownedpartsphysicalprimaryprovisionspubliclyquality
SHARED TOKENS (26): "addressing", "changes", "control", "coordination", "directly", "federal", "form", "funding", "governing", "involving", "law", "major", "name", "owned", "parts", "physical", "primary", "provisions", "publicly", "quality".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbuiltcommunitycomplexconnectingconnectioncreatedesigndesignedearlyengineeringenvironmentfrequentlyintendedlimitlocalmajornetworkphysicalrequirements
SHARED TOKENS (34): "allowing", "built", "community", "complex", "connecting", "connection", "create", "design", "designed", "early", "engineering", "environment", "frequently", "intended", "limit", "local", "major", "network", "physical", "requirements".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in wedding_events: "Bridge".
0.500
Convention ↗ Q225862 EXACT TITLE
agreementboardcertaindifferentfieldformalgroupindustrylargelawlegallinemediaofficepeoplepractitionerspropertystandard
SHARED TOKENS (18): "agreement", "board", "certain", "different", "field", "formal", "group", "industry", "large", "law", "legal", "line", "media", "office", "people", "practitioners", "property", "standard". | EXACT TITLE in transportation_infrastructure: "Convention". | EXACT TITLE in wedding_events: "Convention".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddistributionfieldformfullgrowthimprovementsirrigation
SHARED TOKENS (47): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "distribution", "field", "form", "full", "growth", "improvements", "irrigation".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in wedding_events: "Irrigation".
0.500
accessallowingcommunicationsdatadevelopmentdigitalearlyelectricalformfurtherindependentindividualinformationmeansmediaphysicalpowerreducedsingletechnology
SHARED TOKENS (20): "access", "allowing", "communications", "data", "development", "digital", "early", "electrical", "form", "further", "independent", "individual", "information", "means", "media", "physical", "power", "reduced", "single", "technology". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
agenciesbuildingsbuiltdepartmentsdesigndistinguishengineeringenvironmentfirmsgovernmentinfrastructuremaintenancemunicipalnationalphysicalplaceprivateprofessionalpublicroads
SHARED TOKENS (22): "agencies", "buildings", "built", "departments", "design", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "maintenance", "municipal", "national", "physical", "place", "private", "professional", "public", "roads".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
additionaladvancedagenciesauthoritiesbusinessescertaindepartmentdriveemergencyfacilitieshistoricallymedicalmodeloperatepartspersonnelpresentprimarypublicremains
SHARED TOKENS (32): "additional", "advanced", "agencies", "authorities", "businesses", "certain", "department", "drive", "emergency", "facilities", "historically", "medical", "model", "operate", "parts", "personnel", "present", "primary", "public", "remains".... | EXACT TITLE in wedding_events: "Emergency medical services".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalapproximatelyblockboardbusinessdailydirectlyexecutivefederallimitedmanagedmetropolitanmillionnationalnetworkoperateoperatesoperatororganizationowned
SHARED TOKENS (35): "additional", "approximately", "block", "board", "business", "daily", "directly", "executive", "federal", "limited", "managed", "metropolitan", "million", "national", "network", "operate", "operates", "operator", "organization", "owned".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
assetsbusinesscentercontractingcontroleconomicevenfacilityfunctionslaterlegallimitedmanagementoperationalorganizationotherwisepracticeprivateprocessprocessing
SHARED TOKENS (28): "assets", "business", "center", "contracting", "control", "economic", "even", "facility", "functions", "later", "legal", "limited", "management", "operational", "organization", "otherwise", "practice", "private", "process", "processing".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
Signage ↗ Q1211272 EXACT TITLE
buildingscreateddesigndesigneddigitaldisplaysdistinctformgroupinformationinsidemeansnamesignagesignssizestreetstreetsvisual
SHARED TOKENS (19): "buildings", "created", "design", "designed", "digital", "displays", "distinct", "form", "group", "information", "inside", "means", "name", "signage", "signs", "size", "street", "streets", "visual". | EXACT TITLE in transportation_infrastructure: "Signage". | EXACT TITLE in wedding_events: "Signage".
0.500
agenciesapplybusinessescomprehensivedesigndestinationsfacilitiesfuturegovernmentincorporatesinfluencemoveneedspeopleplannersplanningpoliciesprivateprocesspublic
SHARED TOKENS (25): "agencies", "apply", "businesses", "comprehensive", "design", "destinations", "facilities", "future", "government", "incorporates", "influence", "move", "needs", "people", "planners", "planning", "policies", "private", "process", "public".... | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Weather ↗ Q11663 EXACT TITLE
affectagricultureairannuallyapplicationchangesclimateconditionscontrolcreatingdifferentdistributionevidencefuturehistoryindustrylargelayerlimitedlong-term
SHARED TOKENS (34): "affect", "agriculture", "air", "annually", "application", "changes", "climate", "conditions", "control", "creating", "different", "distribution", "evidence", "future", "history", "industry", "large", "layer", "limited", "long-term".... | EXACT TITLE in transportation_infrastructure: "Weather". | EXACT TITLE in wedding_events: "Weather".
0.500
amongapproximatelyboisecompetedivisionestablishedextensionfallsidaholateropenedoperatesparkproductionprofessionalpublicrepresentedresearchruralschools
SHARED TOKENS (24): "among", "approximately", "boise", "compete", "division", "established", "extension", "falls", "idaho", "later", "opened", "operates", "park", "production", "professional", "public", "represented", "research", "rural", "schools".... | EXACT TITLE in wedding_events: "University of Idaho".
0.500
Concert ↗ Q182832 EXACT TITLE
designatedequipmenteventlargelogisticsoutdoorparksperformanceprivateprofessionalrequireshowsinglesmallsupport
SHARED TOKENS (15): "designated", "equipment", "event", "large", "logistics", "outdoor", "parks", "performance", "private", "professional", "require", "show", "single", "small", "support". | EXACT TITLE in wedding_events: "Concert".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbasebusinesscreatecreatingdevelopeddigitaldirectelectricalexposureforminsidelatermaterialmeansoperatespracticeprocessingproduceproduces
SHARED TOKENS (26): "application", "base", "business", "create", "creating", "developed", "digital", "direct", "electrical", "exposure", "form", "inside", "later", "material", "means", "operates", "practice", "processing", "produce", "produces".... | EXACT TITLE in wedding_events: "Photography".
0.500
alreadybuildingbuildingscodesdepartmentdivisioneventhazardsincreasesinspectintendedlimitplannedpracticessafetyschoolsstructurestrain
SHARED TOKENS (18): "already", "building", "buildings", "codes", "department", "division", "event", "hazards", "increases", "inspect", "intended", "limit", "planned", "practices", "safety", "schools", "structures", "train". | EXACT TITLE in wedding_events: "Fire safety".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventfoodgroupindividualmanagementmodelon-siteparkspracticesprivatesafetyservedservesservingsettingspaces
SHARED TOKENS (18): "business", "commercial", "event", "food", "group", "individual", "management", "model", "on-site", "parks", "practices", "private", "safety", "served", "serves", "serving", "setting", "spaces". | EXACT TITLE in wedding_events: "Catering".
0.500
Waste management ↗ EXACT TITLE
accordingactivityadditionalairapproximatelycenterscitiesclimatecombinedcommercialcontrolledcreateddevelopeddifferenteconomicenvironmentexistingfinalfoodhealth
SHARED TOKENS (49): "according", "activity", "additional", "air", "approximately", "centers", "cities", "climate", "combined", "commercial", "controlled", "created", "developed", "different", "economic", "environment", "existing", "final", "food", "health".... | EXACT TITLE in transportation_infrastructure: "Waste management". | EXACT TITLE in wedding_events: "Waste management".
0.500
Parking ↗ Q267917 EXACT TITLE
availabilitybuildingscentersdesignfacilitieslandlocalparkingpercentroadrulesspacessupportthoughtravelurban
SHARED TOKENS (16): "availability", "buildings", "centers", "design", "facilities", "land", "local", "parking", "percent", "road", "rules", "spaces", "support", "though", "travel", "urban". | EXACT TITLE in transportation_infrastructure: "Parking". | EXACT TITLE in wedding_events: "Parking".
0.500
Park ↗ Q22698 EXACT TITLE
adjacentagainstagenciesbuildingsbuiltcitiesgovernmentinsidelandlargelawnationalparkparkspermitprotectedrecreationrulesshowsspace
SHARED TOKENS (26): "adjacent", "against", "agencies", "buildings", "built", "cities", "government", "inside", "land", "large", "law", "national", "park", "parks", "permit", "protected", "recreation", "rules", "shows", "space".... | EXACT TITLE in transportation_infrastructure: "Park". | EXACT TITLE in wedding_events: "Park".
0.500
accessauthoritiescomprehensivecontinuingcooperativecreatedexistingfederalformationfundingfuturegovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplans
SHARED TOKENS (29): "access", "authorities", "comprehensive", "continuing", "cooperative", "created", "existing", "federal", "formation", "funding", "future", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Floristry ↗ Q637125 EXACT TITLE
arrangementsbusinessconsumerscorporatecreatecreatingcustomersdeliverydesigndistributioneventeventsgardenhandlingindustryknowledgelargelevelmarketmaterial
SHARED TOKENS (36): "arrangements", "business", "consumers", "corporate", "create", "creating", "customers", "delivery", "design", "distribution", "event", "events", "garden", "handling", "industry", "knowledge", "large", "level", "market", "material".... | EXACT TITLE in wedding_events: "Floristry".
0.500
broadercertaincitiescomprehensivecoveringdevelopmenteconomicgrowthindividualinfrastructurelandland-uselargerlevelmanagementnationalneedsnetworkplacementplanning
SHARED TOKENS (36): "broader", "certain", "cities", "comprehensive", "covering", "development", "economic", "growth", "individual", "infrastructure", "land", "land-use", "larger", "level", "management", "national", "needs", "network", "placement", "planning".... | EXACT TITLE in transportation_infrastructure: "Regional planning". | EXACT TITLE in wedding_events: "Regional planning".
0.500
applicationapplicationsbecomecompleteequipmentfeethouseidentifyingitselflicensedlistplaceproductsprofessionalsafelyshapesignstrainingtreatmentwhose
SHARED TOKENS (21): "application", "applications", "become", "complete", "equipment", "feet", "house", "identifying", "itself", "licensed", "list", "place", "products", "professional", "safely", "shape", "signs", "training", "treatment", "whose".... | EXACT TITLE in wedding_events: "Nail technician".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomicenvironmentestimatedgrowthincreaselimitedlocalmarketsorganizationpeoplepotentialpracticesprograms
SHARED TOKENS (28): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "environment", "estimated", "growth", "increase", "limited", "local", "markets", "organization", "people", "potential", "practices", "programs".... | EXACT TITLE in transportation_infrastructure: "Tourism". | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
advertisingaffectedannualapproximatelybecomebusinessbusinessescomcompetingdecemberdirectoryestimatesexpandedfundingincomeinformationlatermillionmobileoperates
SHARED TOKENS (35): "advertising", "affected", "annual", "approximately", "become", "business", "businesses", "com", "competing", "december", "directory", "estimates", "expanded", "funding", "income", "information", "later", "million", "mobile", "operates".... | EXACT TITLE in wedding_events: "Yelp".
0.500
agriculturalalongsideannuallyclimateconcentrateddevelopeddevelopmentdirectenvironmentestimatesgroupgrowthincreaseindividuallimitedmedicalmillionpeoplepolicypopulation
SHARED TOKENS (28): "agricultural", "alongside", "annually", "climate", "concentrated", "developed", "development", "direct", "environment", "estimates", "group", "growth", "increase", "individual", "limited", "medical", "million", "people", "policy", "population".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
agenciesarchitectureconditionscontroldesignengineeringestateexistinggeneralinfrastructurejurisdictionslandscapelicenselicensedlicensesmanagementmasteroutdoorparksplanning
SHARED TOKENS (32): "agencies", "architecture", "conditions", "control", "design", "engineering", "estate", "existing", "general", "infrastructure", "jurisdictions", "landscape", "license", "licensed", "licenses", "management", "master", "outdoor", "parks", "planning".... | EXACT TITLE in transportation_infrastructure: "Landscape architecture".
0.500
applybusinesscompleteconstraintscontractorscreateddesigneddesignersdevelopmentdistinctdocumentationestablishedfundinginfluenceinformationmanagementoperationspermanentpracticeprimary
SHARED TOKENS (33): "apply", "business", "complete", "constraints", "contractors", "created", "designed", "designers", "development", "distinct", "documentation", "established", "funding", "influence", "information", "management", "operations", "permanent", "practice", "primary".... | EXACT TITLE in transportation_infrastructure: "Project management". | EXACT TITLE in wedding_events: "Project management".
0.500
accordingcommunitydescribesdevelopmenteconomicfrequentlygrowthhistoricallyincreasesindividualinfrastructurelocalmarketpeoplepoliciespolicyprocessqualityregionterms
SHARED TOKENS (21): "according", "community", "describes", "development", "economic", "frequently", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "people", "policies", "policy", "process", "quality", "region", "terms".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
Accounting ↗ Q4116214 EXACT TITLE
analysisboardbusinessbusinessescostcouncildesigneddevelopedeconomicentitiesfinancialfirmsfunctionshistoryinformationmajormanagementoperationsorganizationplans
SHARED TOKENS (35): "analysis", "board", "business", "businesses", "cost", "council", "designed", "developed", "economic", "entities", "financial", "firms", "functions", "history", "information", "major", "management", "operations", "organization", "plans".... | EXACT TITLE in wedding_events: "Accounting".
0.500
chaincomplexconsumerconsumersconvertcreatingcustomersdirectdirectlydistributionfacilitiesindependentlinkedlogisticsmanagementmaterialsnetworkproductsstructuresuppliers
SHARED TOKENS (25): "chain", "complex", "consumer", "consumers", "convert", "creating", "customers", "direct", "directly", "distribution", "facilities", "independent", "linked", "logistics", "management", "materials", "network", "products", "structure", "suppliers".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationairassetsauthoritycertificationcommercialcontrolcreateddepartmentfederalgovernmentorganizationpersonnelregulatessettingspacestandardssurroundingtraffictransportation
SHARED TOKENS (21): "administration", "air", "assets", "authority", "certification", "commercial", "control", "created", "department", "federal", "government", "organization", "personnel", "regulates", "setting", "space", "standards", "surrounding", "traffic", "transportation".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
Trade show ↗ Q57305 EXACT TITLE
consumercontinuingcustomersestablishedeventeventsfinalgeneralindustrylatestmarketmarketsopportunitiespresentproductspublicshowshowsstudytherefore
SHARED TOKENS (20): "consumer", "continuing", "customers", "established", "event", "events", "final", "general", "industry", "latest", "market", "markets", "opportunities", "present", "products", "public", "show", "shows", "study", "therefore". | EXACT TITLE in wedding_events: "Trade show".
0.500
additionalairairlinesbranddestinationsextendsformformationhistoryindependentlatermajornetworkoperatesoperatingprincipalregionalrouteseattlethroughout
SHARED TOKENS (20): "additional", "air", "airlines", "brand", "destinations", "extends", "form", "formation", "history", "independent", "later", "major", "network", "operates", "operating", "principal", "regional", "route", "seattle", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
apartbeyondbusinesscertainchangescompletionconditionsdatademandeconomiceconomyemploymentextendsfallsfutureincreasesinventorymaintenancemarketneed
SHARED TOKENS (33): "apart", "beyond", "business", "certain", "changes", "completion", "conditions", "data", "demand", "economic", "economy", "employment", "extends", "falls", "future", "increases", "inventory", "maintenance", "market", "need".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
authoritydocumentissueditselfjurisdictionslegallicenselicensesorganizationotherwiseperiodpermitplacerecordrequireserve
SHARED TOKENS (16): "authority", "document", "issued", "itself", "jurisdictions", "legal", "license", "licenses", "organization", "otherwise", "period", "permit", "place", "record", "require", "serve". | EXACT TITLE in wedding_events: "Marriage license".
0.500
academicageagenciesbeyondcollegecontinuingdevelopmentdifferentdistinctivedivisioneconomiceducationextensionformalfrequentlygeneralgeneratinggovernmentinstitutionalintegrated
SHARED TOKENS (35): "academic", "age", "agencies", "beyond", "college", "continuing", "development", "different", "distinctive", "division", "economic", "education", "extension", "formal", "frequently", "general", "generating", "government", "institutional", "integrated".... | EXACT TITLE in wedding_events: "Continuing education".
0.500
affectagainstcostcostscreateddedicateddesignedevenexpresslyfinancingfundgeneralgroupindividualinsurancelegalliabilitylimitsotherwisepayment
SHARED TOKENS (29): "affect", "against", "cost", "costs", "created", "dedicated", "designed", "even", "expressly", "financing", "fund", "general", "group", "individual", "insurance", "legal", "liability", "limits", "otherwise", "payment".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionalboardbuiltbusinesscentercostdepartmentdepartmentsdestinationdestinationsdirectearlyeconomyenvironmentequipmenteventexecutivefacilitiesfacility
SHARED TOKENS (55): "access", "additional", "board", "built", "business", "center", "cost", "department", "departments", "destination", "destinations", "direct", "early", "economy", "environment", "equipment", "event", "executive", "facilities", "facility".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstbehaviorconditionsdecisiondirectlydistinctevenindividualinfluenceinformationlimitednetworkpeoplepositionproblemprocesssecondspacesupporttechnology
SHARED TOKENS (20): "against", "behavior", "conditions", "decision", "directly", "distinct", "even", "individual", "influence", "information", "limited", "network", "people", "position", "problem", "process", "second", "space", "support", "technology". | EXACT TITLE in wedding_events: "Information cascade".
0.500
accessairairlinesallowingarrangementsassociationauthoritiescompetingcompetitivecontractingcoordinationcostsdesignateddevelopmenteconomicestatefinancialfrequentlyfundinggeneral
SHARED TOKENS (60): "access", "air", "airlines", "allowing", "arrangements", "association", "authorities", "competing", "competitive", "contracting", "coordination", "costs", "designated", "development", "economic", "estate", "financial", "frequently", "funding", "general".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
Snake River ↗ Q272074 EXACT TITLE
ageagenciescanyoncentralcommercialcontrolcreateddevelopedeastfallsfloodfurtherhistoryidahoirrigationlakelargelimitedlowermajor
SHARED TOKENS (40): "age", "agencies", "canyon", "central", "commercial", "control", "created", "developed", "east", "falls", "flood", "further", "history", "idaho", "irrigation", "lake", "large", "limited", "lower", "major".... | EXACT TITLE in wedding_events: "Snake River".
0.500
appliedcontextcontroldesignedequipmentfrequentlyfunctionsinformationinvolvinglaborlargemobileoperationsotherwisepeoplepowerprimarysourcestructuresystems
SHARED TOKENS (24): "applied", "context", "control", "designed", "equipment", "frequently", "functions", "information", "involving", "labor", "large", "mobile", "operations", "otherwise", "people", "power", "primary", "source", "structure", "systems".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
becomecommercialdigitaldirectdistinctionfieldhistoricallylocalmediamethodsmovingnewsproductionstoragework
SHARED TOKENS (15): "become", "commercial", "digital", "direct", "distinction", "field", "historically", "local", "media", "methods", "moving", "news", "production", "storage", "work". | EXACT TITLE in wedding_events: "Videography".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectioncreatingeventfoodintegratedlocalmeansnationalplacepracticeservesharingsource
SHARED TOKENS (18): "agriculture", "among", "associated", "communities", "community", "connection", "creating", "event", "food", "integrated", "local", "means", "national", "place", "practice", "serve", "sharing", "source". | EXACT TITLE in wedding_events: "Festival".
0.500
accordingalreadyassetsconsumerscreatecustomercustomersidentifiedincreaseindustryneedsorganizationpersonnelpoliciesproductsqualitystandardsstrategiesuses
SHARED TOKENS (19): "according", "already", "assets", "consumers", "create", "customer", "customers", "identified", "increase", "industry", "needs", "organization", "personnel", "policies", "products", "quality", "standards", "strategies", "uses". | EXACT TITLE in wedding_events: "Customer service".
0.500
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancefinancialfinancingfirmsfundgeneralinvestmentlimitedlong-termmanagementoperationalotherwise
SHARED TOKENS (31): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "general", "investment", "limited", "long-term", "management", "operational", "otherwise".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Tent ↗ Q170544 EXACT TITLE
capablecitiesintendedlargelargerlinkedmaterialmultiplenearpeoplesecondsizesmallstructuressupportingtemporary
SHARED TOKENS (16): "capable", "cities", "intended", "large", "larger", "linked", "material", "multiple", "near", "people", "second", "size", "small", "structures", "supporting", "temporary". | EXACT TITLE in transportation_infrastructure: "Tent". | EXACT TITLE in wedding_events: "Tent".
0.500
Orchard ↗ Q236371 EXACT TITLE
basecommercialconcentratedfoodgardenlargemaintenancemakesnearproductionscaleservesingleuntilwater
SHARED TOKENS (15): "base", "commercial", "concentrated", "food", "garden", "large", "maintenance", "makes", "near", "production", "scale", "serve", "single", "until", "water". | EXACT TITLE in wedding_events: "Orchard".
0.500
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingbuiltconcentrateddifferenteveneventsfoodformformallargepeoplethemtogether
SHARED TOKENS (15): "additional", "among", "building", "built", "concentrated", "different", "even", "events", "food", "form", "formal", "large", "people", "them", "together". | EXACT TITLE in wedding_events: "Banquet".
0.500
accessagenciesbeyondcitiescommunitycustomersdailydesigneddestinationdevelopeddriverseconomicextendsformformalgovernmentincomelocalmetropolitanmobility
SHARED TOKENS (39): "access", "agencies", "beyond", "cities", "community", "customers", "daily", "designed", "destination", "developed", "drivers", "economic", "extends", "form", "formal", "government", "income", "local", "metropolitan", "mobility".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
activityagenciesauthorizationbusinessdepartmentsdeterminesdetermininggovernmentissuedjurisdictionlicenselicenseslocalmultiplemunicipalitiesoperateoperatingpermitsphysicalrequires
SHARED TOKENS (21): "activity", "agencies", "authorization", "business", "departments", "determines", "determining", "government", "issued", "jurisdiction", "license", "licenses", "local", "multiple", "municipalities", "operate", "operating", "permits", "physical", "requires".... | EXACT TITLE in wedding_events: "Business license".
0.490
approximatelyboisecentercomplexidahonampawest
SHARED TOKENS (7): "approximately", "boise", "center", "complex", "idaho", "nampa", "west". | URL->B (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.480
Floodplain ↗ Q193110 EXACT TITLE
adjacentagriculturalbasecontroldevelopedfloodfrequentlyincreasinglandnearriverurbanvalleywater
SHARED TOKENS (14): "adjacent", "agricultural", "base", "control", "developed", "flood", "frequently", "increasing", "land", "near", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.480
designdestinationdifferentdocumentationeventindustrymanagementplannersplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (14): "design", "destination", "different", "documentation", "event", "industry", "management", "planners", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.480
controlsdesigndifferentjurisdictionsmajorotherwisepracticeroadroadsseparatespecifiedtrafficusesvehicles
SHARED TOKENS (14): "controls", "design", "different", "jurisdictions", "major", "otherwise", "practice", "road", "roads", "separate", "specified", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.480
boiseexpansionidaholakeoperatingportlandrailrestorationroutesaltseattleservethoughtrain
SHARED TOKENS (14): "boise", "expansion", "idaho", "lake", "operating", "portland", "rail", "restoration", "route", "salt", "seattle", "serve", "though", "train". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.460
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalintegratedlevelnetworkplannedrequirementstechnologytransferuses
SHARED TOKENS (13): "access", "context", "data", "different", "digital", "integrated", "level", "network", "planned", "requirements", "technology", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.460
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialconcentrateddistrictdowntownemploymentlowerofficepopulationpublicsmall
SHARED TOKENS (13): "business", "center", "central", "commercial", "concentrated", "district", "downtown", "employment", "lower", "office", "population", "public", "small". | EXACT TITLE in transportation_infrastructure: "Downtown". | EXACT TITLE in wedding_events: "Downtown".
0.460
fieldfreewaypermitroadroadsroutesstandardstreetssystemthoughtraffictransportuses
SHARED TOKENS (13): "field", "freeway", "permit", "road", "roads", "routes", "standard", "streets", "system", "though", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.460
administrationdepartmentdivisionfederalmajorofficeprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (13): "administration", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.440
Resort ↗ Q875157 EXACT TITLE
centralcommercialcontainingfoodfrequentlymeansneedsoperatedownedownershippeoplesingle
SHARED TOKENS (12): "central", "commercial", "containing", "food", "frequently", "means", "needs", "operated", "owned", "ownership", "people", "single". | EXACT TITLE in wedding_events: "Resort".
0.440
Utility ↗ Q466707 EXACT TITLE
amongbehaviorcertaincontextdecisiondevelopeddistinctfunctionfunctionsgoalrelationshipsource
SHARED TOKENS (12): "among", "behavior", "certain", "context", "decision", "developed", "distinct", "function", "functions", "goal", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.440
activityamongfallsidahomeridianpercentprogramspublicresearchstudentstwinuniversity
SHARED TOKENS (12): "activity", "among", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "twin", "university". | EXACT TITLE in transportation_infrastructure: "Idaho State University". | EXACT TITLE in wedding_events: "Idaho State University".
0.420
Rose garden ↗ Q291177 EXACT TITLE
alongsidealreadyexistinggardenindividualoriginsparkpresentpublicspecializedtreated
SHARED TOKENS (11): "alongside", "already", "existing", "garden", "individual", "origins", "park", "present", "public", "specialized", "treated". | EXACT TITLE in wedding_events: "Rose garden".
0.420
agreementarrangementsdesignateddrivedrivershomeinfluenceremainssafelyselectionterms
SHARED TOKENS (11): "agreement", "arrangements", "designated", "drive", "drivers", "home", "influence", "remains", "safely", "selection", "terms". | EXACT TITLE in wedding_events: "Designated driver".
0.420
Barn ↗ Q1303167 EXACT TITLE
agriculturalappliedbuildingbuildingsequipmenthouseintegratedrestrictedstoragestructuresterms
SHARED TOKENS (11): "agricultural", "applied", "building", "buildings", "equipment", "house", "integrated", "restricted", "storage", "structures", "terms". | EXACT TITLE in wedding_events: "Barn".
0.420
Cosmetology ↗ EXACT TITLE
applicationcostlicensemedianoccupationalpermanentschoolstudytimestreatmentwage
SHARED TOKENS (11): "application", "cost", "license", "median", "occupational", "permanent", "school", "study", "times", "treatment", "wage". | EXACT TITLE in wedding_events: "Cosmetology".
0.420
Snowplow ↗ Q14976 EXACT TITLE
frequentlyintendedlargeoutdoorrailreceiveservingstreetstransportationvehicleswinter
SHARED TOKENS (11): "frequently", "intended", "large", "outdoor", "rail", "receive", "serving", "streets", "transportation", "vehicles", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
consumerscontractorsequipmentfinalgeneralindividualindustrylimitedperiodtemporary
SHARED TOKENS (10): "consumers", "contractors", "equipment", "final", "general", "individual", "industry", "limited", "period", "temporary". | EXACT TITLE in wedding_events: "Equipment rental".
0.400
businessclimatecommercialestategroupmanagementprofessionalrealseattleview
SHARED TOKENS (10): "business", "climate", "commercial", "estate", "group", "management", "professional", "real", "seattle", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.400
Sidewalk ↗ Q177749 EXACT TITLE
adjacentbuildingscurbdesignedlandmobilitypedestrianprivateroadstreet
SHARED TOKENS (10): "adjacent", "buildings", "curb", "designed", "land", "mobility", "pedestrian", "private", "road", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.400
departmentdevelopmenteconomicidahoinsurancelabormanagedselectedtechnologyworkforce
SHARED TOKENS (10): "department", "development", "economic", "idaho", "insurance", "labor", "managed", "selected", "technology", "workforce". | EXACT TITLE in transportation_infrastructure: "Idaho Department of Labor". | EXACT TITLE in wedding_events: "Idaho Department of Labor".
0.380
Use tax ↗ Q17155766 EXACT TITLE
appliedequivalentpropertysalessoldstoragesubjecttaxtaxes
SHARED TOKENS (9): "applied", "equivalent", "property", "sales", "sold", "storage", "subject", "tax", "taxes". | EXACT TITLE in wedding_events: "Use tax".
0.380
buildingsbuiltcitiesdevelopmentenvironmentmaintainspreservationpreserveproducts
SHARED TOKENS (9): "buildings", "built", "cities", "development", "environment", "maintains", "preservation", "preserve", "products". | EXACT TITLE in wedding_events: "Historic preservation".
0.360
amongcannotdeterminelawlegallegallyrequirementsterms
SHARED TOKENS (8): "among", "cannot", "determine", "law", "legal", "legally", "requirements", "terms". | EXACT TITLE in wedding_events: "Marriage law".
0.360
associationcommunityeventsidahojunenampaprofessionalriver
SHARED TOKENS (8): "association", "community", "events", "idaho", "june", "nampa", "professional", "river". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.360
agenciesbusinessescapitalfinancialidentificationnonprofitprocessthough
SHARED TOKENS (8): "agencies", "businesses", "capital", "financial", "identification", "nonprofit", "process", "though". | EXACT TITLE in wedding_events: "Fundraising".
0.360
accommodatebuildingcentercentersdesignedlargemajorshows
SHARED TOKENS (8): "accommodate", "building", "center", "centers", "designed", "large", "major", "shows". | EXACT TITLE in wedding_events: "Convention center".
0.360
Beer garden ↗ Q857909 EXACT TITLE
capitalfoodgardenlocaloutdoorremainservedshared
SHARED TOKENS (8): "capital", "food", "garden", "local", "outdoor", "remain", "served", "shared". | EXACT TITLE in wedding_events: "Beer garden".
0.360
amongbuildingbuildingsbuiltcostsdesignedexistingterms
SHARED TOKENS (8): "among", "building", "buildings", "built", "costs", "designed", "existing", "terms". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.360
Restaurant ↗ Q11707 EXACT TITLE
businesscustomersdeliveryfoodmodelsservedservessingle
SHARED TOKENS (8): "business", "customers", "delivery", "food", "models", "served", "serves", "single". | EXACT TITLE in wedding_events: "Restaurant".
0.340
Public records ↗ EXACT TITLE
agenciesdocumentsgovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (7): "agencies", "documents", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in wedding_events: "Public records".
0.340
arrangementscreatedeliverydesignevidencemarketingmaterial
SHARED TOKENS (7): "arrangements", "create", "delivery", "design", "evidence", "marketing", "material". | EXACT TITLE in wedding_events: "Floral design".
0.340
Officiant ↗ Q2015874 EXACT TITLE
facilityhealthlawlegalservespecifiedwork
SHARED TOKENS (7): "facility", "health", "law", "legal", "serve", "specified", "work". | EXACT TITLE in wedding_events: "Officiant".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurbanwestern
SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River". | EXACT TITLE in wedding_events: "Boise River".
0.320
businessesissuedlicenseofficialotherwisepermit
SHARED TOKENS (6): "businesses", "issued", "license", "official", "otherwise", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.320
functionsgovernmenthealthjurisdictionrecordssigns
SHARED TOKENS (6): "functions", "government", "health", "jurisdiction", "records", "signs". | EXACT TITLE in wedding_events: "Vital statistics".
0.320
engineeringfieldinvolvingnetworktraffictransportation
SHARED TOKENS (6): "engineering", "field", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
Interior design ↗ KW CROSS HIGH
buildingdesigndesignersdevelopmentenvironmentmanagementpeopleplanningplansprojectresearchsitespacespacesstakeholdersvisual
SHARED TOKENS (16): "building", "design", "designers", "development", "environment", "management", "people", "planning", "plans", "project", "research", "site", "space", "spaces", "stakeholders", "visual".
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
agreementappliesbeyondcontractscontrolcontrolleddistinctdistinctionemergencyentirelyeventeventsfloodgeneralgoverninggovernsintendeditselflawlegal
SHARED TOKENS (37): "agreement", "applies", "beyond", "contracts", "control", "controlled", "distinct", "distinction", "emergency", "entirely", "event", "events", "flood", "general", "governing", "governs", "intended", "itself", "law", "legal"....
0.300
agriculturalagricultureassociateddifferentequipmenteventeventsfarmpracticespublicrecreationsharingshowshowstermswork
SHARED TOKENS (16): "agricultural", "agriculture", "associated", "different", "equipment", "event", "events", "farm", "practices", "public", "recreation", "sharing", "show", "shows", "terms", "work".
0.300
activeadvertisingamongcurrentcustomersdatadigitaldominantfirmsgeneralgovernancelevelmanagementmarketingmediaplatformspotentialpractitionersproductspublic
SHARED TOKENS (26): "active", "advertising", "among", "current", "customers", "data", "digital", "dominant", "firms", "general", "governance", "level", "management", "marketing", "media", "platforms", "potential", "practitioners", "products", "public"....
0.300
connectedequipmentfacilitiesinfrastructurelargemobilemunicipaloutdoorrequiresinglesitessmallsystemtermstreatmenturban
SHARED TOKENS (16): "connected", "equipment", "facilities", "infrastructure", "large", "mobile", "municipal", "outdoor", "require", "single", "sites", "small", "system", "terms", "treatment", "urban".
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedautomobilebrandconditionscustomersdeterminedigitalindependentinspectionmaintenanceneedspartsproblemrolesignswork
SHARED TOKENS (18): "already", "approval", "approved", "automobile", "brand", "conditions", "customers", "determine", "digital", "independent", "inspection", "maintenance", "needs", "parts", "problem", "role", "signs", "work".
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
agreementsamongapplicablebeyondcertaincompletedcontroldistributionestablishingextendformformalgroupintendeditselfjurisdictionjurisdictionslargelawlegal
SHARED TOKENS (36): "agreements", "among", "applicable", "beyond", "certain", "completed", "control", "distribution", "establishing", "extend", "form", "formal", "group", "intended", "itself", "jurisdiction", "jurisdictions", "large", "law", "legal"....
0.300
academicadministrationbusinesscenterscollegededicateddepartmentdestinationfieldindustrymanagementmarketingmasterparksrelevantschoolstudysubjecttourismuniversity
SHARED TOKENS (20): "academic", "administration", "business", "centers", "college", "dedicated", "department", "destination", "field", "industry", "management", "marketing", "master", "parks", "relevant", "school", "study", "subject", "tourism", "university".
0.300
becomechaincomplexconsolidationconsumersdifferentdirectlyeconomyfinalintegratedlargemanagementmarketneedownedownershippositionproblemproduceproduces
SHARED TOKENS (27): "become", "chain", "complex", "consolidation", "consumers", "different", "directly", "economy", "final", "integrated", "large", "management", "market", "need", "owned", "ownership", "position", "problem", "produce", "produces"....
0.300
activityadministrationagenciesbuiltchangescontrolcoordinatecreateddivisioneconomiceducationenforcementenvironmentexecutiveexpandedfurthergoverninggovernmentincreaseinfluence
SHARED TOKENS (34): "activity", "administration", "agencies", "built", "changes", "control", "coordinate", "created", "division", "economic", "education", "enforcement", "environment", "executive", "expanded", "further", "governing", "government", "increase", "influence"....
0.300
ageallowingannuallyappliesapplyauthorizedbasecertaincommunitycompliancecontinuedistributiondistrictdriversfacilityfederalfinalfundinggovernmenthome
SHARED TOKENS (58): "age", "allowing", "annually", "applies", "apply", "authorized", "base", "certain", "community", "compliance", "continue", "distribution", "district", "drivers", "facility", "federal", "final", "funding", "government", "home"....
0.300
administrationageairairlinesbuildingcenterscommercialdepartmentdieseldistributiondivisiondrivedriverseconomyeducationfederalgoverninggovernshandlinghealth
SHARED TOKENS (51): "administration", "age", "air", "airlines", "building", "centers", "commercial", "department", "diesel", "distribution", "division", "drive", "drivers", "economy", "education", "federal", "governing", "governs", "handling", "health"....
0.300
alongsidecapacitycapitalcitiesconnectingconventionalcostdailydedicateddesigndesignedlowermillionnetworkpublicqualityrailreliabilitysinglesystem
SHARED TOKENS (23): "alongside", "capacity", "capital", "cities", "connecting", "conventional", "cost", "daily", "dedicated", "design", "designed", "lower", "million", "network", "public", "quality", "rail", "reliability", "single", "system"....
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare".
0.300
businesscomconnectconnectsconsumerscreatescustomersdemanddevelopeddevelopmentdigitaldirectdistincteconomicgovernancegrouphealthmaintenancemarketmarkets
SHARED TOKENS (45): "business", "com", "connect", "connects", "consumers", "creates", "customers", "demand", "developed", "development", "digital", "direct", "distinct", "economic", "governance", "group", "health", "maintenance", "market", "markets"....
0.300
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemarketingmetropolitanparkparkingpeoplepoolpublicrailroadsignssystemtransfertransportvehicles
SHARED TOKENS (17): "cities", "connections", "large", "marketing", "metropolitan", "park", "parking", "people", "pool", "public", "rail", "road", "signs", "system", "transfer", "transport", "vehicles".
0.300
appliedappliesapprovalassociationcontextdecisiondefinesdevelopmentdocumentationgovernedidentifyingmajormanagementmoveparticipationplanplanspoliciespolicypotential
SHARED TOKENS (32): "applied", "applies", "approval", "association", "context", "decision", "defines", "development", "documentation", "governed", "identifying", "major", "management", "move", "participation", "plan", "plans", "policies", "policy", "potential"....
0.300
acquisitionactivityassetsbusinesscapitalcentralcertaincombinedcommissioncompetitiveconsolidatedconsolidationcontrolcorporatecreatedepartmentdirectentitiesfederalgoverned
SHARED TOKENS (44): "acquisition", "activity", "assets", "business", "capital", "central", "certain", "combined", "commission", "competitive", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "entities", "federal", "governed"....
0.300
accessadvancedautomobilebuiltcapacitycentralchangescitiescompletedconnectconnectedconnectingcontainingdesignedegressevenfreewayimpliesincreasinglimits
SHARED TOKENS (48): "access", "advanced", "automobile", "built", "capacity", "central", "changes", "cities", "completed", "connect", "connected", "connecting", "containing", "designed", "egress", "even", "freeway", "implies", "increasing", "limits"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellcontinueeastgeneralidahointerstatemajornationalnearofficialpacificparallelparkplannedpositioningriverroadroadsrouterules
SHARED TOKENS (23): "caldwell", "continue", "east", "general", "idaho", "interstate", "major", "national", "near", "official", "pacific", "parallel", "park", "planned", "positioning", "river", "road", "roads", "route", "rules"....
0.300
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteasthouseidahometropolitannamepartspopulationrapidlyschoolschoolssharedwest
SHARED TOKENS (16): "ada", "boise", "canyon", "district", "east", "house", "idaho", "metropolitan", "name", "parts", "population", "rapidly", "school", "schools", "shared", "west".
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activitychaincommercialconditionsconsumersdeliverydistributionemergencyfoodformlaterlogisticspeoplepreservationproduceproductsrathersecuritysolelystorage
SHARED TOKENS (24): "activity", "chain", "commercial", "conditions", "consumers", "delivery", "distribution", "emergency", "food", "form", "later", "logistics", "people", "preservation", "produce", "products", "rather", "security", "solely", "storage"....
0.300
adjacentaffectagriculturalagricultureclimatecommunitiesconnectconnectivitycontroldistinctionengineeringevenfloodfoodhealthinfluenceinterfacelandland-uselandscape
SHARED TOKENS (45): "adjacent", "affect", "agricultural", "agriculture", "climate", "communities", "connect", "connectivity", "control", "distinction", "engineering", "even", "flood", "food", "health", "influence", "interface", "land", "land-use", "landscape"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
airapplicationsapproximatelycapablechangesidentifiesincreaseissuelargematerialsmechanismoperateoperatesoperationoperationsphysicalpressureprocessproduceproduces
SHARED TOKENS (28): "air", "applications", "approximately", "capable", "changes", "identifies", "increase", "issue", "large", "materials", "mechanism", "operate", "operates", "operation", "operations", "physical", "pressure", "process", "produce", "produces"....
0.300
completedcontainscouncildifferentfrequentlyhistoryhomehousenonprofitorganizationpeopleperiodphysicalplacementrolesitestandardssupporttourismtraces
SHARED TOKENS (21): "completed", "contains", "council", "different", "frequently", "history", "home", "house", "nonprofit", "organization", "people", "period", "physical", "placement", "role", "site", "standards", "support", "tourism", "traces"....
0.300
departmentdepartmentsdirectlyeconomyexecutivefederalgovernmentmissionpeopleplanreportssafeservingstrategicsystemtransportation
SHARED TOKENS (16): "department", "departments", "directly", "economy", "executive", "federal", "government", "mission", "people", "plan", "reports", "safe", "serving", "strategic", "system", "transportation".
0.300
Food truck ↗ KW CROSS HIGH
amongbecomecommercialcustomersdailydevelopedeconomicestimatedfoodhotindustrylargemajormobileoperationpartspeopleregionalservestreet
SHARED TOKENS (25): "among", "become", "commercial", "customers", "daily", "developed", "economic", "estimated", "food", "hot", "industry", "large", "major", "mobile", "operation", "parts", "people", "regional", "serve", "street"....
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
contextcontractsdifferenteventsexpresslyforminsuranceitselflawlimitedmedicaloperationprincipalrelationshiprelevantresponsibilitiesspecified
SHARED TOKENS (17): "context", "contracts", "different", "events", "expressly", "form", "insurance", "itself", "law", "limited", "medical", "operation", "principal", "relationship", "relevant", "responsibilities", "specified".
0.300
combinedconnectsconsumerscurrentcustomersdeliverydirectdirectlydistinctdistributionelectricalevenformgeneratinghandlinghistoricallyincreaseindustrylevelline
SHARED TOKENS (33): "combined", "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "electrical", "even", "form", "generating", "handling", "historically", "increase", "industry", "level", "line"....
0.300
accessibilityadaagainstbusinesschangescostscouncilemployersfinalhouselaterlawnationalprohibitspublicrequirementsrequiresrights
SHARED TOKENS (18): "accessibility", "ada", "against", "business", "changes", "costs", "council", "employers", "final", "house", "later", "law", "national", "prohibits", "public", "requirements", "requires", "rights".
0.300
airbuildingcertainconditionscontainingcreatesenvironmentevenhealthhotidentificationmaterialspeoplepersonnelphysicalpropertypublicregulationsriskssafety
SHARED TOKENS (26): "air", "building", "certain", "conditions", "containing", "creates", "environment", "even", "health", "hot", "identification", "materials", "people", "personnel", "physical", "property", "public", "regulations", "risks", "safety"....
0.300
accessadditionaladministrationannuallyapproximatelyavoidbuiltcompletecontrolledcostcreatingdesigndesigneddevelopedequivalentestablishedextendsfederalfreewayfuel
SHARED TOKENS (55): "access", "additional", "administration", "annually", "approximately", "avoid", "built", "complete", "controlled", "cost", "creating", "design", "designed", "developed", "equivalent", "established", "extends", "federal", "freeway", "fuel"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationairanalysisarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescodescommunicationscommunitiescommunitycreatingdesigndevelopmentdifferent
SHARED TOKENS (70): "accessibility", "administration", "air", "analysis", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "codes", "communications", "communities", "community", "creating", "design", "development", "different"....
0.300
accordingactivityanalysisbecomesboundariesdesigndocumentationengineeringenvironmentestablishedgeneralgovernmentjurisdictionslegallicenselicensedlocalmaintenancepartsplans
SHARED TOKENS (41): "according", "activity", "analysis", "becomes", "boundaries", "design", "documentation", "engineering", "environment", "established", "general", "government", "jurisdictions", "legal", "license", "licensed", "local", "maintenance", "parts", "plans"....
0.300
academicapplicationdesignengineeringfacilitiesfieldmanagementoccupationaloperationpeopleplanningsafetechnologytransporttransportation
SHARED TOKENS (15): "academic", "application", "design", "engineering", "facilities", "field", "management", "occupational", "operation", "people", "planning", "safe", "technology", "transport", "transportation".
0.300
activeagenciesairapproximatelyauthorityauthorizedbuildingbusinesscapacitycombinedcontroldepartmentdesigndirectdirectlyeasteconomyengineeringenvironmentestablish
SHARED TOKENS (61): "active", "agencies", "air", "approximately", "authority", "authorized", "building", "business", "capacity", "combined", "control", "department", "design", "direct", "directly", "east", "economy", "engineering", "environment", "establish"....
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscitiescontroldedicateddepartmentdominantfacilitiesholdingintendedjurisdictionslimitedmajormunicipalitiesparkparkingpeoplepermitrequirerequiresspaces
SHARED TOKENS (24): "buildings", "cities", "control", "dedicated", "department", "dominant", "facilities", "holding", "intended", "jurisdictions", "limited", "major", "municipalities", "park", "parking", "people", "permit", "require", "requires", "spaces"....
0.300
accessadvertisingbehaviorbusinessesconstraintsconsumerscontextcontrolledcurrentcustomersdatadriveevenformgovernmenthealthinformationlocalmobilenetwork
SHARED TOKENS (32): "access", "advertising", "behavior", "businesses", "constraints", "consumers", "context", "controlled", "current", "customers", "data", "drive", "even", "form", "government", "health", "information", "local", "mobile", "network"....
0.300
activeadvertisingaffectallowingapplicationsbrandbusinessesconnectconsumerscostcreatecreatedcustomercustomersdevelopedentryeventincreasinginfluenceinformation
SHARED TOKENS (36): "active", "advertising", "affect", "allowing", "applications", "brand", "businesses", "connect", "consumers", "cost", "create", "created", "customer", "customers", "developed", "entry", "event", "increasing", "influence", "information"....
0.300
airconcerningconsolidationcontroldifferentdocumentationinsurancelogisticsmanagementmaterialsmovepeopleplanningpurchasingrailroadtraffictraintransportvehicles
SHARED TOKENS (20): "air", "concerning", "consolidation", "control", "different", "documentation", "insurance", "logistics", "management", "materials", "move", "people", "planning", "purchasing", "rail", "road", "traffic", "train", "transport", "vehicles".
0.300
academicbecomebecomesbehaviorcompetecontextcostsdatededicateddevelopeddevelopmentdiscoveryfinancialhomeinformationlargemaintenancemajormediamobile
SHARED TOKENS (37): "academic", "become", "becomes", "behavior", "compete", "context", "costs", "date", "dedicated", "developed", "development", "discovery", "financial", "home", "information", "large", "maintenance", "major", "media", "mobile"....
0.300
administrationbusinesscapitalconsolidationcreatingdepartmentsdesigndevelopmentdocumentingearlyemployeefieldfurtherinclusioninvolvinglabormanagementorganizationpeopleperformance
SHARED TOKENS (32): "administration", "business", "capital", "consolidation", "creating", "departments", "design", "development", "documenting", "early", "employee", "field", "further", "inclusion", "involving", "labor", "management", "organization", "people", "performance"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
createdigitalequipmenteveneventsfunctionslatermediamobileprivateprogramspublicrealrecordrecordssimultaneouslysmallspecializedstationsthem
SHARED TOKENS (23): "create", "digital", "equipment", "even", "events", "functions", "later", "media", "mobile", "private", "programs", "public", "real", "record", "records", "simultaneously", "small", "specialized", "stations", "them"....
0.300
arrangementsbrandbusinesscontractscontroldesigndirectentryfeefunctionsgovernmentindustryinvestmentlargelicensinglocallowermanagementmethodsoperating
SHARED TOKENS (31): "arrangements", "brand", "business", "contracts", "control", "design", "direct", "entry", "fee", "functions", "government", "industry", "investment", "large", "licensing", "local", "lower", "management", "methods", "operating"....
0.300
accesschaincostsdestinationdirectgeneralgroupintendeditselflogisticsmaterialmovingoperatingpracticepracticesrailregionspecializedtraintrains
SHARED TOKENS (23): "access", "chain", "costs", "destination", "direct", "general", "group", "intended", "itself", "logistics", "material", "moving", "operating", "practice", "practices", "rail", "region", "specialized", "train", "trains"....
0.300
agreementsappliesbecomebuildingscenterscommunitiesconnectiondocumentseconomicfuturegroupindustryknowledgelegallocalmajornationalphysicalpreservationproperty
SHARED TOKENS (26): "agreements", "applies", "become", "buildings", "centers", "communities", "connection", "documents", "economic", "future", "group", "industry", "knowledge", "legal", "local", "major", "national", "physical", "preservation", "property"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedautomobilebecomebuildingcitiescommercialcostsdevelopmentenvironmentexistingexpansionformgeneratinggrowthhousinginfrastructurelandlargepeopleplanning
SHARED TOKENS (38): "associated", "automobile", "become", "building", "cities", "commercial", "costs", "development", "environment", "existing", "expansion", "form", "generating", "growth", "housing", "infrastructure", "land", "large", "people", "planning"....
0.300
Vineyard ↗ Q22715 EXACT TITLE
itselfplacepracticeproductionstudy
SHARED TOKENS (5): "itself", "place", "practice", "production", "study". | EXACT TITLE in wedding_events: "Vineyard".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesigndieselenvironmentfullincreaselowermakesmovesneednoisepedestrianreducedrequireresearchresultingroadrules
SHARED TOKENS (29): "associated", "become", "central", "design", "diesel", "environment", "full", "increase", "lower", "makes", "moves", "need", "noise", "pedestrian", "reduced", "require", "research", "resulting", "road", "rules"....
0.300
accordingcreatingdemandformfunctionsmedicalmobileneedsnetworkpeopleprivateprogramspublicratherrelevantrouteroutesruralsharedtechnology
SHARED TOKENS (22): "according", "creating", "demand", "form", "functions", "medical", "mobile", "needs", "network", "people", "private", "programs", "public", "rather", "relevant", "route", "routes", "rural", "shared", "technology"....
0.300
affectedcommunitydifferentemergencyeventsfederalhazardslocalmanagementneedsprofessionalrequiresresponsesearchterms
SHARED TOKENS (15): "affected", "community", "different", "emergency", "events", "federal", "hazards", "local", "management", "needs", "professional", "requires", "response", "search", "terms".
0.300
builtbusinessescenterscentralchangescitiesdevelopmentdriveeasteconomicexpansionformationgrowthmodelplannedpopulationprocessresidentsruralshift
SHARED TOKENS (21): "built", "businesses", "centers", "central", "changes", "cities", "development", "drive", "east", "economic", "expansion", "formation", "growth", "model", "planned", "population", "process", "residents", "rural", "shift"....
0.300
activeaffectedagenciesassociatedbusinessescapacitycompetitivedeterminedeterminingdistributioneconomicemploymententryexistingfirmsfunctionindustrylandlawmarket
SHARED TOKENS (36): "active", "affected", "agencies", "associated", "businesses", "capacity", "competitive", "determine", "determining", "distribution", "economic", "employment", "entry", "existing", "firms", "function", "industry", "land", "law", "market"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedbehaviorclassificationscontroldriversenforcementeventhealthidentifiedlevelmethodsoccupationalpedestrianpracticesproducepublicrapidlyremainrequiringroad
SHARED TOKENS (32): "applied", "behavior", "classifications", "control", "drivers", "enforcement", "event", "health", "identified", "level", "methods", "occupational", "pedestrian", "practices", "produce", "public", "rapidly", "remain", "requiring", "road"....
0.300
advertisingbrandbroaderbusinessbusinessescentralcommunicationscontrolledcreatecustomersdirectequivalentestablisheventeventsexecutiveexposurefieldfirmsform
SHARED TOKENS (49): "advertising", "brand", "broader", "business", "businesses", "central", "communications", "controlled", "create", "customers", "direct", "equivalent", "establish", "event", "events", "executive", "exposure", "field", "firms", "form"....
0.300
blockbuildingbusinesscentercentraldedicateddesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivateproblempublicrailrelationship
SHARED TOKENS (28): "block", "building", "business", "center", "central", "dedicated", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "problem", "public", "rail", "relationship"....
0.300
availabilityconsumerconsumersfeegeneralinformationmultipleneedsoperatorprimaryprocessproductionproductsprovidersretailsegmentselectionsinglesitewider
SHARED TOKENS (20): "availability", "consumer", "consumers", "fee", "general", "information", "multiple", "needs", "operator", "primary", "process", "production", "products", "providers", "retail", "segment", "selection", "single", "site", "wider".
0.300
aircreatedieselfueluses
SHARED TOKENS (5): "air", "create", "diesel", "fuel", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.300
advancedapartapplicationscategorycombinedconnectivityconsumercontainingcontrolsconventionalcreateddigitalearlyexposurefieldfinalformfunctionsfurtherhistory
SHARED TOKENS (45): "advanced", "apart", "applications", "category", "combined", "connectivity", "consumer", "containing", "controls", "conventional", "created", "digital", "early", "exposure", "field", "final", "form", "functions", "further", "history"....
0.300
advertisingagenciesbecomecreatedigitalestimatesformfrequentlyincreaseindependentmarketingmediamobilemultipleoperatingplaceplatformspotentialpracticesproducts
SHARED TOKENS (28): "advertising", "agencies", "become", "create", "digital", "estimates", "form", "frequently", "increase", "independent", "marketing", "media", "mobile", "multiple", "operating", "place", "platforms", "potential", "practices", "products"....
0.300
becomechangesdesigndesignersdriversengineeringphysicalplannersroadroadsrulesafetysignsstrategiestrafficurbanuses
SHARED TOKENS (17): "become", "changes", "design", "designers", "drivers", "engineering", "physical", "planners", "road", "roads", "rule", "safety", "signs", "strategies", "traffic", "urban", "uses".
0.300
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingbusinessescitiescommunitieseconomicgovernmentgrowthhousinginfrastructurelandprivateprocesspublicspacesurban
SHARED TOKENS (15): "addressing", "businesses", "cities", "communities", "economic", "government", "growth", "housing", "infrastructure", "land", "private", "process", "public", "spaces", "urban".
0.300
Vocational education ↗ KW CROSS HIGH
collegecommunitydesignedeconomiceducationformalfurthergeneralindividualknowledgelevelmethodsplaceschoolschoolsspecializedtechnologytraining
SHARED TOKENS (18): "college", "community", "designed", "economic", "education", "formal", "further", "general", "individual", "knowledge", "level", "methods", "place", "school", "schools", "specialized", "technology", "training".
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecitiescommunitiescompetitivecontinuecreatecreatescurrentdescribesdevelopeddevelopmenteconomiceducationequivalentgenerategeographygoalgrowth
SHARED TOKENS (55): "approximately", "architecture", "become", "cities", "communities", "competitive", "continue", "create", "creates", "current", "describes", "developed", "development", "economic", "education", "equivalent", "generate", "geography", "goal", "growth"....
0.300
automobilebecomecapacitydemanddepartmentsdriversincreasingmodeledplanningpublicresultingroadroadsroutetimestraffictransporttransportationurbanvehicles
SHARED TOKENS (20): "automobile", "become", "capacity", "demand", "departments", "drivers", "increasing", "modeled", "planning", "public", "resulting", "road", "roads", "route", "times", "traffic", "transport", "transportation", "urban", "vehicles".
0.300
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialcommerciallydedicateddistinctequipmenthomeindustrylargermakesplaceprocessproduceproductionscalesizeworkers
SHARED TOKENS (18): "built", "business", "commercial", "commercially", "dedicated", "distinct", "equipment", "home", "industry", "larger", "makes", "place", "process", "produce", "production", "scale", "size", "workers".
0.300
affectedannuallyapplicableapproximatelydirectlyeconomicestimatedevenexposurefoodmillionperiodpriorrequiringresponseresulting
SHARED TOKENS (16): "affected", "annually", "applicable", "approximately", "directly", "economic", "estimated", "even", "exposure", "food", "million", "period", "prior", "requiring", "response", "resulting".
0.300
advancedapplicationappliedcapacitychangesconditionsdifferentemergencyfieldincreaseinformationinfrastructurelimitmanagementmobilityroadroadssafetysignssystem
SHARED TOKENS (28): "advanced", "application", "applied", "capacity", "changes", "conditions", "different", "emergency", "field", "increase", "information", "infrastructure", "limit", "management", "mobility", "road", "roads", "safety", "signs", "system"....
0.300
accommodatecreatingdepartmentdesignateddesigneddifferentevenpathwaypermitprimaryrailroutesharedtransporttravelurban
SHARED TOKENS (16): "accommodate", "creating", "department", "designated", "designed", "different", "even", "pathway", "permit", "primary", "rail", "route", "shared", "transport", "travel", "urban".
0.300
appearscombinedcreateddesignatedevenfacilitiesgovernjurisdictionslargelowerotherwisepedestrianplaceroadroadsrulessafelysafetyschoolseparate
SHARED TOKENS (26): "appears", "combined", "created", "designated", "even", "facilities", "govern", "jurisdictions", "large", "lower", "otherwise", "pedestrian", "place", "road", "roads", "rules", "safely", "safety", "school", "separate"....
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicadvertisingaloneapplicationappliedassociatedbeyondcommunicationsconsolidationconsumercreatingcustomerdemanddesigndesignersdevelopmentdifferentdigitaldistinctestablished
SHARED TOKENS (41): "academic", "advertising", "alone", "application", "applied", "associated", "beyond", "communications", "consolidation", "consumer", "creating", "customer", "demand", "design", "designers", "development", "different", "digital", "distinct", "established"....
0.300
additionalcertaincomprehensivecontroldifferentestablishedfurthergovernmentjurisdictionslegallevellimitslocalmunicipalnationalnoiseplacepoliceprivatepublic
SHARED TOKENS (31): "additional", "certain", "comprehensive", "control", "different", "established", "further", "government", "jurisdictions", "legal", "level", "limits", "local", "municipal", "national", "noise", "place", "police", "private", "public"....
0.300
applicationsappliescontrolcorporatedesignersdifferentequipmenteventslightingoperatepeopleperformancepersonnelproductionshowstechnicianswork
SHARED TOKENS (17): "applications", "applies", "control", "corporate", "designers", "different", "equipment", "events", "lighting", "operate", "people", "performance", "personnel", "production", "shows", "technicians", "work".
0.300
ageallowingappliesapproximatelyauthorizationbeyondcertaingeneralincreaseslawlegalmedicalrequirerightsstatuteterritorythoughuntil
SHARED TOKENS (18): "age", "allowing", "applies", "approximately", "authorization", "beyond", "certain", "general", "increases", "law", "legal", "medical", "require", "rights", "statute", "territory", "though", "until".
0.300
approveddecemberdepartmenteducationemployeeenforcementequivalentestablishingexecutivefederalfinancialgovernmenthouseindependentinformationlegallevellocalmattersnational
SHARED TOKENS (27): "approved", "december", "department", "education", "employee", "enforcement", "equivalent", "establishing", "executive", "federal", "financial", "government", "house", "independent", "information", "legal", "level", "local", "matters", "national"....
0.300
buildingscomplexconnectedcontrolleddistinctiondistinguisheventeventsindustryintendedlargermakesmarketsmultiplepowerprocessingprofessionalpublicsinglesmall
SHARED TOKENS (28): "buildings", "complex", "connected", "controlled", "distinction", "distinguish", "event", "events", "industry", "intended", "larger", "makes", "markets", "multiple", "power", "processing", "professional", "public", "single", "small"....
0.300
Marquee ↗ Q1621931 KW CROSS HIGH
buildingchaincoveringhtmllargemakesnetworkpageregionalsignsinglesmallstructuretemporarytrain
SHARED TOKENS (15): "building", "chain", "covering", "html", "large", "makes", "network", "page", "regional", "sign", "single", "small", "structure", "temporary", "train".
0.300
advertisingautomobilebusinessbusinessescommercialconditionsgeneralinsuranceinsurersliabilitylinemarketmedicaloperationspoliciespolicyprofessionalpropertypublicrisks
SHARED TOKENS (22): "advertising", "automobile", "business", "businesses", "commercial", "conditions", "general", "insurance", "insurers", "liability", "line", "market", "medical", "operations", "policies", "policy", "professional", "property", "public", "risks"....
0.300
additionalapplicableapplyauthoritydemanddistrictgeneralgovernedidaholevellocalnationalproductsrequireresidentsretailrulessalessoldstatewide
SHARED TOKENS (25): "additional", "applicable", "apply", "authority", "demand", "district", "general", "governed", "idaho", "level", "local", "national", "products", "require", "residents", "retail", "rules", "sales", "sold", "statewide"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontroldecemberinformationlevellocalmovementsnationalneedpedestrianpoliceroadsystemsystemstechnologytraffic
SHARED TOKENS (18): "advanced", "capacity", "competing", "control", "december", "information", "level", "local", "movements", "national", "need", "pedestrian", "police", "road", "system", "systems", "technology", "traffic".
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
appliesassetsbusinesscodecommercialconsumercreatedistrictemploymententitiesestablishingfinancefinancialfinancingfoodformationframeworkfurthergeneralgovern
SHARED TOKENS (48): "applies", "assets", "business", "code", "commercial", "consumer", "create", "district", "employment", "entities", "establishing", "finance", "financial", "financing", "food", "formation", "framework", "further", "general", "govern"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
businesschaincommercialdataindustryinventorymanagementmarketingmobileplatformsprocessingproductsretailsegmentsupplysystemstransactiontransfer
SHARED TOKENS (18): "business", "chain", "commercial", "data", "industry", "inventory", "management", "marketing", "mobile", "platforms", "processing", "products", "retail", "segment", "supply", "systems", "transaction", "transfer".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
appliedapplyapprovedauthoritybecomesbuildingbuildingschargescodecodescompliancecontrolcouncildepartmentsdesigndesignersdistrictelectricalestatefacility
SHARED TOKENS (48): "applied", "apply", "approved", "authority", "becomes", "building", "buildings", "charges", "code", "codes", "compliance", "control", "council", "departments", "design", "designers", "district", "electrical", "estate", "facility"....
0.300
Train station ↗ Q55488 KW CROSS HIGH
accommodateboardbuildingconnectionsfacilitylevellineloadingplatformrailrailroadsalessignstationssystemstraintrainstransport
SHARED TOKENS (18): "accommodate", "board", "building", "connections", "facility", "level", "line", "loading", "platform", "rail", "railroad", "sales", "sign", "stations", "systems", "train", "trains", "transport".
0.300
accessibilityairassociatedbroaderbusinesscertaindependencedevelopmentdistrictsenvironmentfallsfrequentlyimpliesincreasesinvolvinglinkslocalmobilitynoisepedestrian
SHARED TOKENS (36): "accessibility", "air", "associated", "broader", "business", "certain", "dependence", "development", "districts", "environment", "falls", "frequently", "implies", "increases", "involving", "links", "local", "mobility", "noise", "pedestrian"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementbrandbrandedbusinesscapitalcertainchaincompeteconditionscorporatedirecteconomicexpansionexplicitlyfinancialfranchisegrowthindividualinvestmentlarge
SHARED TOKENS (39): "agreement", "brand", "branded", "business", "capital", "certain", "chain", "compete", "conditions", "corporate", "direct", "economic", "expansion", "explicitly", "financial", "franchise", "growth", "individual", "investment", "large"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionapplicationauthorizedbuildingsconnectdevelopmentevenexpandedfeefinalfullfunctionsgovernmentjurisdictionslandlaterlegalmunicipalitiesownersownership
SHARED TOKENS (35): "acquisition", "application", "authorized", "buildings", "connect", "development", "even", "expanded", "fee", "final", "full", "functions", "government", "jurisdictions", "land", "later", "legal", "municipalities", "owners", "ownership"....
0.300
Ridesharing company ↗ KW CROSS HIGH
cannotcommissioncontractorscustomerdemanddriversindependentinsuranceissuedjurisdictionlegallylicensinglocalmobilemodeloperateoperationspricingregulationsrequirements
SHARED TOKENS (27): "cannot", "commission", "contractors", "customer", "demand", "drivers", "independent", "insurance", "issued", "jurisdiction", "legally", "licensing", "local", "mobile", "model", "operate", "operations", "pricing", "regulations", "requirements"....
0.300
applicationsbuildingbuildingscommercialdistributionemergencyequipmenteventsfacilitiesincreasesinstitutionallargemeansmultiplenamepublicrequiresschoolschoolssmall
SHARED TOKENS (27): "applications", "building", "buildings", "commercial", "distribution", "emergency", "equipment", "events", "facilities", "increases", "institutional", "large", "means", "multiple", "name", "public", "requires", "school", "schools", "small"....
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdecemberdefinesdepartmentdesigndesigneddevelopeddocumentdriversfederalissuedlawlocal
SHARED TOKENS (36): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "december", "defines", "department", "design", "designed", "developed", "document", "drivers", "federal", "issued", "law", "local"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
buildingscannotcombinedconnectdesigndesigneddestinationevenfallsinfrastructureinsidelargemunicipalparkingparkspropertypublicreceiverequireresidential
SHARED TOKENS (26): "buildings", "cannot", "combined", "connect", "design", "designed", "destination", "even", "falls", "infrastructure", "inside", "large", "municipal", "parking", "parks", "property", "public", "receive", "require", "residential"....
0.300
businesscommunityentitiesfinancefurthergeneratelocalmissionnonprofitoperatedoperatesoperationsorganizationownersprivateprogrampublicratherreceiverevenue
SHARED TOKENS (23): "business", "community", "entities", "finance", "further", "generate", "local", "mission", "nonprofit", "operated", "operates", "operations", "organization", "owners", "private", "program", "public", "rather", "receive", "revenue"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdefinitionsdifferentequivalentformindividuallinelowermultipleoperateoperatesoperatingoperationsrailrailroadright-of-waystreetssystem
SHARED TOKENS (27): "broader", "capacity", "conditions", "definitions", "different", "equivalent", "form", "individual", "line", "lower", "multiple", "operate", "operates", "operating", "operations", "rail", "railroad", "right-of-way", "streets", "system"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
agriculturalassociatedchaindestinationdistributeddistributionequipmentfoodfunctioninglogisticsmanagementpreserveproduceproductionproductsqualityrequiressafetystoragesupply
SHARED TOKENS (22): "agricultural", "associated", "chain", "destination", "distributed", "distribution", "equipment", "food", "functioning", "logistics", "management", "preserve", "produce", "production", "products", "quality", "requires", "safety", "storage", "supply"....
0.300
Quinceañera ↗ EXACT TITLE
agedifferenteventfoodpractices
SHARED TOKENS (5): "age", "different", "event", "food", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.300
accordingageamongappliedappliesauthorizationbecomecertaincontextdifferentearlyeconomicemployersentryfallsformalfullfunctionsgeneralindividual
SHARED TOKENS (45): "according", "age", "among", "applied", "applies", "authorization", "become", "certain", "context", "different", "early", "economic", "employers", "entry", "falls", "formal", "full", "functions", "general", "individual"....
0.300
accesscommunitycompletedesigndesignedeconomichealthhomeoperatedplannedplannerspolicypractitionerspublicrequiressafesafetystreetstraffictransportation
SHARED TOKENS (23): "access", "community", "complete", "design", "designed", "economic", "health", "home", "operated", "planned", "planners", "policy", "practitioners", "public", "requires", "safe", "safety", "streets", "traffic", "transportation"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralchargescitiescommunitiesconnectingdieseldifferentdistrictseastinsidelinemetropolitanmultipleoperateoperatespricingrailregionalsystems
SHARED TOKENS (23): "business", "central", "charges", "cities", "communities", "connecting", "diesel", "different", "districts", "east", "inside", "line", "metropolitan", "multiple", "operate", "operates", "pricing", "rail", "regional", "systems"....
🫐 BERRY58 edges
0.280
Baker ↗ Q160131 EXACT TITLE
concentratedplaceproductssource
SHARED TOKENS (4): "concentrated", "place", "products", "source". | EXACT TITLE in wedding_events: "Baker".
0.280
accessconnectingdesignedjurisdictionslocalmajormoveresidentialroadroadsservesstreetstrafficwider
SHARED TOKENS (14): "access", "connecting", "designed", "jurisdictions", "local", "major", "move", "residential", "road", "roads", "serves", "streets", "traffic", "wider".
0.280
designengineeringfuturemaintenancematerialsoperationplanningprofessionalroadsstandardsstreetsstructuraltraffictransportation
SHARED TOKENS (14): "design", "engineering", "future", "maintenance", "materials", "operation", "planning", "professional", "roads", "standards", "streets", "structural", "traffic", "transportation".
0.280
Oversize load ↗ Q680421 KW CROSS HIGH
airequipmentinfrastructurelargelegallimitsordinaryroadsizespecifiedstandardtransporttransportationwater
SHARED TOKENS (14): "air", "equipment", "infrastructure", "large", "legal", "limits", "ordinary", "road", "size", "specified", "standard", "transport", "transportation", "water".
0.280
Wedding ↗ Q49836 EXACT TITLE
authorityincorporatedpeoplepublic
SHARED TOKENS (4): "authority", "incorporated", "people", "public". | EXACT TITLE in wedding_events: "Wedding".
0.280
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciesappliescommunityindustrylargelicensesproductionprofessionalprojectremainthemwhosework
SHARED TOKENS (14): "access", "agencies", "applies", "community", "industry", "large", "licenses", "production", "professional", "project", "remain", "them", "whose", "work".
0.270
currentexecutivegovernmentidahoofficeposition
SHARED TOKENS (6): "current", "executive", "government", "idaho", "office", "position". | URL->B (1): https://sos.idaho.gov/.
0.260
academiccollegecommunitydifferenteducationformpolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (13): "academic", "college", "community", "different", "education", "form", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.260
Calligraphy ↗ Q12681 KW CROSS HIGH
designdocumentseastformincorporatesindividuallevelmovingpracticesignsthoughvisualwestern
SHARED TOKENS (13): "design", "documents", "east", "form", "incorporates", "individual", "level", "moving", "practice", "signs", "though", "visual", "western".
0.260
conditionseducationemergencyenforcementengineeringenvironmentknowledgemethodspracticesresponsesafelysurroundingthem
SHARED TOKENS (13): "conditions", "education", "emergency", "enforcement", "engineering", "environment", "knowledge", "methods", "practices", "response", "safely", "surrounding", "them".
0.260
appliedcompletioneveneventfoodformlinenameratherreceivereceivingseparatewhose
SHARED TOKENS (13): "applied", "completion", "even", "event", "food", "form", "line", "name", "rather", "receive", "receiving", "separate", "whose".
0.260
lawprivatework
SHARED TOKENS (3): "law", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.260
Decoration ↗ Q1232942 EXACT TITLE
houseincreaseintended
SHARED TOKENS (3): "house", "increase", "intended". | EXACT TITLE in wedding_events: "Decoration".
0.240
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegardengovernmentidahometropolitanmunicipalnamepopulationsecondseparatestreet
SHARED TOKENS (12): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "population", "second", "separate", "street".
0.240
documentsestategovernmentmaintainsofficeownershippositionpropertypublicrealrecordsrights
SHARED TOKENS (12): "documents", "estate", "government", "maintains", "office", "ownership", "position", "property", "public", "real", "records", "rights".
0.240
boisebuildingbuiltfeetidaholevelnationalopenedpacificrailroadtrainunion
SHARED TOKENS (12): "boise", "building", "built", "feet", "idaho", "level", "national", "opened", "pacific", "railroad", "train", "union".
0.240
Crowd control ↗ Q1872073 KW CROSS HIGH
controleventsinvolvinglargemanagedmanagementpeoplepolicepracticepublicsecuritystreet
SHARED TOKENS (12): "control", "events", "involving", "large", "managed", "management", "people", "police", "practice", "public", "security", "street".
0.240
businessdefinesdefinitionsenvironmentgovernmenthomelimitedorganizationpeopleprimarytourismtravel
SHARED TOKENS (12): "business", "defines", "definitions", "environment", "government", "home", "limited", "organization", "people", "primary", "tourism", "travel".
0.220
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesigneddestinationlargepeoplerouteroutesstudentstransporttraveluniversity
SHARED TOKENS (11): "applications", "designed", "destination", "large", "people", "route", "routes", "students", "transport", "travel", "university".
0.220
agreementcertainintendedlicensedlicensinglimitedownersrightsseparateuseswork
SHARED TOKENS (11): "agreement", "certain", "intended", "licensed", "licensing", "limited", "owners", "rights", "separate", "uses", "work".
0.220
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargelargermakesplaceproducesproductionpropertywarehouses
SHARED TOKENS (11): "building", "business", "equipment", "large", "larger", "makes", "place", "produces", "production", "property", "warehouses".
0.220
mobileperformance
SHARED TOKENS (2): "mobile", "performance". | EXACT TITLE in wedding_events: "Dance floor".
0.220
consumerscustomercustomersdedicatedformproductsprofessionalpurchasingreviewreviewssites
SHARED TOKENS (11): "consumers", "customer", "customers", "dedicated", "form", "products", "professional", "purchasing", "review", "reviews", "sites".
0.220
Photo booth ↗ Q494312 EXACT TITLE
containsdigital
SHARED TOKENS (2): "contains", "digital". | EXACT TITLE in wedding_events: "Photo booth".
0.220
Review site ↗ Q1340449 KW CROSS HIGH
businessescomearlylaterpeopleproductsprofessionalreviewreviewssitesites
SHARED TOKENS (11): "businesses", "com", "early", "later", "people", "products", "professional", "review", "reviews", "site", "sites".
0.220
Fairground ↗ Q5430425 EXACT TITLE
permanentspace
SHARED TOKENS (2): "permanent", "space". | EXACT TITLE in wedding_events: "Fairground".
0.220
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentrylineresearchrestrictedroadsafetyshowstrafficvehicles
SHARED TOKENS (11): "businesses", "economic", "entry", "line", "research", "restricted", "road", "safety", "shows", "traffic", "vehicles".
0.200
Mobile catering ↗ KW CROSS HIGH
businesscorporateemergencyeventsfoodmobilepeopleretailtimesurban
SHARED TOKENS (10): "business", "corporate", "emergency", "events", "food", "mobile", "people", "retail", "times", "urban".
0.200
aircommercialenvironmentlandlogisticsphysicalprocessproductsshippingtransport
SHARED TOKENS (10): "air", "commercial", "environment", "land", "logistics", "physical", "process", "products", "shipping", "transport".
0.200
categoryestateeventfoodindustryparksplanningrealtourismtravel
SHARED TOKENS (10): "category", "estate", "event", "food", "industry", "parks", "planning", "real", "tourism", "travel".
0.200
costshandlingitselfmultiplerailreducedroadsecuritytransporttransportation
SHARED TOKENS (10): "costs", "handling", "itself", "multiple", "rail", "reduced", "road", "security", "transport", "transportation".
0.200
canyonconnectingeagleeastidahomarsingmeridiannamparivervalley
SHARED TOKENS (10): "canyon", "connecting", "eagle", "east", "idaho", "marsing", "meridian", "nampa", "river", "valley".
0.180
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
eastidahointerstatelimitedpriorroutesystemwestwestern
SHARED TOKENS (9): "east", "idaho", "interstate", "limited", "prior", "route", "system", "west", "western".
0.180
laworganizationpaymentperformanceplacepublicpubliclyrightsthough
SHARED TOKENS (9): "law", "organization", "payment", "performance", "place", "public", "publicly", "rights", "though".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationruralwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.160
Wedding cake ↗ Q558133 KW CROSS HIGH
builtcostevenpartsrealservedsinglewestern
SHARED TOKENS (8): "built", "cost", "even", "parts", "real", "served", "single", "western".
0.160
applicableauthorizesdistrictlandordinancepermituseszoning
SHARED TOKENS (8): "applicable", "authorizes", "district", "land", "ordinance", "permit", "uses", "zoning".
0.160
commerciallargelicensematerialsoperatepartssizevehicles
SHARED TOKENS (8): "commercial", "large", "license", "materials", "operate", "parts", "size", "vehicles".
0.160
citiescountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "cities", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
appliedarchitecturebuildingsperiodratherrelationshipsecond
SHARED TOKENS (7): "applied", "architecture", "buildings", "period", "rather", "relationship", "second".
0.140
agriculturalcitieseastidaholandmajorriver
SHARED TOKENS (7): "agricultural", "cities", "east", "idaho", "land", "major", "river".
0.120
Agritourism ↗ Q1956672 KW CROSS HIGH
activityagriculturefarminvolvingoperationtourism
SHARED TOKENS (6): "activity", "agriculture", "farm", "involving", "operation", "tourism".
0.120
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainjuneownedpipelineserving
SHARED TOKENS (6): "business", "chain", "june", "owned", "pipeline", "serving".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
governmentissuedlawlocalmunicipalityordinance
SHARED TOKENS (6): "government", "issued", "law", "local", "municipality", "ordinance".
0.120
analysisdetermineestablishknowledgerequiresecond
SHARED TOKENS (6): "analysis", "determine", "establish", "knowledge", "require", "second".
0.120
additionalbrandchaindevelopmentjunepipeline
SHARED TOKENS (6): "additional", "brand", "chain", "development", "june", "pipeline".
0.120
operatesplanningplatformsportfolioresourcestechnology
SHARED TOKENS (6): "operates", "planning", "platforms", "portfolio", "resources", "technology".
0.120
Hairstyle ↗ Q327496 KW CROSS HIGH
frequentlyhomeinfluencemethodsshapethough
SHARED TOKENS (6): "frequently", "home", "influence", "methods", "shape", "though".
0.120
gardenidahointerstateroutetreasurevalley
SHARED TOKENS (6): "garden", "idaho", "interstate", "route", "treasure", "valley".
0.120
differentdocumenteventslaterofficialthroughout
SHARED TOKENS (6): "different", "document", "events", "later", "official", "throughout".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
adaconnectingcountiesidahoroute
SHARED TOKENS (5): "ada", "connecting", "counties", "idaho", "route".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
boiseidahomarsingmetropolitanpopulation
SHARED TOKENS (5): "boise", "idaho", "marsing", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
0.100
Equestrianism ↗ KW CROSS HIGH
competitivedescriptiontransportationwelfarework
SHARED TOKENS (5): "competitive", "description", "transportation", "welfare", "work".
◈ Frequently Asked Questions
Transportation Infrastructure × Wedding Events — Treasure Valley
HAIKU · HIGH GATE
How does Interstate 84 in Idaho affect guest arrival times for weddings held in downtown Boise versus Nampa venues?
Interstate 84 in Idaho runs east-west through the Treasure Valley metropolitan area, making travel times from Boise to Nampa approximately 30-40 minutes depending on traffic patterns and right of way conditions. Wedding planners in both cities must account for I-84 congestion during peak hours when coordinating guest arrival windows and ceremony start times.
What role does the Union Pacific Railroad's right of way play in zoning decisions for wedding facilities near Boise Airport?
The Union Pacific Railroad maintains active right of way corridors through Ada County that intersect with zoning designations around Boise Airport and adjacent warehouse districts. Wedding venue developers and land-use planning departments in Boise must coordinate with Union Pacific regarding easement restrictions and noise considerations before licensing new event facilities in these zones.
How do Boise State University and College of Western Idaho coordinate transportation logistics for large wedding events held on their campuses?
Both Boise State University and College of Western Idaho manage campus transportation through parking permits, shuttle services, and coordination with local Boise and Nampa public transit systems when hosting wedding events. Each institution's logistics office works with Treasure Valley metropolitan planning to ensure adequate right of way access and temporary traffic management during peak guest arrival periods.
What zoning and land-use planning permits are required when a wedding warehouse venue in Nampa requires access improvements via state or local roads?
Wedding facilities converting warehouse space in Nampa must obtain conditional use permits through Ada County zoning boards and coordinate with the Idaho State Police regarding traffic safety along access routes. Land-use planning departments require traffic impact studies when new event venues trigger modifications to right of way or parking infrastructure on public roads serving the facility.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Wedding Events 21 QID bridges 300 edges 7,781 ext links 2026-07-17 23:44:25 UTC d2e77d7a6eaf8363
Transportation Infrastructure corridor ↗ Wedding Events corridor ↗ Wedding Events × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals