—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Photography

17 Wikipedia bridge articles confirmed in both vertical ledgers. 225 deterministic cross-vertical edges. 6,180 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
225 Cross Edges
6,180 External Sources
252 Wikipedia Articles
21 🌲 Evergreen
153 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Photography
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
225
External Sources Harvested
6,180
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Construction
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (17)
ConstructionIdahoTreasure ValleyFederal Aviation AdministrationBoise State UniversityBoise AirportCollege of Western IdahoNampa, IdahoBoise, IdahoStar, IdahoAda County, IdahoCaldwell, IdahoMeridian, IdahoKuna, IdahoCanyon County, IdahoMiddleton, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanadacanyonwestwesterncapitalnorthwestcollegenamparivertreasurevalleydowntownhomeassociateddevelopmentpercent
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:42:49 UTC
Content Hash
e1c134a6e2776f50
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Construction
Q3875186 EXACT TITLE 1.000
QID OVERLAP: Q3875186 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (19): "asset", "associated", "building", "buildings", "built", "construction", "design", "development", "eventual", "extend", "facilities", "financing", "industrial", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in photography: "Construction".
assetassociatedbuildingbuildingsbuiltconstructiondesigndevelopmenteventualextendfacilitiesfinancingindustrialinfrastructurepercentplanningprocessproductswork
ivering buildings, infrastructure, industrial facilities, and associated activities through to the end of their life. It typically starts with planning, financing, and design that continues until the asset is built and ready for use. Construction also covers repairs and maintenance work, any work to expand, extend, and improve the asset, and its eventual demolition, dismantling, or decommissioning. The construction industry contributes significantly to many countries' gross domestic products (GDP). Global expenditure on construction activities was about $4 trillion in 2012. In 2022, expenditure on the construction industry exceeded $11 trillion a year, equivalent to about 13 percent of global GDP. This spending was forecasted to rise to around $14.8 trillion in 2030. The construction industry promotes economic development and brings many non-monetary benefits to many countries, but it is one of the most hazardous industries.
Construction processes Some construction projects are small renovations or repair jobs, like repainting or fixing leaks, where the owner may act as designer, paymaster and labourer for the entire project. However, more complex or ambitious projects usually require additional multi-disciplinary expertise and manpower, so the owner may commission one or more specialist businesses to undertake detailed planning, design, construction and handover of the work. Often the owner will appoint one business to oversee the project (this may be a designer, a contractor, a construction manager, or other advisors); such specialists are normally appointed for their expertise in project delivery and construction management and will help the owner define the project brief, agree on a budget and schedule, liaise with relevant public authorities, and procure materials and the services of other specialists (the supply chain, comprising subcontractors and materials suppliers). Contracts are agreed for the delivery of services by all businesses, alongside other detailed plans aimed at ensuring legal, timely, on-budget and safe delivery of the specified works. Design, finance, and legal aspects overlap and interrelate. The design must be not only structurally sound and appropriate for the use and location, but must also be financially possible to build, and legal to use. The financial structure must be adequate to build the design provided and must pay amounts that are legally owed. Legal structures integrate design with other activities and enforce financial and other construction processes. These processes also affect procurement strategies. Clients may, for example, appoint a business to design the project, after which a competitive process is undertaken to appoint a lead contractor to construct the asset (design–bid–build); they may appoint a business to lead both design and construction (design-build); or they may directly appoint a designer, contractor and specialist subcontractors (construction management). Some forms of procurement emphasize collaborative relationships (partnering, alliancing) between the client, the contractor, and other stakeholders within a construction project, seeking to ameliorate often highly competitive and adversarial industry practices.
When applicable, a proposed construction project must comply with local land-use planning policies including zoning and building code requirements. A project will normally be assessed (by the 'authority having jurisdiction', AHJ, typically the municipality where the project will be located) for its potential impacts on neighbouring properties, and upon existing infrastructure (transportation, social infrastructure, and utilities including water supply, sewerage, electricity, telecommunications, etc.). Data may be gathered through site analysis, site surveys and geotechnical investigations. Construction normally cannot start until planning permission has been granted, and may require preparatory work to ensure relevant infrastructure has been upgraded before building work can commence. Preparatory works will also include surveys of existing utility lines to avoid damage-causing outages and other hazardous situations. Some legal requirements come from malum in se considerations, or the desire to prevent indisputably bad phenomena, e.g. explosions or bridge collapses. Other legal requirements come from malum prohibitum considerations, or factors that are a matter of custom or expectation, such as isolating businesses from a business district or residences from a residential district. An attorney may seek changes or exemptions in the law that governs the land where the building will be built, either by arguing that a rule is inapplicable (the bridge design will not cause a collapse), or that the custom is no longer needed (acceptance of live-work spaces has grown in the community). During the construction of a building, a municipal building inspector usually inspects the ongoing work periodically to ensure that construction adheres to the approved plans and the local building code. Once construction is complete, any later changes made to a building or other asset that affect safety, including its use, expansion, structural integrity, and fire protection, usually require municipality approval. Finance Depending on the type of project, mortgage bankers, accountants, and cost engineers may participate in creating an overall plan for the financial management of a construction project. The presence of the mortgage banker is highly likely, even in relatively small projects since the owner's equity in the property is the most obvious source of funding for a building project. Accountants act to study the expected monetary flow over the life of the project and to monitor the payouts throughout the process. Professionals including cost engineers, estimators and quantity surveyors apply expertise to relate the work and materials involved to a proper valuation. Financial planning ensures adequate safeguards and contingency plans are in place before the project is started, and ensures that the plan is properly executed over the life of the project. Construction projects can suffer from preventable financial problems. Underbids happen when builders ask for too little money to complete the project. Cash flow problems exist when the present amount of funding cannot cover the current costs for labour and materials; such problems may arise even when the overall budget is adequate, presenting a temporary issue. Cost overruns with government projects have occurred when the contractor identified change orders or project changes that increased costs, which are not subject to competition from other firms as they have already been eliminated from consideration after the initial bid. Fraud is also an issue of growing significance within construction. Large projects can involve highly complex financial plans and often start with a conceptual cost estimate performed by a building estimator. As portions of a project are completed, they may be sold, supplanting one lender or owner for another, while the logistical requirements of having the right trades and materials available for each stage of the building construction project carry forward. Public–private partnerships (PPPs) or private finance initiatives (PFIs) may also be used to help deliver major projects.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (35): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "early", "economy", "idaho", "land", "manufacturing", "mining", "mountain", "national", "northwest", "official", "pacific", "people".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in photography: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistinctearlyeconomyidaholandmanufacturingminingmountainnationalnorthwestofficialpacificpeoplepopulationproductsriversectorseparatesignificantsmallsuppliestechnologyterritory+5
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "chambers", "commerce", "historically", "idaho", "land", "local", "metropolitan", "region", "river", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in photography: "Treasure Valley".
agriculturalassociationboisechamberscommercehistoricallyidaholandlocalmetropolitanregionrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Federal Aviation Administration
Q335357 EXACT TITLE 1.000
QID OVERLAP: Q335357 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (21): "administration", "agency", "aircraft", "assets", "aviation", "certification", "commercial", "control", "created", "department", "faa", "federal", "government", "organization", "personnel", "space", "standards", "surrounding", "traffic", "transportation".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration". | EXACT TITLE in photography: "Federal Aviation Administration".
administrationagencyaircraftassetsaviationcertificationcommercialcontrolcreateddepartmentfaafederalgovernmentorganizationpersonnelspacestandardssurroundingtraffictransportationvehicles
The Federal Aviation Administration (FAA) is a U.S. federal government agency within the U.S. Department of Transportation that regulates civil aviation in the United States and surrounding international waters. Its powers include air traffic control, certification of personnel and aircraft, setting standards for airports, and protection of U.S. assets during the launch or re-entry of commercial space vehicles. Powers over neighboring international waters were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S.
s were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (18): "activity", "among", "boise", "business", "college", "compete", "education", "idaho", "independent", "mountain", "program", "programs", "public", "reported", "research", "school", "university", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in photography: "Boise State University".
activityamongboisebusinesscollegecompeteeducationidahoindependentmountainprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (27): "ada", "aircraft", "airport", "aviation", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "faa", "facility", "field", "functions", "general", "idaho", "military", "national", "operated".... | EXACT TITLE in transportation_infrastructure: "Boise Airport". | EXACT TITLE in photography: "Boise Airport".
adaaircraftairportaviationboisecentercombinedcommercialcommissiondepartmentdowntownfaafacilityfieldfunctionsgeneralidahomilitarynationaloperatedoperatespermissionreceiverequiringrightsuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (28): "academic", "ada", "board", "boise", "canyon", "classes", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in photography: "College of Western Idaho".
academicadaboardboisecanyonclassescollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedsouthweststudentstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (17): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "student", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeaningmeridianmetropolitannampanorthwestpopulationprincipalstudentuniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "downtown", "feet", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "river", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownfeethomeidaholocallymajormanufacturingmetropolitanpopulationriversectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Star, Idaho
Q1516815 QID OVERLAP 0.760
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (13): "ada", "boise", "canyon", "idaho", "metropolitan", "middleton", "parts", "population", "school", "schools", "shared", "star", "west".
adaboisecanyonidahometropolitanmiddletonpartspopulationschoolschoolssharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and photography (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "home", "idaho", "local", "metropolitan", "northwest", "pacific", "population", "private".
adaboisecapitalhomeidaholocalmetropolitannorthwestpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Middleton, Idaho
Q1517595 QID OVERLAP 0.640
QID OVERLAP: Q1517595 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
boisecanyonidahometropolitanmiddletonnampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.640
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and photography (tier:branch). | SHARED TOKENS (7): "ada", "boise", "downtown", "eagle", "idaho", "northwest", "population".
adaboisedowntowneagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
208 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP208 edges
🌲 EVERGREEN4 edges
0.650
acquisitionagencyboardcommercecommissionconstructioncreatedfederalgovernmentindependentmatterspreviouslyrailroadsrateregulatoryrelevantservessubjecttraffictransportation
SHARED TOKENS (21): "acquisition", "agency", "board", "commerce", "commission", "construction", "created", "federal", "government", "independent", "matters", "previously", "railroads", "rate", "regulatory", "relevant", "serves", "subject", "traffic", "transportation".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationairportamericanaviationcommercialcostsfederalgeneralgrantgrantslandlightingmanagedpercentplanningprogramprojectspublicrevenue
SHARED TOKENS (25): "acquisition", "administration", "airport", "american", "aviation", "commercial", "costs", "federal", "general", "grant", "grants", "land", "lighting", "managed", "percent", "planning", "program", "projects", "public", "revenue".... | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamonganotherboisecanyoncapacitycapitalcentercitiesconventionalcostsdestinationeagleearlyemployerenvironmentalfederalfield
SHARED TOKENS (72): "ada", "additional", "agencies", "among", "another", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "costs", "destination", "eagle", "early", "employer", "environmental", "federal", "field".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.610
agencycreatedcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepresentpublicstatewide
SHARED TOKENS (13): "agency", "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
🌿 BRANCH153 edges
0.500
anotherappearapplicationapplicationsconsumercontrolledcreateddatadescribesdesignfrequentlyhistorylimitedmanagementmatchingmedianeedsoperatingpartlyparts
SHARED TOKENS (35): "another", "appear", "application", "applications", "consumer", "controlled", "created", "data", "describes", "design", "frequently", "history", "limited", "management", "matching", "media", "needs", "operating", "partly", "parts".... | EXACT TITLE in photography: "Color management".
0.500
anothercapabledigitaldisplaysformhistoricalinformationlightmarketsmediamethodpresentrecordrecordsshowingsingleuses
SHARED TOKENS (17): "another", "capable", "digital", "displays", "form", "historical", "information", "light", "markets", "media", "method", "present", "record", "records", "showing", "single", "uses". | EXACT TITLE in photography: "Color photography".
0.500
License ↗ Q79719 EXACT TITLE
activityamericananotherbeyondbusinessconditionsdocumentengageextendsfeegovernmentgrantitselflandleaselegallicenselicensedlicenseslicensing
SHARED TOKENS (43): "activity", "american", "another", "beyond", "business", "conditions", "document", "engage", "extends", "fee", "government", "grant", "itself", "land", "lease", "legal", "license", "licensed", "licenses", "licensing".... | EXACT TITLE in transportation_infrastructure: "License". | EXACT TITLE in photography: "License".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscontactcreatecreatingdigitaldirectelectricalforminsidelaterlightmanufacturingmaterialmethodoperatespracticeprocessingproduceproduces
SHARED TOKENS (26): "application", "business", "contact", "create", "creating", "digital", "direct", "electrical", "form", "inside", "later", "light", "manufacturing", "material", "method", "operates", "practice", "processing", "produce", "produces".... | EXACT TITLE in photography: "Photography".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingembeddedfrequentlyitselfmaterialnaturalneedpedestrianplacingpracticeprocessrequirementsshapestructuretrafficvehiclewater
SHARED TOKENS (17): "allowing", "embedded", "frequently", "itself", "material", "natural", "need", "pedestrian", "placing", "practice", "process", "requirements", "shape", "structure", "traffic", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
associationcorridorscreatedenvironmentalespeciallyfrequentlyindustriallandlandscapemultipleparkparkspeoplerecreationalrightsservesurban
SHARED TOKENS (17): "association", "corridors", "created", "environmental", "especially", "frequently", "industrial", "land", "landscape", "multiple", "park", "parks", "people", "recreational", "rights", "serves", "urban". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
accessagencyestablishedhistoricalidahomaintainsmaterialofficeofficialplacespreservationprogrampublicrecordsreferencesitessociety
SHARED TOKENS (17): "access", "agency", "established", "historical", "idaho", "maintains", "material", "office", "official", "places", "preservation", "program", "public", "records", "reference", "sites", "society". | EXACT TITLE in photography: "Idaho State Historical Society".
0.500
airportaviationcanyonconstructionemergencyfaageneralhomeidahoindustrialintegratedmilitarymissionmountainmunicipalnampanationalprivatepublicriver
SHARED TOKENS (22): "airport", "aviation", "canyon", "construction", "emergency", "faa", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "mountain", "municipal", "nampa", "national", "private", "public", "river".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
Darkroom ↗ Q601413 EXACT TITLE
applicationsassociatedcollegecontainingcontroldevelopmentdigitalearlyequipmentinspectionlatermaterialsprocessprocessingprofessionalschoolsspacetechnologythoughwater
SHARED TOKENS (20): "applications", "associated", "college", "containing", "control", "development", "digital", "early", "equipment", "inspection", "later", "materials", "process", "processing", "professional", "schools", "space", "technology", "though", "water". | EXACT TITLE in photography: "Darkroom".
0.500
Copyright ↗ Q1297822 EXACT TITLE
agreementsamongapplicablebeyondcertaincompletedcontrolextendformformalgroupitselfjurisdictionslargelawlegallicenselimitedmultiplenational
SHARED TOKENS (32): "agreements", "among", "applicable", "beyond", "certain", "completed", "control", "extend", "form", "formal", "group", "itself", "jurisdictions", "large", "law", "legal", "license", "limited", "multiple", "national".... | EXACT TITLE in photography: "Copyright".
0.500
applicablebuildingcentercommercialconsumersdedicateddeliverydirectlyequipmentfacilityfirmshandlinginventorylaborlargemarketnetworkoperateoperatesoperation
SHARED TOKENS (33): "applicable", "building", "center", "commercial", "consumers", "dedicated", "delivery", "directly", "equipment", "facility", "firms", "handling", "inventory", "labor", "large", "market", "network", "operate", "operates", "operation".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Freelancer ↗ Q215279 EXACT TITLE
agencyclassescontractordesigneconomyemployeremploymentindependentlaborlong-termparticipationproductionprofessionalrepresentedtaxtemporarytermsworkworkers
SHARED TOKENS (19): "agency", "classes", "contractor", "design", "economy", "employer", "employment", "independent", "labor", "long-term", "participation", "production", "professional", "represented", "tax", "temporary", "terms", "work", "workers". | EXACT TITLE in photography: "Freelancer".
0.500
advertisinganotherappliesbusinesscommercialcommerciallyconditionscontentcreatedirectevenformgenerallaterlegalliabilitylicenselicensesmakingmaterial
SHARED TOKENS (45): "advertising", "another", "applies", "business", "commercial", "commercially", "conditions", "content", "create", "direct", "even", "form", "general", "later", "legal", "liability", "license", "licenses", "making", "material".... | EXACT TITLE in photography: "Model release".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingbuildingscertaindensitydevelopmentdiffersformgoverngovernmentgrowthguidelinesindustriallandland-uselocalmethodpermissionplacesplanning
SHARED TOKENS (33): "allowing", "building", "buildings", "certain", "density", "development", "differs", "form", "govern", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "method", "permission", "places", "planning".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in photography: "Zoning".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessacquisitionalreadyamericanamongapproximatelybecomebeyondbusinesscapitalcontentcreatedesigndevelopmenteventsfinancingfirmshandlinginformationlist
SHARED TOKENS (33): "access", "acquisition", "already", "american", "among", "approximately", "become", "beyond", "business", "capital", "content", "create", "design", "development", "events", "financing", "firms", "handling", "information", "list".... | EXACT TITLE in photography: "LinkedIn".
0.500
accesscontinuingcreatedfederalfederallyformationfuturegovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplanspopulationprocessprogramsprojects
SHARED TOKENS (24): "access", "continuing", "created", "federal", "federally", "formation", "future", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans", "population", "process", "programs", "projects".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
agencyappliedbecomebuiltdeliverydepartmentdevelopmentestablishedfederalgovernmentirrigationlawmanagementoperationpeopleproduceprogramprojectsprovidingprovisions
SHARED TOKENS (26): "agency", "applied", "become", "built", "delivery", "department", "development", "established", "federal", "government", "irrigation", "law", "management", "operation", "people", "produce", "program", "projects", "providing", "provisions".... | EXACT TITLE in photography: "Bureau of Reclamation".
0.500
broadercertaincitiescoveringdevelopmentenvironmentalgrowthindividualindustrialinfrastructurelandland-usemanagementmilitarynationalneedsnetworkplacementplanningplans
SHARED TOKENS (35): "broader", "certain", "cities", "covering", "development", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "management", "military", "national", "needs", "network", "placement", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescommunitycomposedconditionscreateddevelopmentdistincteconomyelectricalemergencyenforcementenvironmentenvironmentalespeciallyfacilitiesfirmsfrequentlygeneralindustrial
SHARED TOKENS (43): "access", "agencies", "community", "composed", "conditions", "created", "development", "distinct", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "especially", "facilities", "firms", "frequently", "general", "industrial".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in photography: "Infrastructure".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdevelopmentemergingenvironmentenvironmentalgrowthimpactslimitedlocalmarketsorganizationorganizationspeopleplacespracticesprograms
SHARED TOKENS (30): "activity", "beyond", "business", "commercial", "communities", "development", "emerging", "environment", "environmental", "growth", "impacts", "limited", "local", "markets", "organization", "organizations", "people", "places", "practices", "programs".... | EXACT TITLE in transportation_infrastructure: "Tourism". | EXACT TITLE in photography: "Tourism".
0.500
agriculturalconcernsdevelopmentdirectenvironmentenvironmentalestimatesgroupgrowthimpactindividuallimitedmedicalnaturalpeoplepolicypopulationprocessprojectsrate
SHARED TOKENS (25): "agricultural", "concerns", "development", "direct", "environment", "environmental", "estimates", "group", "growth", "impact", "individual", "limited", "medical", "natural", "people", "policy", "population", "process", "projects", "rate".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in photography: "Population growth".
0.500
advancedapplicationscategorycombinedconsumercontainingconventionalcreateddigitalearlyembeddedfasterfieldfilesformfunctionsfurtherhistoryinterfacelater
SHARED TOKENS (38): "advanced", "applications", "category", "combined", "consumer", "containing", "conventional", "created", "digital", "early", "embedded", "faster", "field", "files", "form", "functions", "further", "history", "interface", "later".... | EXACT TITLE in photography: "Digital photography".
0.500
americanapplicableappliedassociationcitiescommunitiescommunityconditionscostscreatingdependsdesigndevelopmentdistrictsenvironmentalfacilitiesfurtherfuturejurisdictionsland
SHARED TOKENS (36): "american", "applicable", "applied", "association", "cities", "communities", "community", "conditions", "costs", "creating", "depends", "design", "development", "districts", "environmental", "facilities", "further", "future", "jurisdictions", "land".... | EXACT TITLE in photography: "Land-use planning".
0.500
Metadata ↗ Q180160 EXACT TITLE
accessallowinganalysisarchiveassetcontextcreatedatadescribesdescribingdigitaldocumentfilesfunctionsgovernmenthistoryhtmlidentificationidentifyinginformation
SHARED TOKENS (32): "access", "allowing", "analysis", "archive", "asset", "context", "create", "data", "describes", "describing", "digital", "document", "files", "functions", "government", "history", "html", "identification", "identifying", "information".... | EXACT TITLE in photography: "Metadata".
0.500
Architecture ↗ Q12271 EXACT TITLE
accordingarchitecturebuildingbuildingscivicclassesconstructiondesignengineersespeciallyfieldformfurtherhistoricalidentifieditselflaterlocalmaterialmaterials
SHARED TOKENS (31): "according", "architecture", "building", "buildings", "civic", "classes", "construction", "design", "engineers", "especially", "field", "form", "further", "historical", "identified", "itself", "later", "local", "material", "materials".... | EXACT TITLE in transportation_infrastructure: "Architecture". | EXACT TITLE in photography: "Architecture".
0.500
certificationcompetenceemployerextendfieldformallaborlicensepeopleperiodpermanentplacementpracticepractitionersprofessionalregulatedsectorsstudysystemtraining
SHARED TOKENS (20): "certification", "competence", "employer", "extend", "field", "formal", "labor", "license", "people", "period", "permanent", "placement", "practice", "practitioners", "professional", "regulated", "sectors", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmentespeciallyfrequentlygrowthhistoricallyindividualinfrastructurelocalmarketpeoplepoliciespolicyprocessqualityregiontermswest
SHARED TOKENS (20): "according", "community", "describes", "development", "especially", "frequently", "growth", "historically", "individual", "infrastructure", "local", "market", "people", "policies", "policy", "process", "quality", "region", "terms", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
approximatelyfeetfieldhomeidahoitselflargemountainparkpreservationpublicrecreationsitesmallvisiblewestern
SHARED TOKENS (16): "approximately", "feet", "field", "home", "idaho", "itself", "large", "mountain", "park", "preservation", "public", "recreation", "site", "small", "visible", "western". | EXACT TITLE in photography: "Bruneau Dunes State Park".
0.500
chainchainsconsumerconsumerscreatingdirectdirectlyfacilitiesindependentmanagementmaterialsnetworkproductproductsstructuresupplierssystemsystemsthemvalue
SHARED TOKENS (20): "chain", "chains", "consumer", "consumers", "creating", "direct", "directly", "facilities", "independent", "management", "materials", "network", "product", "products", "structure", "suppliers", "system", "systems", "them", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
beyondboiseconnectsdedicatedeagleextendsgreenbeltidahomunicipalitiesparkspartspermitprovidingrecreationalresidentialriverroutessystemtrailtransportation
SHARED TOKENS (23): "beyond", "boise", "connects", "dedicated", "eagle", "extends", "greenbelt", "idaho", "municipalities", "parks", "parts", "permit", "providing", "recreational", "residential", "river", "routes", "system", "trail", "transportation".... | EXACT TITLE in transportation_infrastructure: "Boise River Greenbelt".
0.500
acquiredacquisitionsadditionalaircraftbrandextendsformformationhistoryindependentlatermajornetworkoperatesoperatingprincipalregionalroutestar
SHARED TOKENS (19): "acquired", "acquisitions", "additional", "aircraft", "brand", "extends", "form", "formation", "history", "independent", "later", "major", "network", "operates", "operating", "principal", "regional", "route", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
accessibilityagenciesagencyamericanavoidbusinessesconditionscoordinationcurrentdatadepartmentfederalfieldgovernmentlaborlocalmajormanagementneedoffice
SHARED TOKENS (30): "accessibility", "agencies", "agency", "american", "avoid", "businesses", "conditions", "coordination", "current", "data", "department", "federal", "field", "government", "labor", "local", "major", "management", "need", "office".... | EXACT TITLE in photography: "Bureau of Labor Statistics".
0.500
administrationagencyaircraftairportapproximatelycertaincombinedconnectingcreateddatadepartmentenforcementfacilitiesfederalgovernmentidentificationlawlocalmissionoperated
SHARED TOKENS (33): "administration", "agency", "aircraft", "airport", "approximately", "certain", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "government", "identification", "law", "local", "mission", "operated".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincollectioncostsdedicatedequipmentfacilityfieldfoodinformationmanagedmanagementmaterialmaterialsmilitarymodelmovingneedsoperational
SHARED TOKENS (30): "according", "another", "chain", "collection", "costs", "dedicated", "equipment", "facility", "field", "food", "information", "managed", "management", "material", "materials", "military", "model", "moving", "needs", "operational".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentfederalfinancialfunctionsgovernmentgrantslightlocalofficeoperateoperatorspeopleprogramsprovidersprovidingpublic
SHARED TOKENS (27): "administration", "agencies", "agency", "assistance", "department", "federal", "financial", "functions", "government", "grants", "light", "local", "office", "operate", "operators", "people", "programs", "providers", "providing", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbodybroaderbuildingscanalscapitalcategorycommunityconstructiondirectlyelectricalemploymentenvironmentalfacilitiesgovernmenthospitalsinfrastructurelong-termmunicipaloperator
SHARED TOKENS (34): "assets", "body", "broader", "buildings", "canals", "capital", "category", "community", "construction", "directly", "electrical", "employment", "environmental", "facilities", "government", "hospitals", "infrastructure", "long-term", "municipal", "operator".... | EXACT TITLE in transportation_infrastructure: "Public works". | EXACT TITLE in photography: "Public works".
0.500
builtconnectedcurrentdirectlyequipmentitselflargelightmeaningmovingneedsproducesprofessionalqualityseparatesignalstandardizeduses
SHARED TOKENS (18): "built", "connected", "current", "directly", "equipment", "itself", "large", "light", "meaning", "moving", "needs", "produces", "professional", "quality", "separate", "signal", "standardized", "uses". | EXACT TITLE in transportation_infrastructure: "Flash (photography)". | EXACT TITLE in photography: "Flash (photography)".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbuildingsbusinesscommercialentityestategeneralgovernmentlandlawlegalnaturalownedownershipprivatepropertypublicrealresidentialterms
SHARED TOKENS (22): "acquisition", "buildings", "business", "commercial", "entity", "estate", "general", "government", "land", "law", "legal", "natural", "owned", "ownership", "private", "property", "public", "real", "residential", "terms".... | EXACT TITLE in transportation_infrastructure: "Real estate". | EXACT TITLE in photography: "Real estate".
0.500
accessallowingassociationcontractingcoordinationcorridorscostsdesignateddevelopmentestatefinancialfixedfrequentlygeneralgovernmenthistoricalinfrastructureintegratedlightlocal
SHARED TOKENS (49): "access", "allowing", "association", "contracting", "coordination", "corridors", "costs", "designated", "development", "estate", "financial", "fixed", "frequently", "general", "government", "historical", "infrastructure", "integrated", "light", "local".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
appliedconstructioncontextcontrolequipmentfrequentlyfunctionsindustrialinformationinvolvinglaborlargemobileoperationspeoplesourcestructuresystemsusesvehicles
SHARED TOKENS (20): "applied", "construction", "context", "control", "equipment", "frequently", "functions", "industrial", "information", "involving", "labor", "large", "mobile", "operations", "people", "source", "structure", "systems", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcitiescreatingdesignatedearlyhistoricallynetworkpedestrianpeopleprofessionalrecordsafetyspeedtrafficurbanvehicleswider
SHARED TOKENS (18): "american", "associated", "cities", "creating", "designated", "early", "historically", "network", "pedestrian", "people", "professional", "record", "safety", "speed", "traffic", "urban", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian". | EXACT TITLE in photography: "Pedestrian".
0.500
departmentfacilitiesfederalidentifiedindividuallocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningsafetyservingsystemtransportation
SHARED TOKENS (18): "department", "facilities", "federal", "identified", "individual", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingamericancertaincitiesconsolidatedcountiesdistrictsformfurthergovernmentindependentlawlegallylocallocallymultiplemunicipalitiesplacespopulationproviding
SHARED TOKENS (25): "according", "american", "certain", "cities", "consolidated", "counties", "districts", "form", "further", "government", "independent", "law", "legally", "local", "locally", "multiple", "municipalities", "places", "population", "providing".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in photography: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscommunicationsconstructiondesignateddevelopmentdigitalenvironmentequipmentestablishgovernmenthistorylandlawlegalownershipplanningpointsprofessionalpropertyresearch
SHARED TOKENS (24): "analysis", "communications", "construction", "designated", "development", "digital", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "ownership", "planning", "points", "professional", "property", "research".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Contract ↗ Q93288 EXACT TITLE
agreementsapplyboundarybusinesscategorycertaincodecommercialcontractingcontractsdistinctdocumentenforcementeventfieldframeworkfuturegeneralgovernedindependent
SHARED TOKENS (37): "agreements", "apply", "boundary", "business", "category", "certain", "code", "commercial", "contracting", "contracts", "distinct", "document", "enforcement", "event", "field", "framework", "future", "general", "governed", "independent".... | EXACT TITLE in transportation_infrastructure: "Contract". | EXACT TITLE in photography: "Contract".
0.500
accessibilityadministrationanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescodescommunicationscommunitiescommunitycreatingdesigndevelopingdevelopment
SHARED TOKENS (58): "accessibility", "administration", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "codes", "communications", "communities", "community", "creating", "design", "developing", "development".... | EXACT TITLE in photography: "Urban planning".
0.500
advertisingapplicableappliedbusinessbusinessescategorydirectoriesdirectorylocalnationalpagesratherregisteredsystemthough
SHARED TOKENS (15): "advertising", "applicable", "applied", "business", "businesses", "category", "directories", "directory", "local", "national", "pages", "rather", "registered", "system", "though". | EXACT TITLE in photography: "Yellow pages".
0.500
administrationagenciesagencyassistancecreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramspublicresearchrightssafetytransportation
SHARED TOKENS (20): "administration", "agencies", "agency", "assistance", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "public", "research", "rights", "safety", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
E-commerce ↗ Q484847 EXACT TITLE
businesschaincollectioncommercecommercialdatainventorymanagementmarketingmobileplatformsprocessingproductsretailsystemstransaction
SHARED TOKENS (16): "business", "chain", "collection", "commerce", "commercial", "data", "inventory", "management", "marketing", "mobile", "platforms", "processing", "products", "retail", "systems", "transaction". | EXACT TITLE in photography: "E-commerce".
0.500
addressingagencyassistancecodifiedcontrolcoordinationdirectlyengineersenvironmentalfederalformgoverninginvolvinglawmajorownedpartsphysicalprovidingprovisions
SHARED TOKENS (27): "addressing", "agency", "assistance", "codified", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "major", "owned", "parts", "physical", "providing", "provisions".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbridgebuiltcommunityconnectingconnectionconstructioncreatedesignearlyengineersenvironmentfrequentlyimpactsindustriallocalmajormethodnetworkpermitted
SHARED TOKENS (33): "allowing", "bridge", "built", "community", "connecting", "connection", "construction", "create", "design", "early", "engineers", "environment", "frequently", "impacts", "industrial", "local", "major", "method", "network", "permitted".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in photography: "Bridge".
0.500
alreadyannouncedcombinedcommercialcommerciallydevelopmentdigitaldiscoveryevenformhistorylightmakingmanagedmaterialsmediaminutesmultiplenaturalordinary
SHARED TOKENS (31): "already", "announced", "combined", "commercial", "commercially", "development", "digital", "discovery", "even", "form", "history", "light", "making", "managed", "materials", "media", "minutes", "multiple", "natural", "ordinary".... | EXACT TITLE in photography: "History of photography".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescollectionconditionsconsolidationcontrolcontrolleddirectlydischargedistributeddownstreamenvironmentalfieldformfullgrowthimprovementsirrigation
SHARED TOKENS (43): "agricultural", "agriculture", "application", "applies", "collection", "conditions", "consolidation", "control", "controlled", "directly", "discharge", "distributed", "downstream", "environmental", "field", "form", "full", "growth", "improvements", "irrigation".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in photography: "Irrigation".
0.500
accessallowingcommunicationsdatadevelopersdevelopmentdigitalearlyelectricalformfurtherindependentindividualinformationmediaphysicalsignalssingletechnology
SHARED TOKENS (19): "access", "allowing", "communications", "data", "developers", "development", "digital", "early", "electrical", "form", "further", "independent", "individual", "information", "media", "physical", "signals", "single", "technology". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Airspace ↗ Q272730 EXACT TITLE
airspaceaviationboundaryclassificationcontrolcontrolledenforcementestablishedfaaguidelinesinformationlegalmanagementmilitarynationaloperationsorganizationregulatoryrulesspace
SHARED TOKENS (24): "airspace", "aviation", "boundary", "classification", "control", "controlled", "enforcement", "established", "faa", "guidelines", "information", "legal", "management", "military", "national", "operations", "organization", "regulatory", "rules", "space".... | EXACT TITLE in transportation_infrastructure: "Airspace". | EXACT TITLE in photography: "Airspace".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessescitiesdirectlyfacilityindustriallargemanufacturersmanufacturingmaterialsmovingparkspartsproductionstandard
SHARED TOKENS (18): "agriculture", "associated", "building", "buildings", "businesses", "cities", "directly", "facility", "industrial", "large", "manufacturers", "manufacturing", "materials", "moving", "parks", "parts", "production", "standard". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
agenciesbuildingsbuiltcanalsconstructiondepartmentsdesigndistinguishenvironmentfirmsgovernmentinfrastructurelocallymilitarymunicipalnationalphysicalplaceprivateprofessional
SHARED TOKENS (24): "agencies", "buildings", "built", "canals", "construction", "departments", "design", "distinguish", "environment", "firms", "government", "infrastructure", "locally", "military", "municipal", "national", "physical", "place", "private", "professional".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyboardbusinessdirectlyfederallimitedmanagedmetropolitannationalnetworkoperateoperatesoperatororganizationownedpartsrevenueroutes
SHARED TOKENS (23): "additional", "american", "approximately", "board", "business", "directly", "federal", "limited", "managed", "metropolitan", "national", "network", "operate", "operates", "operator", "organization", "owned", "parts", "revenue", "routes".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
activitybusinesscontractoremployeremploymentevenindependentindividualissueneedsoperatepartnershippeopleplacingratherrealrelationshiptaxthereforeview
SHARED TOKENS (21): "activity", "business", "contractor", "employer", "employment", "even", "independent", "individual", "issue", "needs", "operate", "partnership", "people", "placing", "rather", "real", "relationship", "tax", "therefore", "view".... | EXACT TITLE in photography: "Self-employment".
0.500
bodybuildingchaindocumentsgeneralgovernmentinformationlibrarymaintainsofficeownershippartspublicrecordsregistrationroleservingworks
SHARED TOKENS (18): "body", "building", "chain", "documents", "general", "government", "information", "library", "maintains", "office", "ownership", "parts", "public", "records", "registration", "role", "serving", "works". | EXACT TITLE in photography: "United States Copyright Office".
0.500
JCPenney ↗ Q920037 EXACT TITLE
americanchaincombineddepartmentdepartmentsdowntownearlyformgrouphomelaterlegallymanagedoperatorsownedownershipportfolioproductspropertyretail
SHARED TOKENS (21): "american", "chain", "combined", "department", "departments", "downtown", "early", "form", "group", "home", "later", "legally", "managed", "operators", "owned", "ownership", "portfolio", "products", "property", "retail".... | EXACT TITLE in photography: "JCPenney".
0.500
agenciesapplybusinessesdesignfacilitiesfuturegovernmentimpactsmoveneedspeopleplannersplanningpoliciesprivateprocesspublicsystemtransportation
SHARED TOKENS (19): "agencies", "apply", "businesses", "design", "facilities", "future", "government", "impacts", "move", "needs", "people", "planners", "planning", "policies", "private", "process", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Camera ↗ Q15328 EXACT TITLE
consumercontentcontrolcreatesdedicateddevelopmentdigitalearlyhistoricallylightmaterialmediamodelsmultipleprofessionalresearchroleseparatesignificantsociety
SHARED TOKENS (26): "consumer", "content", "control", "creates", "dedicated", "development", "digital", "early", "historically", "light", "material", "media", "models", "multiple", "professional", "research", "role", "separate", "significant", "society".... | EXACT TITLE in photography: "Camera".
0.500
accessagenciesbeyondcitiescommunitydestinationdevelopingdischargeextendsfixedformformalgovernmentlocalmetropolitanoperateoperatedoperatesoperatorsorganizations
SHARED TOKENS (35): "access", "agencies", "beyond", "cities", "community", "destination", "developing", "discharge", "extends", "fixed", "form", "formal", "government", "local", "metropolitan", "operate", "operated", "operates", "operators", "organizations".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.440
Road ↗ Q34442 EXACT TITLE
accessanotherdesignlandlocalplaceprivatepublicroutetrafficurbanwhose
SHARED TOKENS (12): "access", "another", "design", "land", "local", "place", "private", "public", "route", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in photography: "Road".
0.440
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadigitalfasterintegratednetworkrequirementssignalsspeedtechnologyuses
SHARED TOKENS (12): "access", "context", "data", "digital", "faster", "integrated", "network", "requirements", "signals", "speed", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.440
administrationagencydepartmentfederalmajorofficepreviouslyprogramprogramspublicroletransportation
SHARED TOKENS (12): "administration", "agency", "department", "federal", "major", "office", "previously", "program", "programs", "public", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.420
americandiffersfieldintersectionpermitroutesstandardsystemthoughtrafficuses
SHARED TOKENS (11): "american", "differs", "field", "intersection", "permit", "routes", "standard", "system", "though", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in photography: "Interchange (road)".
0.420
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbodycontroldischargefrequentlyincreasinglandriverurbanvalleywater
SHARED TOKENS (11): "agricultural", "body", "control", "discharge", "frequently", "increasing", "land", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.420
Shutterfly ↗ Q7505672 EXACT TITLE
acquiredamericanbusinessmanagementmobileownedownershipprivateproductspublicsharing
SHARED TOKENS (11): "acquired", "american", "business", "management", "mobile", "owned", "ownership", "private", "products", "public", "sharing". | EXACT TITLE in photography: "Shutterfly".
0.420
businesscommercialeventsfrequentlygrouplightingpeopleschoolsitesubjecttoward
SHARED TOKENS (11): "business", "commercial", "events", "frequently", "group", "lighting", "people", "school", "site", "subject", "toward". | EXACT TITLE in photography: "Portrait photography".
0.400
analysisapproximatelydatadescribingdevelopmentexplicitlyfieldframeworkminingstudy
SHARED TOKENS (10): "analysis", "approximately", "data", "describing", "development", "explicitly", "field", "framework", "mining", "study". | EXACT TITLE in photography: "Machine learning".
0.400
designintersectionjurisdictionsmajorpracticeseparatespecifiedtrafficusesvehicles
SHARED TOKENS (10): "design", "intersection", "jurisdictions", "major", "practice", "separate", "specified", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in photography: "Intersection (road)".
0.400
Sales tax ↗ Q11055488 EXACT TITLE
bodycertaincollectconsumerdirectlyeducationfoodgoverningsalestax
SHARED TOKENS (10): "body", "certain", "collect", "consumer", "directly", "education", "food", "governing", "sales", "tax". | EXACT TITLE in transportation_infrastructure: "Sales tax". | EXACT TITLE in photography: "Sales tax".
0.400
Snowplow ↗ Q14976 EXACT TITLE
especiallyfrequentlylargeoutdoorreceiveservingspecifictransportationvehiclevehicles
SHARED TOKENS (10): "especially", "frequently", "large", "outdoor", "receive", "serving", "specific", "transportation", "vehicle", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
advertisingagenciesapplicationassociationbrandcannotdedicatedmajorprofessionalwork
SHARED TOKENS (10): "advertising", "agencies", "application", "association", "brand", "cannot", "dedicated", "major", "professional", "work". | EXACT TITLE in photography: "Sports photography".
0.400
Yearbook ↗ Q9311446 EXACT TITLE
annualcollegedocumentingeventsmediapagephysicalrecordschoolschools
SHARED TOKENS (10): "annual", "college", "documenting", "events", "media", "page", "physical", "record", "school", "schools". | EXACT TITLE in photography: "Yearbook".
0.380
buildingsbuiltcitiesdevelopmentenvironmenthistoricalmaintainspreservationproducts
SHARED TOKENS (9): "buildings", "built", "cities", "development", "environment", "historical", "maintains", "preservation", "products". | EXACT TITLE in photography: "Historic preservation".
0.380
Lifetouch ↗ Q6545544 EXACT TITLE
americanfacilitiesmedianationaloperatesoperationsplacesschoolschools
SHARED TOKENS (9): "american", "facilities", "media", "national", "operates", "operations", "places", "school", "schools". | EXACT TITLE in photography: "Lifetouch".
0.380
boisebusinessesidahooperatesownedplanningpropertyretailwestern
SHARED TOKENS (9): "boise", "businesses", "idaho", "operates", "owned", "planning", "property", "retail", "western". | EXACT TITLE in photography: "Boise Towne Square".
0.380
documentingequipmentfieldknowledgenaturalneedrequirerequiresrequiring
SHARED TOKENS (9): "documenting", "equipment", "field", "knowledge", "natural", "need", "require", "requires", "requiring". | EXACT TITLE in photography: "Wildlife photography".
0.360
advertisingamongcommercialcreatefoodinvolvingmediaprofessional
SHARED TOKENS (8): "advertising", "among", "commercial", "create", "food", "involving", "media", "professional". | EXACT TITLE in photography: "Food photography".
0.360
Jostens ↗ Q6291141 EXACT TITLE
academicamericanfacilitiesoperationalparksproductionproductsschools
SHARED TOKENS (8): "academic", "american", "facilities", "operational", "parks", "production", "products", "schools". | EXACT TITLE in photography: "Jostens".
0.360
aircraftfixedoperatedplatformsproducestructuresvehiclesview
SHARED TOKENS (8): "aircraft", "fixed", "operated", "platforms", "produce", "structures", "vehicles", "view". | EXACT TITLE in photography: "Aerial photography".
0.360
Use tax ↗ Q17155766 EXACT TITLE
appliedproductpropertysalesstoragesubjecttaxtaxes
SHARED TOKENS (8): "applied", "product", "property", "sales", "storage", "subject", "tax", "taxes". | EXACT TITLE in photography: "Use tax".
0.340
Utility ↗ Q466707 EXACT TITLE
amongcertaincontextdistinctfunctionsrelationshipsource
SHARED TOKENS (7): "among", "certain", "context", "distinct", "functions", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.340
commercialcreatedeventsproductsratherspecificvisual
SHARED TOKENS (7): "commercial", "created", "events", "products", "rather", "specific", "visual". | EXACT TITLE in photography: "Fine-art photography".
0.340
Sidewalk ↗ Q177749 EXACT TITLE
americanbuildingslandpedestrianprivatesidevehicle
SHARED TOKENS (7): "american", "buildings", "land", "pedestrian", "private", "side", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurbanwestern
SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River". | EXACT TITLE in photography: "Boise River".
0.320
Cyclorama ↗ Q1147753 EXACT TITLE
buildinginsideplaceplatformshowview
SHARED TOKENS (6): "building", "inside", "place", "platform", "show", "view". | EXACT TITLE in photography: "Cyclorama".
0.320
agenciesdocumentsgovernmentinformationpublicrecords
SHARED TOKENS (6): "agencies", "documents", "government", "information", "public", "records". | EXACT TITLE in photography: "Public records".
0.320
boiseexpansionidahooperatingroutethough
SHARED TOKENS (6): "boise", "expansion", "idaho", "operating", "route", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.300
applieddigitalestablishedincreasinglightlimitedmakingmediaorganizationsproductsrecordsalesstatedusesvisible
SHARED TOKENS (15): "applied", "digital", "established", "increasing", "light", "limited", "making", "media", "organizations", "products", "record", "sales", "stated", "uses", "visible".
0.300
accesschaincostsdestinationdirectespeciallygeneralgroupitselfmaterialmovingoperatingpracticepracticesregionspecializedtransportation
SHARED TOKENS (17): "access", "chain", "costs", "destination", "direct", "especially", "general", "group", "itself", "material", "moving", "operating", "practice", "practices", "region", "specialized", "transportation".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcitiescommercialcostsdensedensitydevelopmentenvironmentenvironmentalexpansionformgrowthindustrialinfrastructurelacklandlarge
SHARED TOKENS (36): "agency", "associated", "become", "building", "cities", "commercial", "costs", "dense", "density", "development", "environment", "environmental", "expansion", "form", "growth", "industrial", "infrastructure", "lack", "land", "large"....
0.300
activityapplyconstructioncontextdatadigitaleventforminformationmedicalmodelsmultipleprocessingproducerealsystemsvisual
SHARED TOKENS (17): "activity", "apply", "construction", "context", "data", "digital", "event", "form", "information", "medical", "models", "multiple", "processing", "produce", "real", "systems", "visual".
0.300
activeadvertisingamongcontentcurrentdatadigitalfirmsgeneralmanagementmarketingmediaplatformspractitionersproductproductspublicratherreviewsscope
SHARED TOKENS (21): "active", "advertising", "among", "content", "current", "data", "digital", "firms", "general", "management", "marketing", "media", "platforms", "practitioners", "product", "products", "public", "rather", "reviews", "scope"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalbrandconditionsdigitalindependentinspectionneedspartsrepairroleshowingspecificvehiclework
SHARED TOKENS (15): "already", "approval", "brand", "conditions", "digital", "independent", "inspection", "needs", "parts", "repair", "role", "showing", "specific", "vehicle", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomedesignengineersenvironmentfullintegrationintersectionmakesneedpedestrianpermittedreducerequireresearchrulessafetysignalssignificantspeed
SHARED TOKENS (25): "associated", "become", "design", "engineers", "environment", "full", "integration", "intersection", "makes", "need", "pedestrian", "permitted", "reduce", "require", "research", "rules", "safety", "signals", "significant", "speed"....
0.300
directlyenvironmenteveneventeventspeopleperiodplacesprojectspropertypublicsecuritythoughtimingurbanvisiblework
SHARED TOKENS (17): "directly", "environment", "even", "event", "events", "people", "period", "places", "projects", "property", "public", "security", "though", "timing", "urban", "visible", "work".
0.300
accordingcreatingfixedformfunctionsmedicalmobileneedsnetworkpeopleprivateprogramspublicratherrelevantrouteroutessharedtechnologyvehicles
SHARED TOKENS (20): "according", "creating", "fixed", "form", "functions", "medical", "mobile", "needs", "network", "people", "private", "programs", "public", "rather", "relevant", "route", "routes", "shared", "technology", "vehicles".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesschargescitiescommunitiesconnectingdistrictsinsidemetropolitanmultipleoperateoperatespricingregionalsystemsurbanzone
SHARED TOKENS (16): "business", "charges", "cities", "communities", "connecting", "districts", "inside", "metropolitan", "multiple", "operate", "operates", "pricing", "regional", "systems", "urban", "zone".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedclassescontrolenforcementeventguidelinesidentifiedimpactoccupationalpedestrianpracticesproduceprovidingpublicremainrequiringsafesafetysidespecific
SHARED TOKENS (27): "applied", "classes", "control", "enforcement", "event", "guidelines", "identified", "impact", "occupational", "pedestrian", "practices", "produce", "providing", "public", "remain", "requiring", "safe", "safety", "side", "specific"....
0.300
associatedbroaderbusinesscapacityclassificationcompliancecontroldedicateddocumenteventualevidencefieldformidentificationinformationinstitutionalmanagementorganizationpermanentpreservation
SHARED TOKENS (26): "associated", "broader", "business", "capacity", "classification", "compliance", "control", "dedicated", "document", "eventual", "evidence", "field", "form", "identification", "information", "institutional", "management", "organization", "permanent", "preservation"....
0.300
buildingbusinesscenterdedicateddensedevelopmentformgrowthintegratedlandlightnetworkplanningprivatepublicrelationshipresidentialscaleservingspace
SHARED TOKENS (21): "building", "business", "center", "dedicated", "dense", "development", "form", "growth", "integrated", "land", "light", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "space"....
0.300
Cloud storage ↗ Q914359 KW CROSS HIGH
applicationapplicationscapacitycontentdataenvironmentinterfaceleasemanagedmanagementmodelmultiplenetworkorganizationorganizationsownedpeoplephysicalprovidersstorage
SHARED TOKENS (21): "application", "applications", "capacity", "content", "data", "environment", "interface", "lease", "managed", "management", "model", "multiple", "network", "organization", "organizations", "owned", "people", "physical", "providers", "storage"....
0.300
becomebuildingscommercialconditionsdocumentationearlyfoodhistorylandlandscapelightmarketnationalnaturalpeopleplaceproductprojectspublicshared
SHARED TOKENS (26): "become", "buildings", "commercial", "conditions", "documentation", "early", "food", "history", "land", "landscape", "light", "market", "national", "natural", "people", "place", "product", "projects", "public", "shared"....
0.300
Olan Mills ↗ Q7083077 EXACT TITLE
americancorporatedirectoriesdirectoryowned
SHARED TOKENS (5): "american", "corporate", "directories", "directory", "owned". | EXACT TITLE in photography: "Olan Mills".
0.300
approximatelycertaincontainingcreatedcreatesdevelopmentdigitaldirectdiscoveryformitselflaterlayerlightmatchingmediaprocessprocessingproducerecord
SHARED TOKENS (30): "approximately", "certain", "containing", "created", "creates", "development", "digital", "direct", "discovery", "form", "itself", "later", "layer", "light", "matching", "media", "process", "processing", "produce", "record"....
0.300
administrationagencyamericananotherbuildingcommercialconstructiondepartmenteconomyeducationenvironmentalfederalgoverninggovernshandlinghomeimprovementsknowledgelandlarge
SHARED TOKENS (45): "administration", "agency", "american", "another", "building", "commercial", "construction", "department", "economy", "education", "environmental", "federal", "governing", "governs", "handling", "home", "improvements", "knowledge", "land", "large"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
abilityaccessaccordingadditionalcarecommunitiesconditionsconstitutecostscoveragedevelopmenteconomyestablishedfacilitiesfinancialfinancinggeneralhealthcarehistoryinformation
SHARED TOKENS (43): "ability", "access", "according", "additional", "care", "communities", "conditions", "constitute", "costs", "coverage", "development", "economy", "established", "facilities", "financial", "financing", "general", "healthcare", "history", "information"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
canalscapablecertaincreatedestatefacilityfullgovernmentlandlegallocaloperateownershippartspeoplephysicalprivaterailroadsrealrights
SHARED TOKENS (29): "canals", "capable", "certain", "created", "estate", "facility", "full", "government", "land", "legal", "local", "operate", "ownership", "parts", "people", "physical", "private", "railroads", "real", "rights"....
0.300
advantagesagricultureapplicationsappliedavoiddatadevelopmentdigitalenvironmentespeciallyfieldformmedicalmilitaryprocessprocessingsignalsystemswider
SHARED TOKENS (19): "advantages", "agriculture", "applications", "applied", "avoid", "data", "development", "digital", "environment", "especially", "field", "form", "medical", "military", "process", "processing", "signal", "systems", "wider".
0.300
businessescategorycertaincreateindividualinformationlandlawlegallimitedownershippeopleperiodplaceproducerspropertyrightssystemsthemthough
SHARED TOKENS (20): "businesses", "category", "certain", "create", "individual", "information", "land", "law", "legal", "limited", "ownership", "people", "period", "place", "producers", "property", "rights", "systems", "them", "though".
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecitiescommunitiescreatecreatescurrentdescribesdevelopingdevelopmenteducationenvironmentalgeographygrowthimpactincreasinginstitutionallackland
SHARED TOKENS (42): "approximately", "architecture", "become", "cities", "communities", "create", "creates", "current", "describes", "developing", "development", "education", "environmental", "geography", "growth", "impact", "increasing", "institutional", "lack", "land"....
0.300
anotherbecomecapacitydensitydepartmentsengagefixedincreasinginteractionplanningpublicroutespeedtraffictransportationurbanvehicles
SHARED TOKENS (17): "another", "become", "capacity", "density", "departments", "engage", "fixed", "increasing", "interaction", "planning", "public", "route", "speed", "traffic", "transportation", "urban", "vehicles".
0.300
Privacy law ↗ Q1247836 KW CROSS HIGH
categorycollectioncommunicationscompliancecontactdatadigitalemergingfinancialgeneralgoverngovernshandlinghomeindividualinformationissuelawmedicalorganizations
SHARED TOKENS (30): "category", "collection", "communications", "compliance", "contact", "data", "digital", "emerging", "financial", "general", "govern", "governs", "handling", "home", "individual", "information", "issue", "law", "medical", "organizations"....
0.300
associationbusinessbusinessescertaincircumstancescorporatedistinctdocumententityformgovernedjurisdictionslegalliabilitylicenselimitedmedicaloperatingoperationsorganization
SHARED TOKENS (34): "association", "business", "businesses", "certain", "circumstances", "corporate", "distinct", "document", "entity", "form", "governed", "jurisdictions", "legal", "liability", "license", "limited", "medical", "operating", "operations", "organization"....
0.300
americancapacitycapitalcitiesconnectingconventionalcorridorsdedicateddesignlightnetworkpublicqualityreducereliabilitysinglespeedsystemsystemstraffic
SHARED TOKENS (21): "american", "capacity", "capital", "cities", "connecting", "conventional", "corridors", "dedicated", "design", "light", "network", "public", "quality", "reduce", "reliability", "single", "speed", "system", "systems", "traffic"....
0.300
accordingappliedcompletiondatadigitalfieldinformationlightlistmanagementmodelsneedprocessingproducereducesubjectsystems
SHARED TOKENS (17): "according", "applied", "completion", "data", "digital", "field", "information", "light", "list", "management", "models", "need", "processing", "produce", "reduce", "subject", "systems".
0.300
Camera trap ↗ Q1723004 KW CROSS HIGH
activeamongapplicationsbecomecommercialdevelopmentearlyequipmentfieldimprovementslightmarketmethodpopulationpresentqualityresearchrolestructuresstudies
SHARED TOKENS (21): "active", "among", "applications", "become", "commercial", "development", "early", "equipment", "field", "improvements", "light", "market", "method", "population", "present", "quality", "research", "role", "structures", "studies"....
0.300
accidentadvancedapplicationappliedcapacitycollectionconditionsemergencyfieldinformationinfrastructuremanagementreducesafetyspeedsystemsystemstechnologytraffictransportation
SHARED TOKENS (21): "accident", "advanced", "application", "applied", "capacity", "collection", "conditions", "emergency", "field", "information", "infrastructure", "management", "reduce", "safety", "speed", "system", "systems", "technology", "traffic", "transportation"....
0.300
americanassistancecombinedcreateddesignatedespeciallyevenfacilitiesgovernintersectionjurisdictionslargepedestrianplacepointsrulessafetyschoolseparatesignals
SHARED TOKENS (24): "american", "assistance", "combined", "created", "designated", "especially", "even", "facilities", "govern", "intersection", "jurisdictions", "large", "pedestrian", "place", "points", "rules", "safety", "school", "separate", "signals"....
0.300
administrationaircraftaviationcodecommercialdesignfaafederalgeneralgoverninglightingmodeloperationspilotpilotspublicregulatedrulessafespace
SHARED TOKENS (23): "administration", "aircraft", "aviation", "code", "commercial", "design", "faa", "federal", "general", "governing", "lighting", "model", "operations", "pilot", "pilots", "public", "regulated", "rules", "safe", "space"....
0.300
appliedappliesapprovalassociationcontextdevelopmentdocumentationenvironmentalgovernedidentifyingimpactimpactsjustifylightmajormakingmanagementmoveparticipationplans
SHARED TOKENS (34): "applied", "applies", "approval", "association", "context", "development", "documentation", "environmental", "governed", "identifying", "impact", "impacts", "justify", "light", "major", "making", "management", "move", "participation", "plans"....
0.300
accessadvancedamericanbuiltcapacitycitiescompletedconnectconnectedconnectingcontainingevenincreasinglimitsnetworkparkingpedestrianplanspropertyregulated
SHARED TOKENS (33): "access", "advanced", "american", "built", "capacity", "cities", "completed", "connect", "connected", "connecting", "containing", "even", "increasing", "limits", "network", "parking", "pedestrian", "plans", "property", "regulated"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralidahointersectionmajornationalnorthwestofficialpacificparkriverrouteruleswestwestern
SHARED TOKENS (15): "caldwell", "general", "idaho", "intersection", "major", "national", "northwest", "official", "pacific", "park", "river", "route", "rules", "west", "western".
0.300
Work for hire ↗ Q516039 KW CROSS HIGH
commissioncorporatecreatedcreatesemployeremploymententitygeneralindividualjurisdictionslawlegalorganizationownedrelationshipservingwhosework
SHARED TOKENS (18): "commission", "corporate", "created", "creates", "employer", "employment", "entity", "general", "individual", "jurisdictions", "law", "legal", "organization", "owned", "relationship", "serving", "whose", "work".
0.300
advertisingarchitecturebecomedesigndevelopmenteconomyeducationespeciallyinformationknowledgeprivatepublicresourcesectorsectorstherefore
SHARED TOKENS (16): "advertising", "architecture", "become", "design", "development", "economy", "education", "especially", "information", "knowledge", "private", "public", "resource", "sector", "sectors", "therefore".
0.300
agencydepartmenteducationenforcementengineersenvironmentalfederalfederallyfinancialgovernmentindependentinformationlegallocalmattersmonitoringnationaloperationpermittingprograms
SHARED TOKENS (25): "agency", "department", "education", "enforcement", "engineers", "environmental", "federal", "federally", "financial", "government", "independent", "information", "legal", "local", "matters", "monitoring", "national", "operation", "permitting", "programs"....
0.300
activityappliedbuiltcitiescreatedenvironmenteventsindustriallandlandscapelightnaturaloutdoorshowthereforeurbanwaterweather
SHARED TOKENS (18): "activity", "applied", "built", "cities", "created", "environment", "events", "industrial", "land", "landscape", "light", "natural", "outdoor", "show", "therefore", "urban", "water", "weather".
0.300
accesscodecommercecontroldigitaldirectextendfieldinformationitselflawliabilitymanagementorganizationprincipalproductionpropertyprovidersrightssociety
SHARED TOKENS (22): "access", "code", "commerce", "control", "digital", "direct", "extend", "field", "information", "itself", "law", "liability", "management", "organization", "principal", "production", "property", "providers", "rights", "society"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciesamericancanyoncommercialconstructioncontrolcreateddownstreameventualfurtherhistoryidahoirrigationlargelimitedmajormilitarynationalnorthwestpacific
SHARED TOKENS (38): "agencies", "american", "canyon", "commercial", "construction", "control", "created", "downstream", "eventual", "further", "history", "idaho", "irrigation", "large", "limited", "major", "military", "national", "northwest", "pacific"....
0.300
agricultureaircraftapplicationsassetsbecomeboardcontrolcontrolledcostscoverageenvironmentalinfrastructuremilitarymonitoringpilotproductriversystemvehicleweather
SHARED TOKENS (20): "agriculture", "aircraft", "applications", "assets", "become", "board", "control", "controlled", "costs", "coverage", "environmental", "infrastructure", "military", "monitoring", "pilot", "product", "river", "system", "vehicle", "weather".
0.300
combinedconnectsconsumerscurrentdeliverydirectdirectlydistinctelectricalevenformhandlinghistoricallylocalmajormarketnetworkownedseparatesite
SHARED TOKENS (22): "combined", "connects", "consumers", "current", "delivery", "direct", "directly", "distinct", "electrical", "even", "form", "handling", "historically", "local", "major", "market", "network", "owned", "separate", "site"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontrolinformationintersectionlightlocalnationalneedpedestrianpolicereducesignalsignalssystemsystemstechnologytraffic
SHARED TOKENS (18): "advanced", "capacity", "control", "information", "intersection", "light", "local", "national", "need", "pedestrian", "police", "reduce", "signal", "signals", "system", "systems", "technology", "traffic".
0.300
buildingcertaincircumstancesconditionscontainingcreatesenvironmentevenidentificationmaterialspeoplepersonnelphysicalpropertypublicriskssafetyspecificsubjectsystem
SHARED TOKENS (22): "building", "certain", "circumstances", "conditions", "containing", "creates", "environment", "even", "identification", "materials", "people", "personnel", "physical", "property", "public", "risks", "safety", "specific", "subject", "system"....
0.300
announcedcentercreateitselflaternetworkoperatesoperatingpacificplansprincipalprojectrouteroutessystemtransportationwestwestern
SHARED TOKENS (18): "announced", "center", "create", "itself", "later", "network", "operates", "operating", "pacific", "plans", "principal", "project", "route", "routes", "system", "transportation", "west", "western".
0.300
accessadditionaladministrationapproximatelyavoidbuiltcollectionconstructioncontrolledcreatingdensedesignestablishedextendsfederalfuturegeneralgovernmentitselfnational
SHARED TOKENS (40): "access", "additional", "administration", "approximately", "avoid", "built", "collection", "construction", "controlled", "creating", "dense", "design", "established", "extends", "federal", "future", "general", "government", "itself", "national"....
0.300
accordingactivityanalysisbecomesdesigndocumentationengineersenvironmentestablishedgeneralgovernmentjurisdictionslegallicenselicensedlocalpartsplanspracticepractitioners
SHARED TOKENS (36): "according", "activity", "analysis", "becomes", "design", "documentation", "engineers", "environment", "established", "general", "government", "jurisdictions", "legal", "license", "licensed", "local", "parts", "plans", "practice", "practitioners"....
0.300
activeagenciesapproximatelybuildingbusinesscanalscapacitycombinedconstituteconstructioncontroldepartmentdesigndirectdirectlyeconomyengineersenvironmentenvironmentalestablish
SHARED TOKENS (55): "active", "agencies", "approximately", "building", "business", "canals", "capacity", "combined", "constitute", "construction", "control", "department", "design", "direct", "directly", "economy", "engineers", "environment", "environmental", "establish"....
0.300
fieldinvolvingnetworktraffictransportation
SHARED TOKENS (5): "field", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
accordingadministrationannualapplyassetsauthorizationbusinessbusinessescertificationgovernmenthomeinspectionlargelicensemedicaloperateoperationsorganizationspolicyprograms
SHARED TOKENS (31): "according", "administration", "annual", "apply", "assets", "authorization", "business", "businesses", "certification", "government", "home", "inspection", "large", "license", "medical", "operate", "operations", "organizations", "policy", "programs"....
0.300
abilityaffectsagencyapproximatelybodybusinessescapablecertainconstructioncontractsdirecteconomygovernmentgroupgrowthissuelocalorganizationorganizationspractices
SHARED TOKENS (37): "ability", "affects", "agency", "approximately", "body", "businesses", "capable", "certain", "construction", "contracts", "direct", "economy", "government", "group", "growth", "issue", "local", "organization", "organizations", "practices"....
0.300
adaboisecenterconnectedcontainsgardenidahoitselfmetropolitanmountainnationalpopulationrecreationstarvalleywestern
SHARED TOKENS (16): "ada", "boise", "center", "connected", "contains", "garden", "idaho", "itself", "metropolitan", "mountain", "national", "population", "recreation", "star", "valley", "western".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbuildingsconnectdevelopmentevenfeefullfunctionsgovernmentimpactjurisdictionslandlaterlegalmunicipalitiesownersownershippayment
SHARED TOKENS (30): "acquisition", "another", "application", "buildings", "connect", "development", "even", "fee", "full", "functions", "government", "impact", "jurisdictions", "land", "later", "legal", "municipalities", "owners", "ownership", "payment"....
0.300
additionaladvancedagenciesaircraftbusinessescarecertaincontactdepartmentdevelopingemergencyfacilitieshistoricallyhospitalmedicalmodeloperatepartspatientpersonnel
SHARED TOKENS (34): "additional", "advanced", "agencies", "aircraft", "businesses", "care", "certain", "contact", "department", "developing", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "parts", "patient", "personnel"....
0.300
administrationagenciesamongcommunitiescompliancecontentcontrolcurrentdepartmentdesigndiffersdocumentfederallawlocalnationalownedparkingplacementpublic
SHARED TOKENS (29): "administration", "agencies", "among", "communities", "compliance", "content", "control", "current", "department", "design", "differs", "document", "federal", "law", "local", "national", "owned", "parking", "placement", "public"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
buildingscannotcombinedconnectdesigndestinationeveninfrastructureinsidelargemunicipalparkingparkspropertypublicreceiverequireresidentialsmallsystems
SHARED TOKENS (21): "buildings", "cannot", "combined", "connect", "design", "destination", "even", "infrastructure", "inside", "large", "municipal", "parking", "parks", "property", "public", "receive", "require", "residential", "small", "systems"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsformindividuallightmeaningmultipleoperateoperatesoperatingoperationsspeedsystemsystemstechnologytrafficurbanuses
SHARED TOKENS (19): "broader", "capacity", "conditions", "form", "individual", "light", "meaning", "multiple", "operate", "operates", "operating", "operations", "speed", "system", "systems", "technology", "traffic", "urban", "uses".
0.300
codecodifiedcreateexplicitlygrantslawlibrarylimitedofficepublicpubliclyregistrationrightsstatedsubjecttransfersworks
SHARED TOKENS (17): "code", "codified", "create", "explicitly", "grants", "law", "library", "limited", "office", "public", "publicly", "registration", "rights", "stated", "subject", "transfers", "works".
0.300
Fair use ↗ Q131562 KW CROSS HIGH
allowingappliedappliesbroadercertaincreatedgeneralimpactlawlimitedmajormarketmaterialpermissionpermitspublicrightsstatutorytestthough
SHARED TOKENS (25): "allowing", "applied", "applies", "broader", "certain", "created", "general", "impact", "law", "limited", "major", "market", "material", "permission", "permits", "public", "rights", "statutory", "test", "though"....
0.300
accesscommunitydesignengineersenvironmentalhomeoperatedplannerspolicypractitionerspublicrequiressafesafetytraffictransportationtravelurban
SHARED TOKENS (18): "access", "community", "design", "engineers", "environmental", "home", "operated", "planners", "policy", "practitioners", "public", "requires", "safe", "safety", "traffic", "transportation", "travel", "urban".
🫐 BERRY51 edges
0.280
americanbuiltbusinessescitiesdevelopmentenvironmentalexpansionformationgrowthmodelpopulationprocessurbanzone
SHARED TOKENS (14): "american", "built", "businesses", "cities", "development", "environmental", "expansion", "formation", "growth", "model", "population", "process", "urban", "zone".
0.280
documenteventslaterofficial
SHARED TOKENS (4): "document", "events", "later", "official". | EXACT TITLE in photography: "Wedding photography".
0.280
americandepartmentdepartmentsdirectlyeconomyfederalgovernmentmissionpeoplereportssafeservingsystemtransportation
SHARED TOKENS (14): "american", "department", "departments", "directly", "economy", "federal", "government", "mission", "people", "reports", "safe", "serving", "system", "transportation".
0.280
buildingsspecializedstructuresterms
SHARED TOKENS (4): "buildings", "specialized", "structures", "terms". | EXACT TITLE in photography: "Architectural photography".
0.280
boisecitiesdesignateddowntownhomeidahomajormetropolitanmountainnorthwestriverrouteroutesserves
SHARED TOKENS (14): "boise", "cities", "designated", "downtown", "home", "idaho", "major", "metropolitan", "mountain", "northwest", "river", "route", "routes", "serves".
0.260
createnaturaluses
SHARED TOKENS (3): "create", "natural", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
designdigitaldirectlightmajormanufacturersproductratherrecordsseparateshowingshowsview
SHARED TOKENS (13): "design", "digital", "direct", "light", "major", "manufacturers", "product", "rather", "records", "separate", "showing", "shows", "view".
0.260
Camera lens ↗ KW CROSS HIGH
bodycapableconstructioncreatedesignfixedmajormediapracticepresentproduceproductionsystem
SHARED TOKENS (13): "body", "capable", "construction", "create", "design", "fixed", "major", "media", "practice", "present", "produce", "production", "system".
0.260
accessibilityadabusinesscostslaterlawnationalprohibitspublicrequirementsrequiresrightssupported
SHARED TOKENS (13): "accessibility", "ada", "business", "costs", "later", "law", "national", "prohibits", "public", "requirements", "requires", "rights", "supported".
0.260
academiccollegecommunityeducationforminstitutionspolicyprogramsschoolseniorstudentsuniversityworkforce
SHARED TOKENS (13): "academic", "college", "community", "education", "form", "institutions", "policy", "programs", "school", "senior", "students", "university", "workforce".
0.260
academicapplicationdesignfacilitiesfieldmanagementoccupationaloperationpeopleplanningsafetechnologytransportation
SHARED TOKENS (13): "academic", "application", "design", "facilities", "field", "management", "occupational", "operation", "people", "planning", "safe", "technology", "transportation".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeconstructionequipmentindustrialinfrastructurelargelegallimitsordinaryspecifiedstandardtransportationwater
SHARED TOKENS (13): "bridge", "construction", "equipment", "industrial", "infrastructure", "large", "legal", "limits", "ordinary", "specified", "standard", "transportation", "water".
0.240
becomedesigndesignersengineersespeciallyphysicalplannerssafetyspeedtrafficurbanuses
SHARED TOKENS (12): "become", "design", "designers", "engineers", "especially", "physical", "planners", "safety", "speed", "traffic", "urban", "uses".
0.240
applicationscertaincreatedigitallightpositionprocessproductrecordshowtechnicalvalue
SHARED TOKENS (12): "applications", "certain", "create", "digital", "light", "position", "process", "product", "record", "show", "technical", "value".
0.240
createdeterminesespeciallyinformationlightlightinglimitednaturalqualitysourcesubjectvisual
SHARED TOKENS (12): "create", "determines", "especially", "information", "light", "lighting", "limited", "natural", "quality", "source", "subject", "visual".
0.240
codifiedfixedlaterlawpartsprovisionspublicratherremainsrightsstatuteterms
SHARED TOKENS (12): "codified", "fixed", "later", "law", "parts", "provisions", "public", "rather", "remains", "rights", "statute", "terms".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
citieslargelightmarketingmetropolitanparkparkingpeoplepublicsystemvehiclevehicles
SHARED TOKENS (12): "cities", "large", "light", "marketing", "metropolitan", "park", "parking", "people", "public", "system", "vehicle", "vehicles".
0.220
automotivedesigndevelopmentformmanufacturingmarketmarketingorganizationsrevenuevehiclevehicles
SHARED TOKENS (11): "automotive", "design", "development", "form", "manufacturing", "market", "marketing", "organizations", "revenue", "vehicle", "vehicles".
0.220
Image sensor ↗ Q209121 KW CROSS HIGH
convertscurrentdigitalequipmentforminformationlightmedicalsignalssmalltechnology
SHARED TOKENS (11): "converts", "current", "digital", "equipment", "form", "information", "light", "medical", "signals", "small", "technology".
0.220
bodycontroldistinctenvironmentfuturemodelprivateproducesratherremainsubject
SHARED TOKENS (11): "body", "control", "distinct", "environment", "future", "model", "private", "produces", "rather", "remain", "subject".
0.220
constructiondesignengineersfuturematerialsoperationplanningprofessionalstandardstraffictransportation
SHARED TOKENS (11): "construction", "design", "engineers", "future", "materials", "operation", "planning", "professional", "standards", "traffic", "transportation".
0.220
eventpractice
SHARED TOKENS (2): "event", "practice". | EXACT TITLE in photography: "Event photography".
0.200
creatingdepartmentdesignatedevenpathwaypermitroutesharedtravelurban
SHARED TOKENS (10): "creating", "department", "designated", "even", "pathway", "permit", "route", "shared", "travel", "urban".
0.200
agencycategoryestateeventfoodparksplanningrealtourismtravel
SHARED TOKENS (10): "agency", "category", "estate", "event", "food", "parks", "planning", "real", "tourism", "travel".
0.200
accessconnectingjurisdictionslocalmajormoveresidentialservestrafficwider
SHARED TOKENS (10): "access", "connecting", "jurisdictions", "local", "major", "move", "residential", "serves", "traffic", "wider".
0.200
aircraftcostsfasterhandlingitselfmethodmultiplesecuritytransportationvehicle
SHARED TOKENS (10): "aircraft", "costs", "faster", "handling", "itself", "method", "multiple", "security", "transportation", "vehicle".
0.200
applicationassetassetscollectiondatadigitalfilesmanagementoperationssystem
SHARED TOKENS (10): "application", "asset", "assets", "collection", "data", "digital", "files", "management", "operations", "system".
0.200
becomedigitaldirectdisplayslacklightneedprofessionalsystemterms
SHARED TOKENS (10): "become", "digital", "direct", "displays", "lack", "light", "need", "professional", "system", "terms".
0.180
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegardengovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (9): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.180
bodycitiescountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (9): "body", "cities", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "western".
0.180
Gig economy ↗ Q51711208 KW CROSS HIGH
corporatedigitaleconomyengagepeoplesectorsystemworkersworkforce
SHARED TOKENS (9): "corporate", "digital", "economy", "engage", "people", "sector", "system", "workers", "workforce".
0.180
applicationdigitalespeciallyformmeaningpracticesprofessionalprogramsubject
SHARED TOKENS (9): "application", "digital", "especially", "form", "meaning", "practices", "professional", "program", "subject".
0.160
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
idahointersectionlimitedroutesystemtrailwestwestern
SHARED TOKENS (8): "idaho", "intersection", "limited", "route", "system", "trail", "west", "western".
0.160
americancommercialenvironmentlandmilitaryphysicalprocessproducts
SHARED TOKENS (8): "american", "commercial", "environment", "land", "military", "physical", "process", "products".
0.160
commerciallargelicensematerialsoperatepartsvehiclevehicles
SHARED TOKENS (8): "commercial", "large", "license", "materials", "operate", "parts", "vehicle", "vehicles".
0.160
Bike lane ↗ Q1378400 KW CROSS HIGH
businessesentrypermittedresearchsafetyshowstrafficvehicles
SHARED TOKENS (8): "businesses", "entry", "permitted", "research", "safety", "shows", "traffic", "vehicles".
0.160
canyonconnectingeagleidahomeridiannamparivervalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "river", "valley".
0.140
contactcreatingdigitaldirectlypermanentprocessproduction
SHARED TOKENS (7): "contact", "creating", "digital", "directly", "permanent", "process", "production".
0.140
becomecommerciallydesignershistorymodelproductswork
SHARED TOKENS (7): "become", "commercially", "designers", "history", "model", "products", "work".
0.140
airspaceapplicableclassescontrolcontrolledtrafficweather
SHARED TOKENS (7): "airspace", "applicable", "classes", "control", "controlled", "traffic", "weather".
0.140
Drawing pin ↗ Q406839 KW CROSS HIGH
americanlightmeaningplacepressuresmallterms
SHARED TOKENS (7): "american", "light", "meaning", "place", "pressure", "small", "terms".
0.140
commercialcontrolindividualpropertyratherrightsuses
SHARED TOKENS (7): "commercial", "control", "individual", "property", "rather", "rights", "uses".
0.120
adaconnectingcountiesidahoroutestar
SHARED TOKENS (6): "ada", "connecting", "counties", "idaho", "route", "star".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "small".
0.120
contentoperatesplanningplatformsportfoliotechnology
SHARED TOKENS (6): "content", "operates", "planning", "platforms", "portfolio", "technology".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
gardenidahoroutetreasurevalley
SHARED TOKENS (5): "garden", "idaho", "route", "treasure", "valley".
0.100
businesscreateownedplacerepresented
SHARED TOKENS (5): "business", "create", "owned", "place", "represented".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Photography — Treasure Valley
HAIKU · HIGH GATE
What transportation routes in the Treasure Valley provide the best vantage points for infrastructure photography?
Interstate 84 running through Ada County and Canyon County offers photographers direct sightlines to major bridge construction projects and highway interchanges. State routes connecting Boise, Nampa, Caldwell, Meridian, and Kuna expose numerous grade separations and Federal Aviation Administration approach corridors that document the region's western metropolitan expansion.
How does Boise Airport's expansion relate to photography documentation in the Treasure Valley?
Boise Airport's runways and taxiway construction generate visual records critical to understanding northwestern Idaho's infrastructure development captured by regional photographers. The Federal Aviation Administration's coordination with Ada County on airfield improvements creates accessible documentation sites for aviation infrastructure photography along the metropolitan corridor.
Why do photographers document transportation construction near Boise State University and College of Western Idaho?
Construction projects serving Boise State University in Boise and College of Western Idaho in Nampa demonstrate how regional infrastructure adapts to accommodate population growth in the Treasure Valley's two largest metropolitan hubs. Photographers record these transit corridors and parking infrastructure improvements as visual evidence of northwestern Idaho's educational institution expansion.
What transportation corridors in Star, Kuna, and Meridian attract infrastructure photographers?
The developing street networks and bridge construction in Star, Kuna, and Meridian document the western expansion of Ada County and Canyon County's metropolitan footprint. Photographers systematically record these emerging transportation routes as the Treasure Valley population spreads outward from Boise's capital core.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Photography 17 QID bridges 225 edges 6,180 ext links 2026-07-17 23:42:49 UTC 0405a7cc040d28d8
Transportation Infrastructure corridor ↗ Photography corridor ↗ Photography × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals