—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Beauty Salon

14 Wikipedia bridge articles confirmed in both vertical ledgers. 235 deterministic cross-vertical edges. 6,706 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
235 Cross Edges
6,706 External Sources
278 Wikipedia Articles
18 🌲 Evergreen
160 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Beauty Salon
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
235
External Sources Harvested
6,706
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (14)
IdahoZoningApprenticeshipBoise, IdahoTreasure ValleyAmericans with Disabilities Act of 1990Nampa, IdahoAda County, IdahoCaldwell, IdahoGarden City, IdahoMeridian, IdahoKuna, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitancapitalsecondwestwesternlocalhomeapproximatelynationalseparatetechnologyuseszonesectorsdowntownlocallytreasure
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:39:11 UTC
Content Hash
f4041eb5215c8bee
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:evergreen). | SHARED TOKENS (25): "approximately", "associated", "boise", "capital", "distinct", "economy", "idaho", "linked", "national", "official", "population", "prior", "products", "sector", "separate", "significant", "small", "south", "supplies", "technology".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in beauty_salon: "Idaho".
approximatelyassociatedboisecapitaldistincteconomyidaholinkednationalofficialpopulationpriorproductssectorseparatesignificantsmallsouthsuppliestechnologytourismuseswestwesternzone
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:evergreen). | SHARED TOKENS (28): "allowing", "building", "compatible", "developed", "development", "different", "form", "govern", "growth", "land-use", "local", "permission", "places", "planning", "policy", "property", "regulations", "regulatory", "residential", "rules".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in beauty_salon: "Zoning".
allowingbuildingcompatibledevelopeddevelopmentdifferentformgoverngrowthland-uselocalpermissionplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesystemsurbanuseszonezoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:evergreen). | SHARED TOKENS (17): "apprenticeship", "boundaries", "certification", "employer", "formal", "labor", "license", "permanent", "potential", "practice", "practitioners", "professional", "regulated", "sectors", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship". | EXACT TITLE in beauty_salon: "Apprenticeship".
apprenticeshipboundariescertificationemployerformallaborlicensepermanentpotentialpracticepractitionersprofessionalregulatedsectorsstudysystemtraining
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and beauty_salon (tier:evergreen). | SHARED TOKENS (15): "annual", "boise", "capital", "downtown", "feet", "home", "idaho", "locally", "major", "metropolitan", "population", "sectors", "technology", "treasure", "valley". | EXACT TITLE in beauty_salon: "Boise, Idaho".
annualboisecapitaldowntownfeethomeidaholocallymajormetropolitanpopulationsectorstechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "historically", "idaho", "local", "metropolitan", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in beauty_salon: "Treasure Valley".
associationboisehistoricallyidaholocalmetropolitanregionresourcestreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:branch). | SHARED TOKENS (17): "accessibility", "act", "against", "business", "changes", "costs", "council", "disability", "later", "law", "national", "prohibits", "provide", "public", "recommended", "requirements", "requires".
accessibilityactagainstbusinesschangescostscouncildisabilitylaterlawnationalprohibitsprovidepublicrecommendedrequirementsrequires
ual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Under Title III, no individual may be discriminated against on the basis of disability with regards to the full and equal enjoyment of the goods, services, facilities, or accommodations of any place of public accommodation by any person who owns, leases, or operates a place of public accommodation. Public accommodations include most places of lodging (such as inns and hotels), recreation, transportation, education, and dining, along with stores, care providers, and places of public displays. Under Title III of the ADA, all new construction (construction, modification or alterations) after the effective date of the ADA (approximately July 1992) must be fully compliant with the Americans With Disabilities Act Accessibility Guidelines (ADAAG) found in the Code of Federal Regulations at 28 C.F.R., Part 36, Appendix A. Title III also has applications to existing facilities. One of the definitions of "discrimination" under Title III of the ADA is a "failure to remove" architectural barriers in existing facilities. See 42 U.S.C. § 12182(b)(2)(A)(iv). This means that even facilities that have not been modified or altered in any way after the ADA was passed still have obligations. The standard is whether "removing barriers" (typically defined as bringing a condition into compliance with the ADAAG) is "readily achievable", defined as "...easily accomplished without much difficulty or expense". The statutory definition of "readily achievable" calls for a balancing test between the cost of the proposed alteration and the wherewithal of the business and/or owners of the business. Thus, what might be "readily achievable" for a sophisticated and financially capable corporation might not be readily achievable for a small or local business. There are exceptions to this title; many private clubs and religious organizations may not be bound by Title III. With regard to historic properties (those properties that are listed or that are eligible for listing in the National Register of Historic Places, or properties designated as historic under state or local law), those facilities must still comply with the provisions of Title III of the ADA to the "maximum extent feasible" but if following the usual standards would "threaten to destroy the historic significance of a feature of the building" then alternative standards may be used. Under 2010 revisions of Department of Justice regulations, newly constructed or altered swimming pools, wading pools, and spas must have an accessible means of entrance and exit to pools for disabled people. However, the requirement is conditioned on whether providing access through a fixed lift is "readily achievable". Other requirements exist, based on pool size, include providing a certain number of accessible means of entry and exit, which are outlined in Section 242 of the standards. However, businesses are free to consider the differences in the application of the rules depending on whether the pool is new or altered, or whether the swimming pool was in existence before the effective date of the new rule.
ADA Amendments Act, 2008 The ADA defines a covered disability as a physical or mental impairment that substantially limits one or more major life activities, a history of having such an impairment, or being regarded as having such an impairment. The Equal Employment Opportunity Commission (EEOC) was charged with interpreting the 1990 law with regard to discrimination in employment. The EEOC developed regulations limiting an individual's impairment to one that "severely or significantly restricts" a major life activity. The ADAAA directed the EEOC to amend its regulations and replace "severely or significantly" with "substantially limits", a more lenient standard. On September 25, 2008, President George W. Bush signed the ADA Amendments Act of 2008 (ADAAA) into law. The amendment broadened the definition of "disability", thereby extending the ADA's protections to a greater number of people. The ADAAA also added to the ADA examples of "major life activities" including, but not limited to, "caring for oneself, performing manual tasks, seeing, hearing, eating, sleeping, walking, standing, lifting, bending, speaking, breathing, learning, reading, concentrating, thinking, communicating, and working" as well as the operation of several specified "major bodily functions". The act overturned a 1999 US Supreme Court case that held that an employee was not disabled if the impairment could be corrected by mitigating measures; it specifically provides that such impairment must be determined without considering such ameliorative measures. It also overturned the court's finding that an impairment that substantially limits one major life activity must also limit others to be considered a disability. In 2008, the United States House Committee on Education and Labor stated that the amendment "makes it absolutely clear that the ADA is intended to provide broad coverage to protect anyone who faces discrimination on the basis of disability." Thus the ADAAA led to broader coverage of impaired employees. Web Content Accessibility Guidelines, 2019 In October 2019, the Supreme Court declined to resolve a circuit split as to whether websites are covered by the ADA. The Court turned down an appeal from Domino's Pizza and let stand a U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (14): "according", "boise", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "second", "student", "west", "western".
accordingboisecollegehomeidahomeaningmeridianmetropolitannampapopulationsecondstudentwestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:branch). | SHARED TOKENS (11): "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "second".
boisecapitaldistricthomeidahojurisdictionlocalmetropolitanpopulationprivatesecond
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Garden City, Idaho
QID OVERLAP 0.660
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and beauty_salon (tier:evergreen). | SHARED TOKENS (8): "boise", "garden", "idaho", "metropolitan", "municipal", "population", "second", "separate".
boisegardenidahometropolitanmunicipalpopulationsecondseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
s only main street, Chinden Boulevard, is a portmanteau of the words "China" and "garden." In the second decade of the 21st century, it became a haven for artists' studios. Garden City is part of the Boise metropolitan area. Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (8): "among", "boise", "capital", "idaho", "making", "meridian", "population", "second".
amongboisecapitalidahomakingmeridianpopulationsecond
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (7): "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
additionalboiseidahokunametropolitanpercentpopulation
metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020. History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and beauty_salon (tier:branch). | SHARED TOKENS (5): "boise", "downtown", "eagle", "idaho", "population".
boisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
221 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP221 edges
🌲 EVERGREEN4 edges
0.650
applicationapplicationscarefeetidentifyingitselflicensedlistproductsprofessionalshapespecifictechniciantrainingtreatmentwhosework
SHARED TOKENS (17): "application", "applications", "care", "feet", "identifying", "itself", "licensed", "list", "products", "professional", "shape", "specific", "technician", "training", "treatment", "whose", "work". | URL->B (1): https://www.cdc.gov/niosh/nail-technicians/about/index.html. | EXACT TITLE in beauty_salon: "Nail technician".
0.650
acquisitionagencyboardcommissionconstructioneconomicfederalindependentindustryjurisdictionpipelinespowersregulationregulatoryrelevantsubjecttraffictransportation
SHARED TOKENS (18): "acquisition", "agency", "board", "commission", "construction", "economic", "federal", "independent", "industry", "jurisdiction", "pipelines", "powers", "regulation", "regulatory", "relevant", "subject", "traffic", "transportation". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationcommercialcostsfederalgeneralpercentplanningprogrampublicrevenuesafetysignagestationstax
SHARED TOKENS (15): "acquisition", "administration", "commercial", "costs", "federal", "general", "percent", "planning", "program", "public", "revenue", "safety", "signage", "stations", "tax". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
additionalamonganotherauthorityboisecapacitycapitalconventionalcostcostsdemanddestinationdistricteagleemployerfederalfirmsformgardenhome
SHARED TOKENS (62): "additional", "among", "another", "authority", "boise", "capacity", "capital", "conventional", "cost", "costs", "demand", "destination", "district", "eagle", "employer", "federal", "firms", "form", "garden", "home".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH160 edges
0.570
agencybegancreatingdepartmentenforcementidaholawmunicipalpresentpublicstatewide
SHARED TOKENS (11): "agency", "began", "creating", "department", "enforcement", "idaho", "law", "municipal", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
associatedbuildingconstructiondesigndevelopmenteconomiceventualfacilitiesindustryinfrastructuremaintenancepercentplanningprocessproductswork
SHARED TOKENS (16): "associated", "building", "construction", "design", "development", "economic", "eventual", "facilities", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in beauty_salon: "Construction".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscontactcreatecreatingdevelopeddirectelectricalexposureforminsidelatermaterialmeansoperatespracticeprocessingrealstudentsuses
SHARED TOKENS (21): "application", "business", "contact", "create", "creating", "developed", "direct", "electrical", "exposure", "form", "inside", "later", "material", "means", "operates", "practice", "processing", "real", "students", "uses".... | EXACT TITLE in beauty_salon: "Photography".
0.500
accordingactivityadditionalaestheticsapproximatelycenterscollectioncommercialconsumptioncontrolleddevelopeddifferenteconomicembeddedexistinghealthinvolvingitselflargemanagement
SHARED TOKENS (39): "according", "activity", "additional", "aesthetics", "approximately", "centers", "collection", "commercial", "consumption", "controlled", "developed", "different", "economic", "embedded", "existing", "health", "involving", "itself", "large", "management".... | EXACT TITLE in transportation_infrastructure: "Waste management".
0.500
aloneavoidbeyondbuildingcodecodesconditionsconsumptioncontroldemanddependdescribeddesigndirectdirectlyexposurehazardhealthimpactimpacts
SHARED TOKENS (39): "alone", "avoid", "beyond", "building", "code", "codes", "conditions", "consumption", "control", "demand", "depend", "described", "design", "direct", "directly", "exposure", "hazard", "health", "impact", "impacts".... | EXACT TITLE in beauty_salon: "Ventilation (architecture)".
0.500
applicablebuildingcenterscommercialconsumersdedicateddeliverydemanddirectlyfacilityfirmshandlinginventorylaborlargelogisticsmarketnetworkoperateoperates
SHARED TOKENS (34): "applicable", "building", "centers", "commercial", "consumers", "dedicated", "delivery", "demand", "directly", "facility", "firms", "handling", "inventory", "labor", "large", "logistics", "market", "network", "operate", "operates".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
awaybusinessescenterscentralchangesdevelopmenteconomicexpansiongrowthmodelmovementoutwardpatternsplannedpopulationprocessresidentssouthurbanzone
SHARED TOKENS (20): "away", "businesses", "centers", "central", "changes", "development", "economic", "expansion", "growth", "model", "movement", "outward", "patterns", "planned", "population", "process", "residents", "south", "urban", "zone". | EXACT TITLE in beauty_salon: "Suburbanization".
0.500
ageassociatedcannotcarecommunityconditionsdisabilityfacilitieshomelong-termmedicalmeetmultipleneedneedspractitionersprovideprovidingqualityrequires
SHARED TOKENS (22): "age", "associated", "cannot", "care", "community", "conditions", "disability", "facilities", "home", "long-term", "medical", "meet", "multiple", "need", "needs", "practitioners", "provide", "providing", "quality", "requires".... | EXACT TITLE in beauty_salon: "Long-term care".
0.500
accessactcontinuingexistingfederalfuturegovernedlawlocalmetropolitanparticipationplanningplanspopulationprocessprogramspublicregionalstatewidetransportation
SHARED TOKENS (20): "access", "act", "continuing", "existing", "federal", "future", "governed", "law", "local", "metropolitan", "participation", "planning", "plans", "population", "process", "programs", "public", "regional", "statewide", "transportation". | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Laundry ↗ Q852100 EXACT TITLE
beganbuildingbusinesscarecommercialdifferentfacilityhistoryhomeindividualitselflaterneedresponsibilitysharedstudentwork
SHARED TOKENS (17): "began", "building", "business", "care", "commercial", "different", "facility", "history", "home", "individual", "itself", "later", "need", "responsibility", "shared", "student", "work". | EXACT TITLE in beauty_salon: "Laundry".
0.500
Fashion ↗ Q12684 EXACT TITLE
aestheticsallowingalongsideamongannualbrandingcentersconsumersdescribesdifferentdistrictgeneralimpactindustryinfluenceissuemajormeansmetropolitanpatterns
SHARED TOKENS (25): "aesthetics", "allowing", "alongside", "among", "annual", "branding", "centers", "consumers", "describes", "different", "district", "general", "impact", "industry", "influence", "issue", "major", "means", "metropolitan", "patterns".... | EXACT TITLE in beauty_salon: "Fashion".
0.500
broadercoveringdevelopmenteconomicgrowthindividualinfrastructureland-uselargermanagementnationalneedsnetworkplanningplanspracticesregionregionalrequirerequires
SHARED TOKENS (30): "broader", "covering", "development", "economic", "growth", "individual", "infrastructure", "land-use", "larger", "management", "national", "needs", "network", "planning", "plans", "practices", "region", "regional", "require", "requires".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
Employment ↗ EXACT TITLE
annualconditionsdisabilityemployeeemployeremploymententityhealthinsuranceoptionspaymentpowersectorsectorswork
SHARED TOKENS (15): "annual", "conditions", "disability", "employee", "employer", "employment", "entity", "health", "insurance", "options", "payment", "power", "sector", "sectors", "work". | EXACT TITLE in transportation_infrastructure: "Employment". | EXACT TITLE in beauty_salon: "Employment".
0.500
accesscommunityconditionsdevelopmentdifferentdistincteconomiceconomyelectricalenforcementespeciallyfacilitiesfirmsgeneralhealthindustryinfrastructureinstitutionslawmanagement
SHARED TOKENS (33): "access", "community", "conditions", "development", "different", "distinct", "economic", "economy", "electrical", "enforcement", "especially", "facilities", "firms", "general", "health", "industry", "infrastructure", "institutions", "law", "management".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in beauty_salon: "Infrastructure".
0.500
Skin care ↗ Q1294114 EXACT TITLE
accordingagecareclinicalconditionsexposurehealthinclusionindividualmaintainingmanagementneedspracticepracticesprocessproductsregulatedsupport
SHARED TOKENS (18): "according", "age", "care", "clinical", "conditions", "exposure", "health", "inclusion", "individual", "maintaining", "management", "needs", "practice", "practices", "process", "products", "regulated", "support". | EXACT TITLE in beauty_salon: "Skin care".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomicgrowthimpactslimitedlocalmarketsorganizationsplacespotentialpracticesprogramsprovidingreal
SHARED TOKENS (27): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "growth", "impacts", "limited", "local", "markets", "organizations", "places", "potential", "practices", "programs", "providing", "real".... | EXACT TITLE in transportation_infrastructure: "Tourism". | EXACT TITLE in beauty_salon: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredannualapproximatelybusinessbusinessescomdecemberdirectoryestimatesexcludingformerfoundedinformationlatermobileoperatespracticepracticespublicpublishes
SHARED TOKENS (30): "acquired", "annual", "approximately", "business", "businesses", "com", "december", "directory", "estimates", "excluding", "former", "founded", "information", "later", "mobile", "operates", "practice", "practices", "public", "publishes".... | EXACT TITLE in beauty_salon: "Yelp".
0.500
alongsidechoicesconcentratedconsumptiondevelopeddevelopmentdirectestimatesgrowthimpactindividuallimitedmedicalpolicypopulationpotentialprocessresourcessignificantstandard
SHARED TOKENS (22): "alongside", "choices", "concentrated", "consumption", "developed", "development", "direct", "estimates", "growth", "impact", "individual", "limited", "medical", "policy", "population", "potential", "process", "resources", "significant", "standard".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in beauty_salon: "Population growth".
0.500
collegecommunityeconomiceducationformalfurthergeneralindividualknowledgeoccupationsprovideschoolschoolssectorsskillsspecializedspecifictechnicaltechnologytraining
SHARED TOKENS (20): "college", "community", "economic", "education", "formal", "further", "general", "individual", "knowledge", "occupations", "provide", "school", "schools", "sectors", "skills", "specialized", "specific", "technical", "technology", "training". | EXACT TITLE in beauty_salon: "Vocational education".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
bodybuildingcleanconcentratedcontactdifferentespeciallyformhistoricallymedicalphysicalprocessreducesectorsimultaneouslytreatmentwastework
SHARED TOKENS (18): "body", "building", "clean", "concentrated", "contact", "different", "especially", "form", "historically", "medical", "physical", "process", "reduce", "sector", "simultaneously", "treatment", "waste", "work". | EXACT TITLE in beauty_salon: "Disinfectant".
0.500
approximatelycommunitiescompetitivecreatecreatescurrentdescribesdevelopeddevelopmenteconomiceconomicseducationgrowthhealthimpactinstitutionallargerlinkedmajormerely
SHARED TOKENS (41): "approximately", "communities", "competitive", "create", "creates", "current", "describes", "developed", "development", "economic", "economics", "education", "growth", "health", "impact", "institutional", "larger", "linked", "major", "merely".... | EXACT TITLE in beauty_salon: "Urbanization".
0.500
accessaddressingalreadyamongbusinessescapacitychangescommunitydevelopmenteconomiceducationequityformformalfoundedhistoricallyhistoryhomeindustryneed
SHARED TOKENS (45): "access", "addressing", "already", "among", "businesses", "capacity", "changes", "community", "development", "economic", "education", "equity", "form", "formal", "founded", "historically", "history", "home", "industry", "need".... | EXACT TITLE in transportation_infrastructure: "Workforce development".
0.500
accordingcommunitydescribesdevelopmenteconomiceconomicsespeciallygrowthhistoricallyindividualinfrastructurelocalmarketpolicyprocessqualityregionwest
SHARED TOKENS (18): "according", "community", "describes", "development", "economic", "economics", "especially", "growth", "historically", "individual", "infrastructure", "local", "market", "policy", "process", "quality", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
chainchainsconsumerconsumersconvertcreatingcustomersdirectdirectlyfacilitiesindependentlinkedlogisticsmanagementmaterialsnetworkproductproductsstructuresupply
SHARED TOKENS (22): "chain", "chains", "consumer", "consumers", "convert", "creating", "customers", "direct", "directly", "facilities", "independent", "linked", "logistics", "management", "materials", "network", "product", "products", "structure", "supply".... | EXACT TITLE in transportation_infrastructure: "Supply chain". | EXACT TITLE in beauty_salon: "Supply chain".
0.500
administrationagencyauthoritycertificationcommercialcontroldepartmentfederalpowersregulatesspacestandardstraffictransportationvehicles
SHARED TOKENS (15): "administration", "agency", "authority", "certification", "commercial", "control", "department", "federal", "powers", "regulates", "space", "standards", "traffic", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
acquiredadditionalbrandextendsformhistoryindependentlatermajornetworkoperatesoperatingregionalstarthroughout
SHARED TOKENS (15): "acquired", "additional", "brand", "extends", "form", "history", "independent", "later", "major", "network", "operates", "operating", "regional", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
accessibilityagencyavoidbusinessesconditionscurrentdatadepartmenteconomiceconomicsfederallaborlocalmajormanagementneedpublicqualityresearchresource
SHARED TOKENS (24): "accessibility", "agency", "avoid", "businesses", "conditions", "current", "data", "department", "economic", "economics", "federal", "labor", "local", "major", "management", "need", "public", "quality", "research", "resource".... | EXACT TITLE in beauty_salon: "Bureau of Labor Statistics".
0.500
administrationagencyapproximatelyauthorityconnectingdatadepartmentenforcementfacilitiesfederalidentificationlawlocaloperatedpartnerspipelinesprimaryproceduresregulationsregulatory
SHARED TOKENS (27): "administration", "agency", "approximately", "authority", "connecting", "data", "department", "enforcement", "facilities", "federal", "identification", "law", "local", "operated", "partners", "pipelines", "primary", "procedures", "regulations", "regulatory".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincollectionconsumptioncostscustomersdedicatedfacilityinformationlogisticsmaintainingmanagementmaterialmaterialsmodelmovementneedsoperationalphysical
SHARED TOKENS (31): "according", "another", "chain", "collection", "consumption", "costs", "customers", "dedicated", "facility", "information", "logistics", "maintaining", "management", "material", "materials", "model", "movement", "needs", "operational", "physical".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in beauty_salon: "Logistics".
0.500
administrationagencyassistancedepartmentdistrictexistingfederalfinancialfunctionslocaloperateoperatorsprogramsprovidersprovidingpublicregionalrequirementsstatutorysystems
SHARED TOKENS (23): "administration", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "local", "operate", "operators", "programs", "providers", "providing", "public", "regional", "requirements", "statutory", "systems".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
bodybroadercapitalcategorycommunityconstructiondirectlyeconomicelectricalemploymentfacilitieshealthinfrastructurelong-termmunicipaloperatorphysicalpipelinesprivatepublic
SHARED TOKENS (27): "body", "broader", "capital", "category", "community", "construction", "directly", "economic", "electrical", "employment", "facilities", "health", "infrastructure", "long-term", "municipal", "operator", "physical", "pipelines", "private", "public".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
againstapprovedarrangementsassociationboardbodiesbodycertificationcouncildemonstrateformalindependentinspectionnationalprimaryprovidequalityregionregionalrelevant
SHARED TOKENS (25): "against", "approved", "arrangements", "association", "board", "bodies", "body", "certification", "council", "demonstrate", "formal", "independent", "inspection", "national", "primary", "provide", "quality", "region", "regional", "relevant".... | EXACT TITLE in beauty_salon: "Accreditation".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestategenerallawlegalmeansownedownershipprivatepropertypublicrealresidentialresourcesvehicles
SHARED TOKENS (19): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "law", "legal", "means", "owned", "ownership", "private", "property", "public", "real", "residential", "resources", "vehicles". | EXACT TITLE in transportation_infrastructure: "Real estate". | EXACT TITLE in beauty_salon: "Real estate".
0.500
authoritybuildingbusinesscapitalcenterscommercialcontainingestatefunctionsinvestmentlocalmedicalmultiplepropertyrealregulationsresidentialretailsignificantspace
SHARED TOKENS (23): "authority", "building", "business", "capital", "centers", "commercial", "containing", "estate", "functions", "investment", "local", "medical", "multiple", "property", "real", "regulations", "residential", "retail", "significant", "space".... | EXACT TITLE in beauty_salon: "Commercial property".
0.500
accessallowingarrangementsassociationcompetitivecostsdevelopmenteconomicestatefinancialgeneralhistoricalindustryinfrastructureintegratedinvestmentlocalmodelmunicipalnetwork
SHARED TOKENS (43): "access", "allowing", "arrangements", "association", "competitive", "costs", "development", "economic", "estate", "financial", "general", "historical", "industry", "infrastructure", "integrated", "investment", "local", "model", "municipal", "network".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
constructioncontroldescribedfunctionsinformationinvolvinglaborlargemobileoperationsotherwisepowerprimarysourcestructuresystemsusesvehicles
SHARED TOKENS (18): "construction", "control", "described", "functions", "information", "involving", "labor", "large", "mobile", "operations", "otherwise", "power", "primary", "source", "structure", "systems", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
approveddepartmentfacilitiesfederalidentifiedindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningsafetyservingstationssystemtransportation
SHARED TOKENS (19): "approved", "department", "facilities", "federal", "identified", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "stations", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
businessbusinessescapacitycommercialcustomerhomeoperateoperatedoperatesparkingregulationsresidentialsecondsmalltaxworkzoning
SHARED TOKENS (17): "business", "businesses", "capacity", "commercial", "customer", "home", "operate", "operated", "operates", "parking", "regulations", "residential", "second", "small", "tax", "work", "zoning". | EXACT TITLE in beauty_salon: "Home business".
0.500
accordingauthoritybeganboundariesconcentratedconsolidateddifferentdistrictexistingformformerfurtherindependentlawlegallylocallocallymultipleplacespopulation
SHARED TOKENS (26): "according", "authority", "began", "boundaries", "concentrated", "consolidated", "different", "district", "existing", "form", "former", "further", "independent", "law", "legally", "local", "locally", "multiple", "places", "population".... | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariesconstructiondeterminingdevelopmentengineeringestablishhistorylawlegalmapsownershipplanningprofessionalpropertyresearchsalesstationstransportationwork
SHARED TOKENS (20): "analysis", "boundaries", "construction", "determining", "development", "engineering", "establish", "history", "law", "legal", "maps", "ownership", "planning", "professional", "property", "research", "sales", "stations", "transportation", "work". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
activityamongboisebusinesscollegedivisioneconomicseducationengineeringfoundedhealthidahoindependentprogramprogramspublicreportedresearchschoolwest
SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "division", "economics", "education", "engineering", "founded", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University".
0.500
Retail ↗ Q126793 EXACT TITLE
accessadvisoryaffectingagealongsideanalysisbroaderbusinesschainconsumerscostscustomercustomersdecisionsdeliverydescribeddesigndirectlyeconomicallyfirms
SHARED TOKENS (51): "access", "advisory", "affecting", "age", "alongside", "analysis", "broader", "business", "chain", "consumers", "costs", "customer", "customers", "decisions", "delivery", "described", "design", "directly", "economically", "firms".... | EXACT TITLE in transportation_infrastructure: "Retail". | EXACT TITLE in beauty_salon: "Retail".
0.500
accordingactadministrationagencyamongapprovalbuildingcarecenterscontroldecemberdepartmentdisabilitydistinctdivisionengineeringexposurefederalfoundedfunctions
SHARED TOKENS (48): "according", "act", "administration", "agency", "among", "approval", "building", "care", "centers", "control", "december", "department", "disability", "distinct", "division", "engineering", "exposure", "federal", "founded", "functions".... | EXACT TITLE in beauty_salon: "National Institute for Occupational Safety and Health".
0.500
boisecommercialcommissiondepartmentdowntownfacilityfallsfunctionsgeneralidahonationaloperatedoperatespermissionrequiringsouthsupportuseswestern
SHARED TOKENS (19): "boise", "commercial", "commission", "department", "downtown", "facility", "falls", "functions", "general", "idaho", "national", "operated", "operates", "permission", "requiring", "south", "support", "uses", "western". | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
actadministrationagencyassistancedepartmentdevelopmentfederalfinancialmanagementnationaloperatespolicyprogramsprovidepublicregulationsresearchsafetysupporttransportation
SHARED TOKENS (20): "act", "administration", "agency", "assistance", "department", "development", "federal", "financial", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "research", "safety", "support", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingagencyassistancechangescleancontroldirectlyfederalformgoverninginvolvinglawmaintainingmajorownedphysicalprimaryprovidingprovisions
SHARED TOKENS (28): "act", "addressing", "agency", "assistance", "changes", "clean", "control", "directly", "federal", "form", "governing", "involving", "law", "maintaining", "major", "owned", "physical", "primary", "providing", "provisions".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingcommunityconnectingconnectionconstructioncreatedesignengineeringimpactsloadslocalmajormeetnetworkpermittedphysicalproductprovideprovidingrequirements
SHARED TOKENS (28): "allowing", "community", "connecting", "connection", "construction", "create", "design", "engineering", "impacts", "loads", "local", "major", "meet", "network", "permitted", "physical", "product", "provide", "providing", "requirements".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
businesscertificationconsumerconsumerscreatescustomercustomerseconomicentryformgeneralgrowthhealthindividuallawlicenselicensedlicensinglicensuremarket
SHARED TOKENS (39): "business", "certification", "consumer", "consumers", "creates", "customer", "customers", "economic", "entry", "form", "general", "growth", "health", "individual", "law", "license", "licensed", "licensing", "licensure", "market".... | EXACT TITLE in beauty_salon: "Occupational licensing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
applicationappliescentralchangescollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributedformfullgrowthimprovementslandscapemanagementnetworkoperation
SHARED TOKENS (34): "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "form", "full", "growth", "improvements", "landscape", "management", "network", "operation".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
accordingactadministrationannualauthorizationbusinessbusinessescertificationhomeindustryinspectionlargelicensemeasuresmedicaloperateoperationsorganizationspolicyprograms
SHARED TOKENS (32): "according", "act", "administration", "annual", "authorization", "business", "businesses", "certification", "home", "industry", "inspection", "large", "license", "measures", "medical", "operate", "operations", "organizations", "policy", "programs".... | EXACT TITLE in beauty_salon: "Small business".
0.500
accessallowingbegandatadevelopmentelectricalformfurtherindependentindividualinformationmeansmediaphysicalpowersignalssingletechnologyusers
SHARED TOKENS (19): "access", "allowing", "began", "data", "development", "electrical", "form", "further", "independent", "individual", "information", "means", "media", "physical", "power", "signals", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherarrangementbrandbrandedbusinesscapitalchainconditionscontrollingcorporatedirecteconomicentityespeciallyexpansionexplicitlyfeesfinancialfranchisegrowth
SHARED TOKENS (43): "another", "arrangement", "brand", "branded", "business", "capital", "chain", "conditions", "controlling", "corporate", "direct", "economic", "entity", "especially", "expansion", "explicitly", "fees", "financial", "franchise", "growth".... | EXACT TITLE in beauty_salon: "Franchising".
0.500
accordingadditionalbodiescarecostcreateeconomicestimatesexposuregeneralhealthjurisdictionlawoccupationalofficialpowersproductprogramspublicsafety
SHARED TOKENS (24): "according", "additional", "bodies", "care", "cost", "create", "economic", "estimates", "exposure", "general", "health", "jurisdiction", "law", "occupational", "official", "powers", "product", "programs", "public", "safety".... | EXACT TITLE in beauty_salon: "Occupational safety and health".
0.500
activebusinesscapitalcategorychangescontroldescribeddevelopmentequityexpansionfinancialfirmsgeneralinvestmentlimitedlong-termmanagementoperationalotherwiseownership
SHARED TOKENS (29): "active", "business", "capital", "category", "changes", "control", "described", "development", "equity", "expansion", "financial", "firms", "general", "investment", "limited", "long-term", "management", "operational", "otherwise", "ownership".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
constructiondesigndistinguishengineeringfirmsinfrastructurelocallymaintenancemunicipalnationalphysicalpipelinesprivateprofessionalpublicsectorsystems
SHARED TOKENS (17): "construction", "design", "distinguish", "engineering", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "pipelines", "private", "professional", "public", "sector", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalapproximatelyboardbusinessdirectlyfederalfoundedlimitedmetropolitannationalnetworkoperateoperatesoperatorownedreportingrevenuesouthstationssupport
SHARED TOKENS (23): "additional", "approximately", "board", "business", "directly", "federal", "founded", "limited", "metropolitan", "national", "network", "operate", "operates", "operator", "owned", "reporting", "revenue", "south", "stations", "support".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicboardboisecollegecommunitydevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentsstudentstudentstechnical
SHARED TOKENS (25): "academic", "board", "boise", "college", "community", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "reported", "residents", "student", "students", "technical".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
activitybusinesscontractoreconomicemployeremploymentevenindependentindividualissueneedsoperateplacingratherrealtaxthereforeviewwork
SHARED TOKENS (19): "activity", "business", "contractor", "economic", "employer", "employment", "even", "independent", "individual", "issue", "needs", "operate", "placing", "rather", "real", "tax", "therefore", "view", "work". | EXACT TITLE in beauty_salon: "Self-employment".
0.500
additionalagainstapprovedassociationauthorizationcustomersenablesfederalfinancialhistoryinformationissuemeasuresoperationpaymentprocessorssupplysystemtransaction
SHARED TOKENS (19): "additional", "against", "approved", "association", "authorization", "customers", "enables", "federal", "financial", "history", "information", "issue", "measures", "operation", "payment", "processors", "supply", "system", "transaction". | EXACT TITLE in beauty_salon: "Payment processor".
0.500
businessesdesignfacilitiesfutureimpactsinfluencemovementneedsplannersplanningprivateprocesspublicsystemtransportation
SHARED TOKENS (15): "businesses", "design", "facilities", "future", "impacts", "influence", "movement", "needs", "planners", "planning", "private", "process", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessbeyondcommunitycustomersdestinationdevelopedeconomicextendsformformallocalmetropolitanoperateoperatedoperatesoperatorsorganizationsprivateprovideproviding
SHARED TOKENS (29): "access", "beyond", "community", "customers", "destination", "developed", "economic", "extends", "form", "formal", "local", "metropolitan", "operate", "operated", "operates", "operators", "organizations", "private", "provide", "providing".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
Cosmetics ↗ Q131207 EXACT TITLE
applicationapprovalbodycarecommercialcontaindifferenthealthproductsregulationsregulatoryrequiresafetyvisible
SHARED TOKENS (14): "application", "approval", "body", "care", "commercial", "contain", "different", "health", "products", "regulations", "regulatory", "require", "safety", "visible". | EXACT TITLE in beauty_salon: "Cosmetics".
0.460
constructiongeneralhomeidahointegratedmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (13): "construction", "general", "home", "idaho", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.460
controlsdesigndifferentmajormeetotherwisepracticereflectsseparatespecifiedtrafficusesvehicles
SHARED TOKENS (13): "controls", "design", "different", "major", "meet", "otherwise", "practice", "reflects", "separate", "specified", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.460
Plumbing ↗ Q3241671 EXACT TITLE
amongapplicationsdeliverydevelopedhealthinfrastructurelimitedpublicsystemsystemsuseswastework
SHARED TOKENS (13): "among", "applications", "delivery", "developed", "health", "infrastructure", "limited", "public", "system", "systems", "uses", "waste", "work". | EXACT TITLE in beauty_salon: "Plumbing".
0.440
Culvert ↗ Q4168092 EXACT TITLE
allowingembeddeditselfmaterialneedplacingpracticeprocessrequirementsshapestructuretraffic
SHARED TOKENS (12): "allowing", "embedded", "itself", "material", "need", "placing", "practice", "process", "requirements", "shape", "structure", "traffic". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.440
applicationcarecostlicensemakingmedianoccupationalpermanentschoolstudytreatmentwage
SHARED TOKENS (12): "application", "care", "cost", "license", "making", "median", "occupational", "permanent", "school", "study", "treatment", "wage". | EXACT TITLE in beauty_salon: "Cosmetology".
0.420
Road ↗ Q34442 EXACT TITLE
accessanotherdesignlocalmovementprimaryprivatepublictrafficurbanwhose
SHARED TOKENS (11): "access", "another", "design", "local", "movement", "primary", "private", "public", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in beauty_salon: "Road".
0.420
Broadband ↗ Q194163 EXACT TITLE
accessdatadifferentintegratednetworkplannedproviderequirementssignalstechnologyuses
SHARED TOKENS (11): "access", "data", "different", "integrated", "network", "planned", "provide", "requirements", "signals", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.420
Manicure ↗ Q747493 EXACT TITLE
applicationedgefeethomelicensedregulationssmalltechniciansthereforetogethertreatment
SHARED TOKENS (11): "application", "edge", "feet", "home", "licensed", "regulations", "small", "technicians", "therefore", "together", "treatment". | EXACT TITLE in beauty_salon: "Manicure".
0.420
Beauty ↗ Q7242 EXACT TITLE
aestheticsconnectiondescribedintegratedpropertyrathersidestandardsstudysubjecttoward
SHARED TOKENS (11): "aesthetics", "connection", "described", "integrated", "property", "rather", "side", "standards", "study", "subject", "toward". | EXACT TITLE in beauty_salon: "Beauty".
0.420
Oncology ↗ Q162555 EXACT TITLE
amongcareclinicaldescribedformmedicalpracticesprofessionalresearchstudytreatment
SHARED TOKENS (11): "among", "care", "clinical", "described", "form", "medical", "practices", "professional", "research", "study", "treatment". | EXACT TITLE in beauty_salon: "Oncology".
0.400
Acetone ↗ Q49546 EXACT TITLE
bodiesbodybuildinghomeindustrylargermedicalpresentproductssmall
SHARED TOKENS (10): "bodies", "body", "building", "home", "industry", "larger", "medical", "present", "products", "small". | EXACT TITLE in beauty_salon: "Acetone".
0.400
Pedestrian ↗ Q221488 EXACT TITLE
associatedcreatinghistoricallynetworkprofessionalrecordsafetytrafficurbanvehicles
SHARED TOKENS (10): "associated", "creating", "historically", "network", "professional", "record", "safety", "traffic", "urban", "vehicles". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.400
administrationagencydepartmentdivisionfederalmajorprogramprogramspublictransportation
SHARED TOKENS (10): "administration", "agency", "department", "division", "federal", "major", "program", "programs", "public", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.380
becomesbodydifferentfeetgrowthmeaningmedicalprocessvisible
SHARED TOKENS (9): "becomes", "body", "different", "feet", "growth", "meaning", "medical", "process", "visible". | EXACT TITLE in beauty_salon: "Hair removal".
0.380
Nail salon ↗ Q8007048 EXACT TITLE
boardcareformalgeneraloptionsqualificationstechniciansthroughoutwork
SHARED TOKENS (9): "board", "care", "formal", "general", "options", "qualifications", "technicians", "throughout", "work". | EXACT TITLE in beauty_salon: "Nail salon".
0.380
Dermatology ↗ Q171171 EXACT TITLE
advancedbeyondconditionsmedicalphysicalpopulationrequiringschooltraining
SHARED TOKENS (9): "advanced", "beyond", "conditions", "medical", "physical", "population", "requiring", "school", "training". | EXACT TITLE in beauty_salon: "Dermatology".
0.380
annualapproximatelybusinessbusinessesemploymentlaboroccupationalregionalwage
SHARED TOKENS (9): "annual", "approximately", "business", "businesses", "employment", "labor", "occupational", "regional", "wage". | EXACT TITLE in beauty_salon: "Occupational Employment and Wage Statistics".
0.360
Day spa ↗ Q11290050 EXACT TITLE
accordingassociationbusinesscarefacilityhealthitselfproviding
SHARED TOKENS (8): "according", "association", "business", "care", "facility", "health", "itself", "providing". | EXACT TITLE in beauty_salon: "Day spa".
0.360
Electrician ↗ Q165029 EXACT TITLE
dataelectricalelectriciansexistinginfrastructuremaintenancemobileplatforms
SHARED TOKENS (8): "data", "electrical", "electricians", "existing", "infrastructure", "maintenance", "mobile", "platforms". | EXACT TITLE in transportation_infrastructure: "Electrician". | EXACT TITLE in beauty_salon: "Electrician".
0.360
Hair loss ↗ Q181391 EXACT TITLE
agebodyeventneedpresentsmalltreatedtreatment
SHARED TOKENS (8): "age", "body", "event", "need", "present", "small", "treated", "treatment". | EXACT TITLE in beauty_salon: "Hair loss".
0.360
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingbusinessesdirectlyfacilitylargematerialsstandard
SHARED TOKENS (8): "associated", "building", "businesses", "directly", "facility", "large", "materials", "standard". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.340
distinctmeanspresentprocessratherreducespecific
SHARED TOKENS (7): "distinct", "means", "present", "process", "rather", "reduce", "specific". | EXACT TITLE in beauty_salon: "Sterilization (microbiology)".
0.340
Utility ↗ Q466707 EXACT TITLE
amongdevelopeddistincteconomicsfunctionsmaintainingsource
SHARED TOKENS (7): "among", "developed", "distinct", "economics", "functions", "maintaining", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.340
Facial ↗ Q2667974 EXACT TITLE
conditionsgeneralhealthinvolvingphysicalspecifictreatment
SHARED TOKENS (7): "conditions", "general", "health", "involving", "physical", "specific", "treatment". | EXACT TITLE in beauty_salon: "Facial".
0.340
Shampoo ↗ Q180204 EXACT TITLE
careconditionscontainformproductseparateusers
SHARED TOKENS (7): "care", "conditions", "contain", "form", "product", "separate", "users". | EXACT TITLE in beauty_salon: "Shampoo".
0.340
movementpermitstandardsystemthoughtrafficuses
SHARED TOKENS (7): "movement", "permit", "standard", "system", "though", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in beauty_salon: "Interchange (road)".
0.340
Waxing ↗ Q269107 EXACT TITLE
bodycoveringdifferentfeetformgrowthprocess
SHARED TOKENS (7): "body", "covering", "different", "feet", "form", "growth", "process". | EXACT TITLE in beauty_salon: "Waxing".
0.340
boiseexpansionformeridahooperatingrestorationthough
SHARED TOKENS (7): "boise", "expansion", "former", "idaho", "operating", "restoration", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.340
Snowplow ↗ Q14976 EXACT TITLE
deviceespeciallylargeservingspecifictransportationvehicles
SHARED TOKENS (7): "device", "especially", "large", "serving", "specific", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.340
Aveda ↗ Q4827965 EXACT TITLE
bodycarefoundedownedproductsstudentstrains
SHARED TOKENS (7): "body", "care", "founded", "owned", "products", "students", "trains". | EXACT TITLE in beauty_salon: "Aveda".
0.340
bodycontrolledmedicalprocessprovidertreatedtreatment
SHARED TOKENS (7): "body", "controlled", "medical", "process", "provider", "treated", "treatment". | EXACT TITLE in beauty_salon: "Chemical peel".
0.320
Barber ↗ Q107198 EXACT TITLE
developmentplacespublicsafetywhosework
SHARED TOKENS (6): "development", "places", "public", "safety", "whose", "work". | EXACT TITLE in beauty_salon: "Barber".
0.320
associationespeciallylandscapemultipleurbanusers
SHARED TOKENS (6): "association", "especially", "landscape", "multiple", "urban", "users". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.320
createhomepracticereportedsalesspecific
SHARED TOKENS (6): "create", "home", "practice", "reported", "sales", "specific". | EXACT TITLE in beauty_salon: "Hair coloring".
0.300
accesschaincostsdestinationdirecteconomicsespeciallygeneralitselflogisticsmaterialoperatingpracticepracticesregionspecializedtrainstransportation
SHARED TOKENS (18): "access", "chain", "costs", "destination", "direct", "economics", "especially", "general", "itself", "logistics", "material", "operating", "practice", "practices", "region", "specialized", "trains", "transportation".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbuildingcommercialcostsdescribeddevelopmentexistingexpansionformgrowthinfrastructurelargemaintainingplanningpopulationprivatepropertyrequireresidential
SHARED TOKENS (28): "agency", "associated", "building", "commercial", "costs", "described", "development", "existing", "expansion", "form", "growth", "infrastructure", "large", "maintaining", "planning", "population", "private", "property", "require", "residential"....
0.300
bodyelectricalpracticeprocessprofessional
SHARED TOKENS (5): "body", "electrical", "practice", "process", "professional". | EXACT TITLE in beauty_salon: "Electrology".
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activeconditionscontactcontaincontainingcontrolhealthmakingmaterialsplacesprocessproductproductsuseswork
SHARED TOKENS (15): "active", "conditions", "contact", "contain", "containing", "control", "health", "making", "materials", "places", "process", "product", "products", "uses", "work".
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedbrandconditionscustomersindependentinspectionmaintenanceneedsproblemproposedshowingspecifictechnicianwork
SHARED TOKENS (16): "already", "approval", "approved", "brand", "conditions", "customers", "independent", "inspection", "maintenance", "needs", "problem", "proposed", "showing", "specific", "technician", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedcentraldesignfullmovesneedpermittedreducerequireresearchresultingrulessafetysignalssignificantthroughouttrafficvehicleswork
SHARED TOKENS (19): "associated", "central", "design", "full", "moves", "need", "permitted", "reduce", "require", "research", "resulting", "rules", "safety", "signals", "significant", "throughout", "traffic", "vehicles", "work".
0.300
accordingcreatingdemanddisabilityformfunctionsmedicalmobilemovementneedsnetworkprivateprogramsprovidepublicratherrelevantsharedtechnologyusers
SHARED TOKENS (21): "according", "creating", "demand", "disability", "form", "functions", "medical", "mobile", "movement", "needs", "network", "private", "programs", "provide", "public", "rather", "relevant", "shared", "technology", "users"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmenteconomyemploymentexpansionlawlocalmeetnationalpermissionpermitpermitsplanplanners
SHARED TOKENS (26): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "economy", "employment", "expansion", "law", "local", "meet", "national", "permission", "permit", "permits", "plan", "planners"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcommunitiesconnectingdifferenthourinsidemetropolitanmultipleoperateoperatespricingregionalsystemstrainsurbanzone
SHARED TOKENS (17): "business", "central", "communities", "connecting", "different", "hour", "inside", "metropolitan", "multiple", "operate", "operates", "pricing", "regional", "systems", "trains", "urban", "zone".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
classificationscontrolenforcementeventhealthidentifiedimpactmeasuresoccupationalpracticesprovidingpublicremainrequiringsafesafetysecondsidespecificstandards
SHARED TOKENS (24): "classifications", "control", "enforcement", "event", "health", "identified", "impact", "measures", "occupational", "practices", "providing", "public", "remain", "requiring", "safe", "safety", "second", "side", "specific", "standards"....
0.300
buildingbusinesscentraldedicateddevelopmentformgrowthintegratednetworkplanningprivateproblempublicresidentialscaleservingspaceurban
SHARED TOKENS (18): "building", "business", "central", "dedicated", "development", "form", "growth", "integrated", "network", "planning", "private", "problem", "public", "residential", "scale", "serving", "space", "urban".
0.300
applicationassistancecostscoveringeducationfederalfinancialinstitutionsmanagementneedorganizationsprivateprocessstudentstudents
SHARED TOKENS (15): "application", "assistance", "costs", "covering", "education", "federal", "financial", "institutions", "management", "need", "organizations", "private", "process", "student", "students".
0.300
activityadministrationanotherbodieschangescontroldecisionsdivisioneconomiceducationenforcementfurthergoverninginfluenceitselflawlegalmodelpublicregulations
SHARED TOKENS (26): "activity", "administration", "another", "bodies", "changes", "control", "decisions", "division", "economic", "education", "enforcement", "further", "governing", "influence", "itself", "law", "legal", "model", "public", "regulations"....
0.300
availabilityconsumerconsumersfeegeneralinformationmultipleneedsoperatorprimaryprocessproductproductsprovidersregisterretailsinglesitespecificusers
SHARED TOKENS (21): "availability", "consumer", "consumers", "fee", "general", "information", "multiple", "needs", "operator", "primary", "process", "product", "products", "providers", "register", "retail", "single", "site", "specific", "users"....
0.300
accessibleadministrationageagencyanotherawaybuildingcenterscommercialconstructiondepartmentdivisioneconomyeducationfederalgoverninggovernshandlinghealthhome
SHARED TOKENS (46): "accessible", "administration", "age", "agency", "another", "away", "building", "centers", "commercial", "construction", "department", "division", "economy", "education", "federal", "governing", "governs", "handling", "health", "home"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritydifferentestatefacilityfulllegallocaloperateotherwiseownershipphysicalprivaterealspecifictraffictransportationvehicles
SHARED TOKENS (17): "authority", "different", "estate", "facility", "full", "legal", "local", "operate", "otherwise", "ownership", "physical", "private", "real", "specific", "traffic", "transportation", "vehicles".
0.300
actapplicableassociationauthoritycentralchangescommunitiescommunityconditionscostscreatingdependdesigndevelopmenteconomicexposurefacilitiesfoundedfurtherfuture
SHARED TOKENS (45): "act", "applicable", "association", "authority", "central", "changes", "communities", "community", "conditions", "costs", "creating", "depend", "design", "development", "economic", "exposure", "facilities", "founded", "further", "future"....
0.300
analysisbusinessesconnectionconsumerconsumerscontactcustomercustomersdatadedicateddifferentdirectgrowthinformationmanagementmarketmaterialsmedianeedsoperations
SHARED TOKENS (30): "analysis", "businesses", "connection", "consumer", "consumers", "contact", "customer", "customers", "data", "dedicated", "different", "direct", "growth", "information", "management", "market", "materials", "media", "needs", "operations"....
0.300
alongsidecapacitycapitalconnectingconventionalcostdedicateddesignmajoritynetworkpublicqualityreducesinglesystemsystemstraffictransportation
SHARED TOKENS (18): "alongside", "capacity", "capital", "connecting", "conventional", "cost", "dedicated", "design", "majority", "network", "public", "quality", "reduce", "single", "system", "systems", "traffic", "transportation".
0.300
advancedapplicationcapacitychangescollectionconditionsdifferentinformationinfrastructuremanagementprovidereducesafetysystemsystemstechnologytraffictransportationusersvehicles
SHARED TOKENS (20): "advanced", "application", "capacity", "changes", "collection", "conditions", "different", "information", "infrastructure", "management", "provide", "reduce", "safety", "system", "systems", "technology", "traffic", "transportation", "users", "vehicles".
0.300
accessdifferentdistributededucationhistoricallyinstructionmultiplenetworkparticipationpresentprocessprogramschoolstudentstudents
SHARED TOKENS (15): "access", "different", "distributed", "education", "historically", "instruction", "multiple", "network", "participation", "present", "process", "program", "school", "student", "students".
0.300
adultsassistanceboardbroaderbusinesscannotcarecommunityexpansionfacilitiesfacilityfederalfragmentedhealthhomeindustryinformationlimitedmeansmedical
SHARED TOKENS (43): "adults", "assistance", "board", "broader", "business", "cannot", "care", "community", "expansion", "facilities", "facility", "federal", "fragmented", "health", "home", "industry", "information", "limited", "means", "medical"....
0.300
assistanceawayespeciallyevenfacilitiesgovernlargeotherwiserulessafetyschoolseparatesignagesignalstogethertrafficusersvehicles
SHARED TOKENS (18): "assistance", "away", "especially", "even", "facilities", "govern", "large", "otherwise", "rules", "safety", "school", "separate", "signage", "signals", "together", "traffic", "users", "vehicles".
0.300
academicbeganbroaderdirectlyeducationenteroccupationsprofessionalprovideprovidingratherschoolschoolsskillsspecificstudentstechnicaltowardtrainingworkforce
SHARED TOKENS (20): "academic", "began", "broader", "directly", "education", "enter", "occupations", "professional", "provide", "providing", "rather", "school", "schools", "skills", "specific", "students", "technical", "toward", "training", "workforce".
0.300
applicationsbecomescentraldemonstratingformlaterlinkedmedicalpotentialprocessproductsresultingsafetysignificantsystem
SHARED TOKENS (15): "applications", "becomes", "central", "demonstrating", "form", "later", "linked", "medical", "potential", "process", "products", "resulting", "safety", "significant", "system".
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingacquiredadditionalapplicationassistancebeganbusinessesconditionsconsumerdatadedicateddevelopedembeddedfeetlocalmapsmobileorganizationsownersparking
SHARED TOKENS (33): "according", "acquired", "additional", "application", "assistance", "began", "businesses", "conditions", "consumer", "data", "dedicated", "developed", "embedded", "feet", "local", "maps", "mobile", "organizations", "owners", "parking"....
0.300
appliesapprovalassociationdecisionsdefinesdevelopmentgovernedidentifyingimpactimpactsmajormakingmanagementparticipationplanplanspolicypotentialpriorprocess
SHARED TOKENS (30): "applies", "approval", "association", "decisions", "defines", "development", "governed", "identifying", "impact", "impacts", "major", "making", "management", "participation", "plan", "plans", "policy", "potential", "prior", "process"....
0.300
accessadvancedcapacitycentralchangesconnectconnectedconnectingcontainingevenmediannetworkparkingplannedplanspropertyproposedprovidequalificationregulated
SHARED TOKENS (29): "access", "advanced", "capacity", "central", "changes", "connect", "connected", "connecting", "containing", "even", "median", "network", "parking", "planned", "plans", "property", "proposed", "provide", "qualification", "regulated"....
0.300
actanalysisanotherapplicationauthoritycannotcategorycreatedatadecisionsdescribesdesigndifferententerevenexistingfullgeneralhealthcarehistorical
SHARED TOKENS (48): "act", "analysis", "another", "application", "authority", "cannot", "category", "create", "data", "decisions", "describes", "design", "different", "enter", "even", "existing", "full", "general", "healthcare", "historical"....
0.300
Dermabrasion ↗ Q1200226 KW CROSS HIGH
ageawaycentersconditionscontrolledcostlocalmeansmedicaloperatorproceduresprocessprofessionalproviderequiresmall
SHARED TOKENS (16): "age", "away", "centers", "conditions", "controlled", "cost", "local", "means", "medical", "operator", "procedures", "process", "professional", "provide", "require", "small".
0.300
communitiesconnectedcontrolcustomerdatafeesindividualinfluencemanagementmarketsorganizationspotentialproductproductsreviewspacesystemswebsites
SHARED TOKENS (18): "communities", "connected", "control", "customer", "data", "fees", "individual", "influence", "management", "markets", "organizations", "potential", "product", "products", "review", "space", "systems", "websites".
0.300
agencyapprovedbegandecemberdepartmenteducationemployeeenforcementestablishingfederalfinancialindependentinformationlegallocalmaintainingmeasuresnationaloperationpermitting
SHARED TOKENS (29): "agency", "approved", "began", "december", "department", "education", "employee", "enforcement", "establishing", "federal", "financial", "independent", "information", "legal", "local", "maintaining", "measures", "national", "operation", "permitting"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agecentralcommercialconstructioncontroldevelopedeventualfallsfurtherhistoryidaholargelimitedmajornationalpolicyprivateproductprogramsproposed
SHARED TOKENS (29): "age", "central", "commercial", "construction", "control", "developed", "eventual", "falls", "further", "history", "idaho", "large", "limited", "major", "national", "policy", "private", "product", "programs", "proposed"....
0.300
agencybuildingclassificationcommercialconstructiondesigndevelopmentexistingfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivateresidentialsinglesitespace
SHARED TOKENS (24): "agency", "building", "classification", "commercial", "construction", "design", "development", "existing", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private", "residential", "single", "site", "space"....
0.300
Floodplain ↗ Q193110 EXACT TITLE
bodycontroldevelopedurbanvalley
SHARED TOKENS (5): "body", "control", "developed", "urban", "valley". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.300
alonearrangementbusinessentityindividuallegallegallyownedownersprocessresponsibilityseparatespecificsubjectwork
SHARED TOKENS (15): "alone", "arrangement", "business", "entity", "individual", "legal", "legally", "owned", "owners", "process", "responsibility", "separate", "specific", "subject", "work".
0.300
connectsconsumerscurrentcustomersdeliverydirectdirectlydistinctelectricalevenformhandlinghistoricallyindustrylocalmajormarketmovementnetworkowned
SHARED TOKENS (26): "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "electrical", "even", "form", "handling", "historically", "industry", "local", "major", "market", "movement", "network", "owned"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontroldecemberdeviceinformationlocalnationalneedreducesignalssouthsystemsystemstechnologytrafficusers
SHARED TOKENS (17): "advanced", "capacity", "control", "december", "device", "information", "local", "national", "need", "reduce", "signals", "south", "system", "systems", "technology", "traffic", "users".
0.300
buildingconditionscontainingcreatesevenhazardhealthidentificationmaterialsphysicalpropertypublicregulationssafetysignagespecificsubjectsystemwaste
SHARED TOKENS (19): "building", "conditions", "containing", "creates", "even", "hazard", "health", "identification", "materials", "physical", "property", "public", "regulations", "safety", "signage", "specific", "subject", "system", "waste".
0.300
approvedcreatefoundeditselflaternetworkoperatesoperatingplansprojectreportingsystemtransportationwestwestern
SHARED TOKENS (15): "approved", "create", "founded", "itself", "later", "network", "operates", "operating", "plans", "project", "reporting", "system", "transportation", "west", "western".
0.300
accessactadditionaladministrationapproximatelyavoidbegancollectionconstructioncontrolledcostcreatingdesigndevelopedextendsfederalfuturegeneralitselfmedian
SHARED TOKENS (41): "access", "act", "additional", "administration", "approximately", "avoid", "began", "collection", "construction", "controlled", "cost", "creating", "design", "developed", "extends", "federal", "future", "general", "itself", "median"....
0.300
aloneanalysisannualbuildingcollectioncontrolestimatesexposureformhazardhealthinfluenceinsidelinkedmaintainingmajorphysicalprimaryproblemquality
SHARED TOKENS (25): "alone", "analysis", "annual", "building", "collection", "control", "estimates", "exposure", "form", "hazard", "health", "influence", "inside", "linked", "maintaining", "major", "physical", "primary", "problem", "quality"....
0.300
academicappliesauthoritybrandbroadercontentinformationinfrastructuremultiplenewspracticeproductsqualityrathersignalstechnicaltrafficusersverticalvisibility
SHARED TOKENS (21): "academic", "applies", "authority", "brand", "broader", "content", "information", "infrastructure", "multiple", "news", "practice", "products", "quality", "rather", "signals", "technical", "traffic", "users", "vertical", "visibility"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationanalysisanotherbroaderbusinesscapitalcategorycodescommunitiescommunitycreatingdesigndevelopmentdifferenteconomicengineeringexistinggrowthhealth
SHARED TOKENS (54): "accessibility", "administration", "analysis", "another", "broader", "business", "capital", "category", "codes", "communities", "community", "creating", "design", "development", "different", "economic", "engineering", "existing", "growth", "health"....
0.300
academicaddressesamongcareconnectscontroldeliverydepartmenthealthhealthcareinfrastructurelocalmeasuresmedicalpracticepublicpublishesrathersafetysystem
SHARED TOKENS (21): "academic", "addresses", "among", "care", "connects", "control", "delivery", "department", "health", "healthcare", "infrastructure", "local", "measures", "medical", "practice", "public", "publishes", "rather", "safety", "system"....
0.300
accordingactivityanalysisbecomesboundariesdesignengineeringgenerallegallicenselicensedlicensurelocalmaintenanceplanspracticepractitionersprocessproductproducts
SHARED TOKENS (37): "according", "activity", "analysis", "becomes", "boundaries", "design", "engineering", "general", "legal", "license", "licensed", "licensure", "local", "maintenance", "plans", "practice", "practitioners", "process", "product", "products"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
businesschaincollectioncommercialdataindustryinventorymanagementmobileplatformsprocessingproductsretailsupplysystemstransaction
SHARED TOKENS (16): "business", "chain", "collection", "commercial", "data", "industry", "inventory", "management", "mobile", "platforms", "processing", "products", "retail", "supply", "systems", "transaction".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybecomesbeganbodiesbuildingcodecodescomplianceconstructioncontrolcouncildesigndistrictelectricalestatefacilitygeneralhealthinspectors
SHARED TOKENS (44): "approved", "authority", "becomes", "began", "bodies", "building", "code", "codes", "compliance", "construction", "control", "council", "design", "district", "electrical", "estate", "facility", "general", "health", "inspectors"....
0.300
Nursing home ↗ Q837142 KW CROSS HIGH
accordingageassociationcaredifferentfacilitiesfacilityhomeinstitutionsinsurancelong-termmedicalneedneedsoccupationalphysicalplannedprivateprovidepublic
SHARED TOKENS (24): "according", "age", "association", "care", "different", "facilities", "facility", "home", "institutions", "insurance", "long-term", "medical", "need", "needs", "occupational", "physical", "planned", "private", "provide", "public"....
0.300
academicapplicationcompatibledesignengineeringfacilitiesmanagementmovementoccupationaloperationplanningprovidesafetechnologytransportation
SHARED TOKENS (15): "academic", "application", "compatible", "design", "engineering", "facilities", "management", "movement", "occupational", "operation", "planning", "provide", "safe", "technology", "transportation".
0.300
actactiveapproximatelyauthorityauthorizedbuildingbusinesscapacitycleanconstructioncontroldepartmentdesigndirectdirectlyeconomyengineeringestablishfacilitiesfederal
SHARED TOKENS (48): "act", "active", "approximately", "authority", "authorized", "building", "business", "capacity", "clean", "construction", "control", "department", "design", "direct", "directly", "economy", "engineering", "establish", "facilities", "federal"....
0.300
engineeringinvolvingnetworktraffictransportation
SHARED TOKENS (5): "engineering", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedconnectdevelopmentevenfeefullfunctionsimpactlaterlegalownersownershippaymentpowerprivatepropertypublic
SHARED TOKENS (26): "acquisition", "another", "application", "authorized", "connect", "development", "even", "fee", "full", "functions", "impact", "later", "legal", "owners", "ownership", "payment", "power", "private", "property", "public"....
0.300
additionaladvancedbeganbusinessescarecontactdepartmentfacilitieshistoricallymedicalmodeloperateplacespresentprimaryprovideprovidingpublicqualificationremains
SHARED TOKENS (33): "additional", "advanced", "began", "businesses", "care", "contact", "department", "facilities", "historically", "medical", "model", "operate", "places", "present", "primary", "provide", "providing", "public", "qualification", "remains"....
0.300
academicanotherbecomescontentcostsdedicateddevelopeddevelopmentdiscoveryfinancialhomeinformationlargemaintenancemajormediamobilemultiplenewsoperate
SHARED TOKENS (35): "academic", "another", "becomes", "content", "costs", "dedicated", "developed", "development", "discovery", "financial", "home", "information", "large", "maintenance", "major", "media", "mobile", "multiple", "news", "operate"....
0.300
administrationamongchangescommunitiescompliancecontentcontrolcurrentdecemberdefinesdepartmentdesigndevelopeddocumentfederallawlocalnationalownedparking
SHARED TOKENS (29): "administration", "among", "changes", "communities", "compliance", "content", "control", "current", "december", "defines", "department", "design", "developed", "document", "federal", "law", "local", "national", "owned", "parking"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiescannotconnectdesigndestinationevenfallsinfrastructureinsidelargemunicipalparkingpropertypublicrequireresidentialsmallsystems
SHARED TOKENS (18): "bodies", "cannot", "connect", "design", "destination", "even", "falls", "infrastructure", "inside", "large", "municipal", "parking", "property", "public", "require", "residential", "small", "systems".
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdifferentformindividualmeaningmultipleoperateoperatesoperatingoperationssectionsystemsystemstechnologytogethertrafficurbanuses
SHARED TOKENS (20): "broader", "capacity", "conditions", "different", "form", "individual", "meaning", "multiple", "operate", "operates", "operating", "operations", "section", "system", "systems", "technology", "together", "traffic", "urban", "uses".
0.300
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahourbanwestern
SHARED TOKENS (5): "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.300
administrationbuildingconditionsdepartmentdirectlyeconomicemploymentfederalgoverninghealthhistoryhourlaboroccupationalregulationsreportssafetystandardswageworkers
SHARED TOKENS (20): "administration", "building", "conditions", "department", "directly", "economic", "employment", "federal", "governing", "health", "history", "hour", "labor", "occupational", "regulations", "reports", "safety", "standards", "wage", "workers".
0.300
accesscommunitydesigneconomichealthhomeoperatedplannedplannerspolicypractitionerspublicrequiressafesafetytraffictransportationurbanusers
SHARED TOKENS (19): "access", "community", "design", "economic", "health", "home", "operated", "planned", "planners", "policy", "practitioners", "public", "requires", "safe", "safety", "traffic", "transportation", "urban", "users".
0.300
activityanotherbodyemployerestimateseventsexposurefallsgeneralhazardshealthidentifiedlawlegalmaterialnationaloccupationalpopulationreportreported
SHARED TOKENS (28): "activity", "another", "body", "employer", "estimates", "events", "exposure", "falls", "general", "hazards", "health", "identified", "law", "legal", "material", "national", "occupational", "population", "report", "reported"....
0.300
associatedcommunitiescommunityconsumerscontrolexposurehazardhazardshealthindividualmanagementmodelsoccupationalphysicalworkworkers
SHARED TOKENS (16): "associated", "communities", "community", "consumers", "control", "exposure", "hazard", "hazards", "health", "individual", "management", "models", "occupational", "physical", "work", "workers".
0.300
amongassociatedbodycarecategoryconsumerconsumerscontainingdifferentformfurtherinclusionindustrymarketproductsremain
SHARED TOKENS (16): "among", "associated", "body", "care", "category", "consumer", "consumers", "containing", "different", "form", "further", "inclusion", "industry", "market", "products", "remain".
🫐 BERRY57 edges
0.280
careproductsschoolssystems
SHARED TOKENS (4): "care", "products", "schools", "systems". | EXACT TITLE in beauty_salon: "Paul Mitchell (hairdresser)".
0.280
Toluene ↗ Q15779 EXACT TITLE
contactpermanentpotentialsingle
SHARED TOKENS (4): "contact", "permanent", "potential", "single". | EXACT TITLE in beauty_salon: "Toluene".
0.280
Balayage ↗ Q4850161 EXACT TITLE
boundarymapsoperatorpotential
SHARED TOKENS (4): "boundary", "maps", "operator", "potential". | EXACT TITLE in beauty_salon: "Balayage".
0.280
distinguishmeanspermanentprocess
SHARED TOKENS (4): "distinguish", "means", "permanent", "process". | EXACT TITLE in transportation_infrastructure: "Perm (hairstyle)". | EXACT TITLE in beauty_salon: "Perm (hairstyle)".
0.280
buildingcontrolcostsdesignelectricalevaluateimpactmaintenanceoperatingprovidequalitysystemstechnologyvehicles
SHARED TOKENS (14): "building", "control", "costs", "design", "electrical", "evaluate", "impact", "maintenance", "operating", "provide", "quality", "systems", "technology", "vehicles".
0.280
Pedicure ↗ Q1161133 EXACT TITLE
carefeetmeanstreatment
SHARED TOKENS (4): "care", "feet", "means", "treatment". | EXACT TITLE in beauty_salon: "Pedicure".
0.280
Scalp ↗ Q9622 EXACT TITLE
collectioncoveringstructuresstudy
SHARED TOKENS (4): "collection", "covering", "structures", "study". | EXACT TITLE in beauty_salon: "Scalp".
0.260
businessmedicaltreatment
SHARED TOKENS (3): "business", "medical", "treatment". | EXACT TITLE in beauty_salon: "Beauty salon".
0.260
compareconsumerscustomercustomersdecisionsdedicatedformproductproductsprofessionalreviewreviewsusers
SHARED TOKENS (13): "compare", "consumers", "customer", "customers", "decisions", "dedicated", "form", "product", "products", "professional", "review", "reviews", "users".
0.260
largeprocessscale
SHARED TOKENS (3): "large", "process", "scale". | EXACT TITLE in beauty_salon: "Ethyl acetate".
0.260
realrecommendedrequire
SHARED TOKENS (3): "real", "recommended", "require". | EXACT TITLE in beauty_salon: "Artificial nails".
0.260
academiccollegecommunitydifferenteducationforminstitutionspolicyprogramsschoolseniorstudentsworkforce
SHARED TOKENS (13): "academic", "college", "community", "different", "education", "form", "institutions", "policy", "programs", "school", "senior", "students", "workforce".
0.260
Sidewalk ↗ Q177749 EXACT TITLE
privatesidesouth
SHARED TOKENS (3): "private", "side", "south". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.260
Spa ↗ Q1341387 EXACT TITLE
especiallyhealthpowers
SHARED TOKENS (3): "especially", "health", "powers". | EXACT TITLE in transportation_infrastructure: "Spa". | EXACT TITLE in beauty_salon: "Spa".
0.240
boisehomeidaholargermeridianmetropolitannampapercentpopulationsectiontreasurevalley
SHARED TOKENS (12): "boise", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "percent", "population", "section", "treasure", "valley".
0.240
changesdesignengineeringespeciallymeasuresphysicalplannersrulesafetytrafficurbanuses
SHARED TOKENS (12): "changes", "design", "engineering", "especially", "measures", "physical", "planners", "rule", "safety", "traffic", "urban", "uses".
0.240
Make-up artist ↗ Q935666 KW CROSS HIGH
accessappliesbodycommunityindustrylargelicensesprofessionalprojectremainwhosework
SHARED TOKENS (12): "access", "applies", "body", "community", "industry", "large", "licenses", "professional", "project", "remain", "whose", "work".
0.240
creatingdepartmentdifferentevenmovementpathwaypermitprimaryprovidesharedurbanusers
SHARED TOKENS (12): "creating", "department", "different", "even", "movement", "pathway", "permit", "primary", "provide", "shared", "urban", "users".
0.240
Coworking ↗ Q869457 KW CROSS HIGH
arrangementavoidcontractorscostdifferenthomeimpactindependentmajorprovidespaceworkers
SHARED TOKENS (12): "arrangement", "avoid", "contractors", "cost", "different", "home", "impact", "independent", "major", "provide", "space", "workers".
0.240
constructiondesignengineeringfuturemaintenancematerialsoperationplanningprofessionalstandardstraffictransportation
SHARED TOKENS (12): "construction", "design", "engineering", "future", "maintenance", "materials", "operation", "planning", "professional", "standards", "traffic", "transportation".
0.220
Wedding ↗ Q49836 EXACT TITLE
authoritypublic
SHARED TOKENS (2): "authority", "public". | EXACT TITLE in beauty_salon: "Wedding".
0.220
createuses
SHARED TOKENS (2): "create", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.220
Wig ↗ Q105507 EXACT TITLE
coveringprofessional
SHARED TOKENS (2): "covering", "professional". | EXACT TITLE in beauty_salon: "Wig".
0.220
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralidahomajornationalofficialplannedrulesthroughoutwestwestern
SHARED TOKENS (11): "caldwell", "general", "idaho", "major", "national", "official", "planned", "rules", "throughout", "west", "western".
0.220
departmentdirectlyeconomyfederalmovementplanreportssafeservingsystemtransportation
SHARED TOKENS (11): "department", "directly", "economy", "federal", "movement", "plan", "reports", "safe", "serving", "system", "transportation".
0.220
bodydifferenteventsexposurefeetmakingrepeatedlystructuressupportsystemsystems
SHARED TOKENS (11): "body", "different", "events", "exposure", "feet", "making", "repeatedly", "structures", "support", "system", "systems".
0.210
Barbershop ↗ Q4345168 EXACT TITLE
work
SHARED TOKENS (1): "work". | EXACT TITLE in beauty_salon: "Barbershop".
0.210
Hairdresser ↗ Q55187 EXACT TITLE
whose
SHARED TOKENS (1): "whose". | EXACT TITLE in beauty_salon: "Hairdresser".
0.200
approximatelyboisedatadistrictevenidahopopulationresidentssinglesouth
SHARED TOKENS (10): "approximately", "boise", "data", "district", "even", "idaho", "population", "residents", "single", "south".
0.200
anothercapacitydemandplanningpublicresultingtraffictransportationurbanvehicles
SHARED TOKENS (10): "another", "capacity", "demand", "planning", "public", "resulting", "traffic", "transportation", "urban", "vehicles".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
boisedistrictidahometropolitanpopulationschoolschoolssharedstarwest
SHARED TOKENS (10): "boise", "district", "idaho", "metropolitan", "population", "school", "schools", "shared", "star", "west".
0.200
formulaindustrial
EXACT TITLE in beauty_salon: "Butyl acetate".
0.200
Bike lane ↗ Q1378400 KW CROSS HIGH
advisorybusinesseseconomicentrypermittedresearchsafetyshowstrafficvehicles
SHARED TOKENS (10): "advisory", "businesses", "economic", "entry", "permitted", "research", "safety", "shows", "traffic", "vehicles".
0.180
begancenterschangescommunitiesdepartmentlargepowerretailspecialized
SHARED TOKENS (9): "began", "centers", "changes", "communities", "department", "large", "power", "retail", "specialized".
0.160
agencycategoryestateeventindustryplanningrealtourism
SHARED TOKENS (8): "agency", "category", "estate", "event", "industry", "planning", "real", "tourism".
0.160
accessconnectingformerlocalmajorprovideresidentialtraffic
SHARED TOKENS (8): "access", "connecting", "former", "local", "major", "provide", "residential", "traffic".
0.160
appeardifferentgrowthpermanentpracticerecommendedshowtherefore
SHARED TOKENS (8): "appear", "different", "growth", "permanent", "practice", "recommended", "show", "therefore".
0.160
Oversize load ↗ Q680421 KW CROSS HIGH
constructioninfrastructurelargelegalloadsspecifiedstandardtransportation
SHARED TOKENS (8): "construction", "infrastructure", "large", "legal", "loads", "specified", "standard", "transportation".
0.160
awayboisedowntownfallshomeidahomajormetropolitan
SHARED TOKENS (8): "away", "boise", "downtown", "falls", "home", "idaho", "major", "metropolitan".
0.140
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
idaholimitedpriorsouthsystemwestwestern
SHARED TOKENS (7): "idaho", "limited", "prior", "south", "system", "west", "western".
0.140
Acrylic paint ↗ Q207849 KW CROSS HIGH
costcostsdifferentevenmarketmediatechnical
SHARED TOKENS (7): "cost", "costs", "different", "even", "market", "media", "technical".
0.140
bodygoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (7): "body", "governing", "legal", "limited", "local", "municipal", "owned".
0.140
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellidahometropolitannampapopulationwestern
SHARED TOKENS (7): "boise", "caldwell", "idaho", "metropolitan", "nampa", "population", "western".
0.140
applicableauthorizesdistrictordinancepermituseszoning
SHARED TOKENS (7): "applicable", "authorizes", "district", "ordinance", "permit", "uses", "zoning".
0.140
differentdocumenteventslaterofficialprovidethroughout
SHARED TOKENS (7): "different", "document", "events", "later", "official", "provide", "throughout".
0.140
Hairstyle ↗ Q327496 KW CROSS HIGH
arrangementbodyespeciallyhomeinfluenceshapethough
SHARED TOKENS (7): "arrangement", "body", "especially", "home", "influence", "shape", "though".
0.120
boiseidahometropolitanregiontreasurevalley
SHARED TOKENS (6): "boise", "idaho", "metropolitan", "region", "treasure", "valley".
0.120
Park and ride ↗ Q738031 KW CROSS HIGH
largemetropolitanparkingpublicsystemvehicles
SHARED TOKENS (6): "large", "metropolitan", "parking", "public", "system", "vehicles".
0.120
commerciallargelicensematerialsoperatevehicles
SHARED TOKENS (6): "commercial", "large", "license", "materials", "operate", "vehicles".
0.120
connectingeagleidahomeridiannampavalley
SHARED TOKENS (6): "connecting", "eagle", "idaho", "meridian", "nampa", "valley".
0.100
boiseidahometropolitannampapopulation
SHARED TOKENS (5): "boise", "idaho", "metropolitan", "nampa", "population".
0.100
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boiseidahometropolitanpopulationsmall
SHARED TOKENS (5): "boise", "idaho", "metropolitan", "population", "small".
0.100
commerciallogisticsphysicalprocessproducts
SHARED TOKENS (5): "commercial", "logistics", "physical", "process", "products".
0.100
agencycertificationprofessionalpublicqualification
SHARED TOKENS (5): "agency", "certification", "professional", "public", "qualification".
0.100
costshandlingitselfmultipletransportation
SHARED TOKENS (5): "costs", "handling", "itself", "multiple", "transportation".
0.100
contactdirectexposurephysicalresulting
SHARED TOKENS (5): "contact", "direct", "exposure", "physical", "resulting".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boiseidahometropolitannampapopulation
SHARED TOKENS (5): "boise", "idaho", "metropolitan", "nampa", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Beauty Salon — Treasure Valley
HAIKU · HIGH GATE
How do road improvements in Ada County affect beauty salon accessibility?
Road widening and intersection upgrades throughout Ada County directly reduce travel times for clients visiting salons in Boise, Meridian, and Eagle. The Americans with Disabilities Act of 1990 requires these transportation improvements to include accessible parking and curb cuts, which beauty salons in the Treasure Valley must accommodate at their entrances.
What zoning requirements connect transportation routes to beauty salon locations in Nampa and Caldwell?
Zoning codes in Nampa and Caldwell require beauty salons to locate near major transportation corridors to ensure adequate client access and parking infrastructure. Canyon County's zoning ordinances specify that salon properties must meet setback requirements from state highways while maintaining proximity to local street networks.
How do apprenticeship programs relate to beauty salon workers commuting in the Treasure Valley?
Beauty salon apprentices in Boise and Garden City depend on reliable local transportation networks to travel between apprenticeship training sites and their salon workplaces. The Treasure Valley's population growth has increased demand for both transportation infrastructure expansion and trained salon professionals completing apprenticeship requirements.
Why is transportation planning important for beauty salon operations in Kuna?
Kuna's growing population requires coordinated transportation planning to serve the approximately 25,000 residents who access beauty salon services throughout the metropolitan area. Beauty salon owners in Kuna rely on highway improvements connecting to Boise and Ada County to maintain viable customer bases and employee commute patterns.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Beauty Salon 14 QID bridges 235 edges 6,706 ext links 2026-07-17 23:39:11 UTC 850d88cad435d842
Transportation Infrastructure corridor ↗ Beauty Salon corridor ↗ Beauty Salon × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals