—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Aerospace Defense

18 Wikipedia bridge articles confirmed in both vertical ledgers. 243 deterministic cross-vertical edges. 6,602 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
243 Cross Edges
6,602 External Sources
275 Wikipedia Articles
26 🌲 Evergreen
177 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Aerospace Defense
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
243
External Sources Harvested
6,602
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.1100  ·  type: exact_title_cross  ·  13 shared tokens
QID Bridge Titles (18)
Idaho State PoliceNampa Municipal AirportZoningTreasure ValleySupply chainFederal Aviation AdministrationBoise State UniversityBoise AirportCollege of Western IdahoFederal Highway AdministrationNampa, IdahoElectric power transmissionUnion Pacific RailroadBoise, IdahoInterstate 84 in IdahoAda County, IdahoCaldwell, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisewesternmilespopulationpubliccanyonhomedepartmentnampalocaloregoncollegewestadamajorairairportsaviationfaa
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:38:38 UTC
Content Hash
516a10ed560a664e
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.110
QID OVERLAP: Q5987459 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (13): "began", "creating", "department", "enforcement", "idaho", "isp", "law", "municipal", "organization", "police", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police". | EXACT TITLE in aerospace_defense: "Idaho State Police".
begancreatingdepartmentenforcementidahoisplawmunicipalorganizationpolicepresentpublicstatewide
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Other duties The Idaho State Police has two regional communications centers staffed with dispatchers who provide support to officers in the field. The Idaho State Police is tasked with the physical protection of the governor of the state as well as other dignitaries who may need protection. Rank structure See also List of law enforcement agencies in Idaho State police State patrol Highway patrol References External links Official ISP website
Nampa Municipal Airport
Q3566209 EXACT TITLE 1.000
QID OVERLAP: Q3566209 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (26): "air", "airport", "airports", "aviation", "canyon", "civil", "construction", "emergency", "faa", "flight", "general", "hangar", "home", "idaho", "industrial", "integrated", "military", "mission", "municipal", "nampa".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport". | EXACT TITLE in aerospace_defense: "Nampa Municipal Airport".
airairportairportsaviationcanyoncivilconstructionemergencyfaaflightgeneralhangarhomeidahoindustrialintegratedmilitarymissionmunicipalnampanationalplanprivatepublicsystemstraining
Nampa Municipal Airport (ICAO: KMAN, FAA LID: MAN, formerly S67) is a city-owned public airport in Nampa, in Canyon County, Idaho. The FAA's National Plan of Integrated Airport Systems for 2009–2013 called it a general aviation airport. It is used for private, emergency, military and industrial aviation and is home to the Warhawk Air Museum. The airport has ongoing hangar construction. The Civil Air Patrol Nampa Squadron is on airport grounds co-located with EAA in the Shep-Rock hangar. Nampa Municipal Airport is a member of Rocky Mountain Air and the Snake River Flight Training Club. Mission Aviation Fellowship is also headquartered at the Nampa Airport. Most U.S.
port. It is used for private, emergency, military and industrial aviation and is home to the Warhawk Air Museum. The airport has ongoing hangar construction. The Civil Air Patrol Nampa Squadron is on airport grounds co-located with EAA in the Shep-Rock hangar. Nampa Municipal Airport is a member of Rocky Mountain Air and the Snake River Flight Training Club. Mission Aviation Fellowship is also headquartered at the Nampa Airport. Most U.S.
ed with EAA in the Shep-Rock hangar. Nampa Municipal Airport is a member of Rocky Mountain Air and the Snake River Flight Training Club. Mission Aviation Fellowship is also headquartered at the Nampa Airport. Most U.S.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (34): "allowing", "building", "buildings", "certain", "compatible", "determine", "developed", "development", "different", "differs", "form", "government", "governments", "growth", "guidelines", "industrial", "land", "land-use", "local", "municipality".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in aerospace_defense: "Zoning".
allowingbuildingbuildingscertaincompatibledeterminedevelopeddevelopmentdifferentdiffersformgovernmentgovernmentsgrowthguidelinesindustriallandland-uselocalmunicipalityplacesplanningpolicypropertyregulationsregulatoryresidentialrulesshapesingle+4
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "commerce", "eastern", "historically", "idaho", "land", "local", "oregon", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in aerospace_defense: "Treasure Valley".
agriculturalassociationboisecommerceeasternhistoricallyidaholandlocaloregonregionresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Supply chain
Q1824206 EXACT TITLE 1.000
QID OVERLAP: Q1824206 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (24): "chain", "complex", "consumer", "convert", "creating", "customers", "direct", "directly", "distribution", "facilities", "independent", "logistics", "management", "materials", "network", "product", "products", "structure", "suppliers", "supply".... | EXACT TITLE in transportation_infrastructure: "Supply chain". | EXACT TITLE in aerospace_defense: "Supply chain".
chaincomplexconsumerconvertcreatingcustomersdirectdirectlydistributionfacilitiesindependentlogisticsmanagementmaterialsnetworkproductproductsstructuresupplierssupplysystemsystemsthemvalue
A supply chain is a complex logistics system that consists of facilities that convert raw materials into finished products and distribute them to end consumers or end customers, while supply chain management focuses on the optimization of the flow of goods within the supply chain's distribution channels to ensure efficiency. In sophisticated supply chain systems, the reintroduction of used products into the supply chain may occur at any point where the residual value of the product is recyclable. Supply chains are linked to value chains, and suppliers within a supply chain are often organized into tiers. First-tier suppliers, also referred to as "direct suppliers", directly supply goods or services to the client.
the optimization of the flow of goods within the supply chain's distribution channels to ensure efficiency. In sophisticated supply chain systems, the reintroduction of used products into the supply chain may occur at any point where the residual value of the product is recyclable. Supply chains are linked to value chains, and suppliers within a supply chain are often organized into tiers. First-tier suppliers, also referred to as "direct suppliers", directly supply goods or services to the client.
suppliers", directly supply goods or services to the client. Second-tier suppliers supply to the first tier, and so on, creating a hierarchical structure within the supply network. The phrase "supply chain" may have been first published in a 1905 article in The Independent, which briefly mentioned the difficulty of "keeping a supply chain with India unbroken" during the British expedition to Tibet. Overview
Federal Aviation Administration
Q335357 EXACT TITLE 1.000
QID OVERLAP: Q335357 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (26): "administration", "aeronautics", "air", "aircraft", "airports", "assets", "authority", "aviation", "certification", "civil", "commercial", "control", "department", "faa", "federal", "government", "international", "organization", "personnel", "regulates".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
administrationaeronauticsairaircraftairportsassetsauthorityaviationcertificationcivilcommercialcontroldepartmentfaafederalgovernmentinternationalorganizationpersonnelregulatesspacestandardssurroundingtraffictransportationvehicles
The Federal Aviation Administration (FAA) is a U.S. federal government agency within the U.S. Department of Transportation that regulates civil aviation in the United States and surrounding international waters. Its powers include air traffic control, certification of personnel and aircraft, setting standards for airports, and protection of U.S. assets during the launch or re-entry of commercial space vehicles. Powers over neighboring international waters were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S.
s were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (22): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "founded", "high", "idaho", "independent", "program", "programs", "public", "reported", "research", "school".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in aerospace_defense: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringfoundedhighidahoindependentprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (33): "ada", "air", "aircraft", "airport", "airports", "aviation", "base", "boi", "boise", "center", "commercial", "department", "faa", "facility", "field", "functions", "general", "gowen", "idaho", "interagency".... | EXACT TITLE in transportation_infrastructure: "Boise Airport". | EXACT TITLE in aerospace_defense: "Boise Airport".
adaairaircraftairportairportsaviationbaseboiboisecentercommercialdepartmentfaafacilityfieldfunctionsgeneralgowenidahointeragencyinternationalmilesmilitarynationaloperatedoperatesrequiringrightssouthsupport+3
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (29): "academic", "ada", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in aerospace_defense: "College of Western Idaho".
academicadaboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprogramspublicreportedsouthweststudentstechnicaltransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Federal Highway Administration
Q800112 EXACT TITLE 0.960
QID OVERLAP: Q800112 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (13): "administration", "department", "division", "federal", "highway", "major", "office", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration". | EXACT TITLE in aerospace_defense: "Federal Highway Administration".
administrationdepartmentdivisionfederalhighwaymajorofficeprogramprogramspublicroadroletransportation
The Federal Highway Administration (FHWA) is a division of the United States Department of Transportation that specializes in highway transportation. The agency's major activities are grouped into two programs, the Federal-aid Highway Program and the Federal Lands Highway Program.
Background With the coming of the bicycle in the 1890s, interest grew regarding the improvement of streets and roads in America. The traditional method of putting the burden on maintaining roads on local landowners was increasingly inadequate. In 1893, the federal Office of Road Inquiry (ORI) was founded; in 1905, it was renamed the Office of Public Roads (OPR) and made a division of the United States Department of Agriculture. Demands grew for local and state government to take charge. With the coming of the automobile, urgent efforts were made to upgrade and modernize dirt roads designed for horse-drawn wagon traffic. In 1910, the American Association for Highway Improvement was organized. Funding came from automobile registration, and taxes on motor fuels, as well as state aid. By 1914, there were 2.4 million miles of rural dirt rural roads; 100,000 miles had been improved with grading and gravel, and 3,000 miles were given high-quality surfacing. The rapidly increasing speed of automobiles, and especially trucks, made maintenance and repair high-priority items. In 1915, OPR's name was changed to the Bureau of Public Roads. The following year, federal aid was first made available to improve post roads and promote general commerce: $75 million over five years, issued through the BPR in cooperation with the state highway departments. In 1939, BPR was renamed to the Public Roads Administration (PRA) and shifted to the Federal Works Agency.
Creation The Federal Highway Administration was created on October 15, 1966, along with the Bureau of Motor Carrier Safety and the National Highway Safety Bureau (now known as National Highway Traffic Safety Administration), as part of the new U.S. Department of Transportation. The FHWA took over the functions of the Bureau of Public Roads the following year. Functions The FHWA's role in the Federal-aid Highway Program is to oversee federal funds to build and maintain the National Highway System (primarily Interstate highways, U.S. highways and most state highways). This funding mostly comes from the federal gasoline tax and mostly goes to state departments of transportation. The FHWA oversees projects using these funds to ensure that federal requirements for project eligibility, contract administration and construction standards are adhered to. Under the Federal Lands Highway Program (sometimes called "direct fed"), the FHWA provides highway design and construction services for various federal land-management agencies, such as the Forest Service and the National Park Service. The FLHP also jointly administers the Indian Reservation Roads Program. In addition to these programs, the FHWA performs and sponsors research in the areas of roadway safety, congestion, highway materials and construction methods, and provides funding to local technical assistance program centers to disseminate research results to local highway agencies. The FHWA also publishes the Manual on Uniform Traffic Control Devices (MUTCD), which is used by most highway agencies in the United States.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and aerospace_defense (tier:branch). | SHARED TOKENS (17): "boise", "canyon", "college", "home", "idaho", "interstate", "meaning", "meridian", "miles", "nampa", "northwest", "population", "principal", "second", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeaningmeridianmilesnampanorthwestpopulationprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Electric power transmission
Q200928 QID OVERLAP 0.800
QID OVERLAP: Q200928 in transportation_infrastructure (tier:branch) and aerospace_defense (tier:branch). | SHARED TOKENS (29): "connects", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electrical", "energy", "even", "form", "handling", "historically", "industry", "line", "lines", "local", "major"....
connectscurrentcustomersdeliverydirectdirectlydistinctdistributioneasternelectricalenergyevenformhandlinghistoricallyindustrylinelineslocalmajormarketmovementnetworkownedpowerreducedseparatesitewestern
lower currents and lower losses caused by such currents. The AC voltage level is often changed with transformers. A wide area synchronous grid, known as an interconnection in North America, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
erica, directly connects generators delivering AC power with the same relative frequency to many consumers. North America has four major interconnections: Western, Eastern, Quebec and Texas.
High-voltage direct current (HVDC) is used to transmit large amounts of power over long distances or for interconnections between asynchronous grids. When electrical energy is transmitted over very long distances, the power lost in AC transmission becomes appreciable and it is less expensive to use direct current instead. For a long transmission line, these lower losses (and reduced construction cost of a DC line) can offset the cost of the required converter stations at each end. HVDC is used for long submarine cables where AC cannot be used because of cable capacitance. In these cases special high-voltage cables are used. Submarine HVDC systems are often used to interconnect the electricity grids of islands, for example, between Great Britain and continental Europe, between Great Britain and Ireland, between Tasmania and the Australian mainland, between the North and South Islands of New Zealand, between New Jersey and New York City, and between New Jersey and Long Island. Submarine connections up to 600 kilometres (370 mi) in length have been deployed. HVDC links can be used to control grid problems. The power transmitted by an AC line increases as the phase angle between source end voltage and destination ends increases, but too large a phase angle allows the systems at either end to fall out of step. Since the power flow in a DC link is controlled independently of the phases of the AC networks that it connects, this phase angle limit does not exist, and a DC link is always able to transfer its full rated power. A DC link therefore stabilizes the AC grid at either end, since power flow and phase angle can then be controlled independently. As an example, to adjust the flow of AC power on a hypothetical line between Seattle and Boston would require adjustment of the relative phase of the two regional electrical grids. This is an everyday occurrence in AC systems, but one that can become disrupted when AC system components fail and place unexpected loads on the grid.
Union Pacific Railroad
Q725793 QID OVERLAP 0.800
QID OVERLAP: Q725793 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (26): "approved", "center", "corporation", "create", "founded", "freight", "itself", "later", "miles", "network", "operates", "operating", "pacific", "plans", "principal", "project", "rail", "reach", "reporting", "road"....
approvedcentercorporationcreatefoundedfreightitselflatermilesnetworkoperatesoperatingpacificplansprincipalprojectrailreachreportingroadroutesystemtransportationunionwestwestern
ic Corporation, which are both headquartered at the Union Pacific Center, in Omaha, Nebraska. Union Pacific has announced plans to acquire the Norfolk Southern Railway in a deal worth $85 billion. If approved by regulators, it would create the first transcontinental railroad network in the United States. History Union Pacific in the 19th century The original company, the "Union Pacific Rail Road", was incorporated on July 1, 1862, under the Pacific Railroad Act of 1862. President Abraham Lincoln had approved the act, which authorized railroad construction from the Missouri River to the Pacific to ensure the stability of the Union throughout the American Civil War, but construction was not completed until after the conflict's conclusion. Under the original bill that formed the basis of the 1862 Pacific Railroad Act, the Union Pacific Railroad was to be built from the Nevada–Utah border in the west to the Colorado–Kansas border in the east. However, due to intense lobbying by Dr. Thomas Clark Durant, the eastern terminal was moved to a location where the Union Pacific could link up with the Mississippi and Missouri Railroad in Iowa. Following the Act's passage, commissioners appointed by Congress began selling stock in the federally chartered Union Pacific Railroad Company. By 1863, Durant had organized the purchase of 2,000 shares, the prerequisite amount of stock sold in order to begin the railroad's construction. The resulting track ran westward from Council Bluffs, Iowa, to meet in Utah the Central Pacific Railroad line, which had been constructed eastward from Sacramento, California.
History Union Pacific in the 19th century The original company, the "Union Pacific Rail Road", was incorporated on July 1, 1862, under the Pacific Railroad Act of 1862. President Abraham Lincoln had approved the act, which authorized railroad construction from the Missouri River to the Pacific to ensure the stability of the Union throughout the American Civil War, but construction was not completed until after the conflict's conclusion. Under the original bill that formed the basis of the 1862 Pacific Railroad Act, the Union Pacific Railroad was to be built from the Nevada–Utah border in the west to the Colorado–Kansas border in the east. However, due to intense lobbying by Dr. Thomas Clark Durant, the eastern terminal was moved to a location where the Union Pacific could link up with the Mississippi and Missouri Railroad in Iowa. Following the Act's passage, commissioners appointed by Congress began selling stock in the federally chartered Union Pacific Railroad Company. By 1863, Durant had organized the purchase of 2,000 shares, the prerequisite amount of stock sold in order to begin the railroad's construction. The resulting track ran westward from Council Bluffs, Iowa, to meet in Utah the Central Pacific Railroad line, which had been constructed eastward from Sacramento, California.
In March 2024, Union Pacific layoffs caused concern at the Federal Railroad Administration to the extent that the FRA, in a letter to UP's CEO, said "safety of railroad operations is paramount ... decisions that comprise that fundamental ... are unacceptable. You must ensure that highly trained and experienced personnel perform critical inspections and repairs .... Your railroad (layoffs) are far outpacing any of your Class 1 peers." In 2024, the railway celebrated 150 years of having its headquarters in Omaha. The railway's Big Boy #4014, the world's largest operating steam locomotive, visited 14 states throughout the Midwest in 2024. Twenty-five Big Boys were built during World War II, with only eight surviving and #4014 the only operable one, restored by the railroad to join its Heritage Fleet. Its "Heartland of America" tour began in August 2024 in Cheyenne, Wyoming, and travelled through Arkansas, Colorado, Illinois, Iowa, Kansas, Missouri, Nebraska, Oklahoma and Texas through October. Three commemorative locomotives honor U.S. Presidents, including UP No. 4141, named in honor of George H. W. Bush, the 41st President. It is exhibited at the George H. W. Bush Presidential Center at Texas A&M University in College Station, Texas. The locomotive is custom painted in the colors of GWH Bush's Air Force One. The engine also pulled the president's funeral train on his final journey to College Station in 2018. UP No. 1616, honoring railroad founder President Abraham Lincoln, was unveiled on Presidents Day 2025. The Lincoln Locomotive will serve as a traveling ambassador on the rails. The third locomotive, UP No. 4547 honoring President Donald J. Trump, was created to celebrate America’s 250th anniversary in 2026. The locomotive began its first mission hauling Space Launch System solid rocket motor segments for NASA’s Artemis III lunar exploration program . Proposed merger On July 29, 2025, Union Pacific and Norfolk Southern announced an $85 billion agreement to create a transcontinental railroad. The boards of both companies unanimously approved the transaction, which remains subject to review by the Surface Transportation Board.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and aerospace_defense (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "employers", "feet", "home", "idaho", "locally", "major", "manufacturing", "miles", "oregon", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployersfeethomeidaholocallymajormanufacturingmilesoregonpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.780
QID OVERLAP: Q843258 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:evergreen). | SHARED TOKENS (14): "boise", "cities", "highway", "home", "idaho", "interstate", "line", "major", "miles", "near", "northwest", "oregon", "range", "route".
boisecitieshighwayhomeidahointerstatelinemajormilesnearnorthwestoregonrangeroute
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Ada County, Idaho
Q109820 QID OVERLAP 0.780
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and aerospace_defense (tier:branch). | SHARED TOKENS (14): "ada", "boise", "capital", "district", "highway", "home", "idaho", "local", "northwest", "pacific", "population", "private", "range", "second".
adaboisecapitaldistricthighwayhomeidaholocalnorthwestpacificpopulationprivaterangesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and aerospace_defense (tier:branch). | SHARED TOKENS (10): "boise", "caldwell", "canyon", "college", "idaho", "locally", "miles", "oregon", "population", "west".
boisecaldwellcanyoncollegeidaholocallymilesoregonpopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and aerospace_defense (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
225 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP225 edges
🌲 EVERGREEN8 edges
0.650
departmentfederalfundingfuturegrantidahoinfrastructureitdmaintenanceoperationsorganizationplanningprogramsresponsibletransportation
SHARED TOKENS (15): "department", "federal", "funding", "future", "grant", "idaho", "infrastructure", "itd", "maintenance", "operations", "organization", "planning", "programs", "responsible", "transportation". | URL->A (1): https://itd.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho Transportation Department". | EXACT TITLE in aerospace_defense: "Idaho Transportation Department".
0.650
acquisitionbroadcarrierscommerceconstructioneconomicfederalgovernmentindependentindustryinterstatelinesmattersrailregulatoryrelevanttraffictransportationwater
SHARED TOKENS (19): "acquisition", "broad", "carriers", "commerce", "construction", "economic", "federal", "government", "independent", "industry", "interstate", "lines", "matters", "rail", "regulatory", "relevant", "traffic", "transportation", "water". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
actarmychaptercodefederalforcesidaholocalmilitarynationalorganizationpresentregulationssectionsupportsystemtrained
SHARED TOKENS (17): "act", "army", "chapter", "code", "federal", "forces", "idaho", "local", "military", "national", "organization", "present", "regulations", "section", "support", "system", "trained". | URL->B (1): https://www.imd.idaho.gov/204th-regional-training-institute/. | EXACT TITLE in aerospace_defense: "Idaho Army National Guard".
0.650
acquisitionadministrationairportairportsaviationcommercialfederalfuelfundinggeneralgrantlandlightingplanningprogramprojectspublicrevenuerunwayssafety
SHARED TOKENS (24): "acquisition", "administration", "airport", "airports", "aviation", "commercial", "federal", "fuel", "funding", "general", "grant", "land", "lighting", "planning", "program", "projects", "public", "revenue", "runways", "safety".... | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaagenciesairamonganotherauthoritiesauthoritybaseboisecanyoncapacitycapitalcentercitiesconventionaldemanddistrictearlyemployersenvironmental
SHARED TOKENS (72): "ada", "agencies", "air", "among", "another", "authorities", "authority", "base", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "demand", "district", "early", "employers", "environmental".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.630
airaircraftapplicationcontrolhydraulicneedpowerprimaryproducestructuressystemusesvehicleswater
SHARED TOKENS (14): "air", "aircraft", "application", "control", "hydraulic", "need", "power", "primary", "produce", "structures", "system", "uses", "vehicles", "water". | URL->B (1): https://www.pitchaero.com/. | EXACT TITLE in aerospace_defense: "Cyclorotor".
0.610
airaircraftbaseboisefederalfieldgowenidahomilitarymissionsnationaloperatessupport
SHARED TOKENS (13): "air", "aircraft", "base", "boise", "federal", "field", "gowen", "idaho", "military", "missions", "national", "operates", "support". | URL->B (1): https://www.imd.idaho.gov/f-16-mission-coming-to-gowen-starting-in-2027/. | EXACT TITLE in aerospace_defense: "124th Fighter Wing".
0.610
airportairportscaldwellcanyoncodeexecutivefaafacilityidahomilespublictreasurevalley
SHARED TOKENS (13): "airport", "airports", "caldwell", "canyon", "code", "executive", "faa", "facility", "idaho", "miles", "public", "treasure", "valley". | URL->A (1): http://www.cityofcaldwell.org/departments/airport. | EXACT TITLE in transportation_infrastructure: "Caldwell Executive Airport". | EXACT TITLE in aerospace_defense: "Caldwell Executive Airport".
🌿 BRANCH177 edges
0.500
advancedairbasecapabilitiesconsolidationcontractorscontrolsdecadesdedicateddemanddepartmentdevelopmentdiscoveryenergyengineeringfacilitiesforcesformationfutureintegration
SHARED TOKENS (37): "advanced", "air", "base", "capabilities", "consolidation", "contractors", "controls", "decades", "dedicated", "demand", "department", "development", "discovery", "energy", "engineering", "facilities", "forces", "formation", "future", "integration".... | EXACT TITLE in aerospace_defense: "Air Force Research Laboratory".
0.500
adjacentaircraftairportairportsaviationbecomebusinesscivilcorporatefacilityfbofixed-baseflightfuelgeneralhighindustryinstructioninternationalitself
SHARED TOKENS (40): "adjacent", "aircraft", "airport", "airports", "aviation", "become", "business", "civil", "corporate", "facility", "fbo", "fixed-base", "flight", "fuel", "general", "high", "industry", "instruction", "international", "itself".... | EXACT TITLE in aerospace_defense: "Fixed-base operator".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdistinctionlandlocalmovementplaceprimaryprivatepublicroadroutestreettrafficwhose
SHARED TOKENS (15): "access", "another", "distinction", "land", "local", "movement", "place", "primary", "private", "public", "road", "route", "street", "traffic", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in aerospace_defense: "Road".
0.500
assetbuildingbuildingsconstructioncontributesdevelopmenteconomicextendfacilitiesfinancingindustrialindustryinfrastructuremaintenanceplanningprocessproductswork
SHARED TOKENS (18): "asset", "building", "buildings", "construction", "contributes", "development", "economic", "extend", "facilities", "financing", "industrial", "industry", "infrastructure", "maintenance", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in aerospace_defense: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingdesignedembeddedfrequentlyheighthighwayhydraulicitselfneednoiseperformanceplacingpracticeprocessrequirementsroadroadwayselectionshapestructure
SHARED TOKENS (22): "allowing", "designed", "embedded", "frequently", "height", "highway", "hydraulic", "itself", "need", "noise", "performance", "placing", "practice", "process", "requirements", "road", "roadway", "selection", "shape", "structure".... | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureboisecapitalcontainsdistinctearlyeasterneconomyforestryidahoincorporateslandmanufacturingmethodsmilesnationalnorthwestofficialoregon
SHARED TOKENS (34): "agricultural", "agriculture", "boise", "capital", "contains", "distinct", "early", "eastern", "economy", "forestry", "idaho", "incorporates", "land", "manufacturing", "methods", "miles", "national", "northwest", "official", "oregon".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in aerospace_defense: "Idaho".
0.500
Radar ↗ Q47528 EXACT TITLE
airaircraftcontroldeterminedevelopeddevelopmentenvironmentflighthighinformationmilitarymonitoringnoiseplatformprocessingproducingrathersitesmallspace
SHARED TOKENS (26): "air", "aircraft", "control", "determine", "developed", "development", "environment", "flight", "high", "information", "military", "monitoring", "noise", "platform", "processing", "producing", "rather", "site", "small", "space".... | EXACT TITLE in aerospace_defense: "Radar".
0.500
abilityacademicanalysisanotherapplicationsbroaderbusinessdataengineeringessentialforestrygeographyindexindustryinformationinstitutionalinsuranceintegratedintelligenceknowledge
SHARED TOKENS (39): "ability", "academic", "analysis", "another", "applications", "broader", "business", "data", "engineering", "essential", "forestry", "geography", "index", "industry", "information", "institutional", "insurance", "integrated", "intelligence", "knowledge".... | EXACT TITLE in aerospace_defense: "Geographic information system".
0.500
airaircraftaviationcivilcommercialcomponentsexcludinggeneralinternationaloperationsorganizationprivatespecializedtransporttransportationuseswork
SHARED TOKENS (17): "air", "aircraft", "aviation", "civil", "commercial", "components", "excluding", "general", "international", "operations", "organization", "private", "specialized", "transport", "transportation", "uses", "work". | EXACT TITLE in transportation_infrastructure: "General aviation". | EXACT TITLE in aerospace_defense: "General aviation".
0.500
World War II ↗ EXACT TITLE
advancedcivildocumentearlyeasterneconomicestablishedeventsexpansionforcesfuturehistoryinfluenceinternationalmajormovedpacificpartsregimesecond
SHARED TOKENS (25): "advanced", "civil", "document", "early", "eastern", "economic", "established", "events", "expansion", "forces", "future", "history", "influence", "international", "major", "moved", "pacific", "parts", "regime", "second".... | EXACT TITLE in aerospace_defense: "World War II".
0.500
Robotics ↗ Q170978 EXACT TITLE
activeagricultureapplicationbusinessconstructioncontrolcreatecreatesdevelopmentelectricalespeciallyfieldfoodimpactintelligenceinventoryitselfmanagementmanufacturingmilitary
SHARED TOKENS (32): "active", "agriculture", "application", "business", "construction", "control", "create", "creates", "development", "electrical", "especially", "field", "food", "impact", "intelligence", "inventory", "itself", "management", "manufacturing", "military".... | EXACT TITLE in aerospace_defense: "Robotics".
0.500
airapplicablebuildingcentercenterscommercialcoordinatededicateddeliverydemanddestinationsdirectlydistributionequipmentfacilityfirmsfunctionhandlinginventorylabor
SHARED TOKENS (43): "air", "applicable", "building", "center", "centers", "commercial", "coordinate", "dedicated", "delivery", "demand", "destinations", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "inventory", "labor".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
actagenciesagreementsaviationboisebuildingcentercomplexcontributesexecutivefacilityfederalfoundedgovernmentgroupguidelineshomeidahointeragencylarge
SHARED TOKENS (34): "act", "agencies", "agreements", "aviation", "boise", "building", "center", "complex", "contributes", "executive", "facility", "federal", "founded", "government", "group", "guidelines", "home", "idaho", "interagency", "large".... | EXACT TITLE in aerospace_defense: "National Interagency Fire Center".
0.500
accessactauthoritiescomprehensivecontinuingfederalfederallyformationfundingfuturegovernedgovernmenthighwaylawlocalorganizationparticipationplanningplanspopulation
SHARED TOKENS (28): "access", "act", "authorities", "comprehensive", "continuing", "federal", "federally", "formation", "funding", "future", "governed", "government", "highway", "law", "local", "organization", "participation", "planning", "plans", "population".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
acquisitionactiveairaircraftcertificationcivilespeciallyflightfoundedlicensepartspilotpilotsprimaryprivaterecurringrequirementsschoolschoolsskills
SHARED TOKENS (26): "acquisition", "active", "air", "aircraft", "certification", "civil", "especially", "flight", "founded", "license", "parts", "pilot", "pilots", "primary", "private", "recurring", "requirements", "school", "schools", "skills".... | EXACT TITLE in transportation_infrastructure: "Flight training". | EXACT TITLE in aerospace_defense: "Flight training".
0.500
approachbroadercertaincitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargerlawsmanagemanagementmilitary
SHARED TOKENS (37): "approach", "broader", "certain", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "laws", "manage", "management", "military".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
Skydio ↗ Q97321374 EXACT TITLE
applicationbusinesscommercialcompleteconsumercustomersdepartmentdesigneddocumentforcesinspectionmarketmilitarymissionsreconstructionreportedsubstantial
SHARED TOKENS (17): "application", "business", "commercial", "complete", "consumer", "customers", "department", "designed", "document", "forces", "inspection", "market", "military", "missions", "reconstruction", "reported", "substantial". | EXACT TITLE in aerospace_defense: "Skydio".
0.500
accessagenciesairportscommunitycomponentsconditionsdevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentenvironmentalespeciallyessentialfacilitiesfirms
SHARED TOKENS (50): "access", "agencies", "airports", "community", "components", "conditions", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "especially", "essential", "facilities", "firms".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in aerospace_defense: "Infrastructure".
0.500
Multirotor ↗ Q3772377 EXACT TITLE
addingaircraftcomplexconstructioncontrolflightfrequentlylimitsmechanicspowerprojectsrangereducedsinglesmallverticalwhose
SHARED TOKENS (17): "adding", "aircraft", "complex", "construction", "control", "flight", "frequently", "limits", "mechanics", "power", "projects", "range", "reduced", "single", "small", "vertical", "whose". | EXACT TITLE in aerospace_defense: "Multirotor".
0.500
agriculturalalongsideconcentratedconcernsdevelopeddevelopmentdirectenvironmentenvironmentalgroupgrowthhighimpactindividualinternationallimitedmedicalpolicypopulationprocess
SHARED TOKENS (26): "agricultural", "alongside", "concentrated", "concerns", "developed", "development", "direct", "environment", "environmental", "group", "growth", "high", "impact", "individual", "international", "limited", "medical", "policy", "population", "process".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
actapplicableappliedassociationauthoritychangescitiescommunitycomprehensiveconditionscreatingdependdependsdevelopmenteconomicenvironmentalessentialexposurefacilitiesfounded
SHARED TOKENS (43): "act", "applicable", "applied", "association", "authority", "changes", "cities", "community", "comprehensive", "conditions", "creating", "depend", "depends", "development", "economic", "environmental", "essential", "exposure", "facilities", "founded".... | EXACT TITLE in aerospace_defense: "Land-use planning".
0.500
analysisanotherappliedcollectioncomplexdataenvironmentinformationlinesmaterialsmodelsphysicalpointsprocessrangerecordtechnologyuses
SHARED TOKENS (18): "analysis", "another", "applied", "collection", "complex", "data", "environment", "information", "lines", "materials", "models", "physical", "points", "process", "range", "record", "technology", "uses". | EXACT TITLE in aerospace_defense: "Photogrammetry".
0.500
addinganotherbecomecapacitycongestiondemanddepartmentshighinteractionplanningpublicresultingroadroutetraffictransporttransportationtripvehicles
SHARED TOKENS (19): "adding", "another", "become", "capacity", "congestion", "demand", "departments", "high", "interaction", "planning", "public", "resulting", "road", "route", "traffic", "transport", "transportation", "trip", "vehicles". | EXACT TITLE in aerospace_defense: "Traffic congestion".
0.500
agricultureairaircraftauthorizedaviationbusinesscargocivilcommercialdistinctionestablishflightgeneralindividualinternationallargermajormilitaryoperationoperations
SHARED TOKENS (39): "agriculture", "air", "aircraft", "authorized", "aviation", "business", "cargo", "civil", "commercial", "distinction", "establish", "flight", "general", "individual", "international", "larger", "major", "military", "operation", "operations".... | EXACT TITLE in aerospace_defense: "Civil aviation".
0.500
apprenticeshipsboundariescertificationcompleteextendfieldformalhelpslaborlicensepracticeprofessionalreachregulatedsectorsstudysystemtraining
SHARED TOKENS (18): "apprenticeships", "boundaries", "certification", "complete", "extend", "field", "formal", "helps", "labor", "license", "practice", "professional", "reach", "regulated", "sectors", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship". | EXACT TITLE in aerospace_defense: "Apprenticeship".
0.500
communitydescribesdevelopmenteconomiceconomicsespeciallyfrequentlygrowthhistoricallyincreasesindividualinfrastructurelocalmarketpoliciespolicyprocessqualityregionterms
SHARED TOKENS (21): "community", "describes", "development", "economic", "economics", "especially", "frequently", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "policies", "policy", "process", "quality", "region", "terms".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
actaddressesbroadcivilcollectioncommunicationscompliancecontactdatadevelopeddifferentfinancialgeneralgovernmentsgovernshandlinghomeindividualinformationinternational
SHARED TOKENS (37): "act", "addresses", "broad", "civil", "collection", "communications", "compliance", "contact", "data", "developed", "different", "financial", "general", "governments", "governs", "handling", "home", "individual", "information", "international".... | EXACT TITLE in aerospace_defense: "Privacy law".
0.500
aircraftaviationbuildingcivilgovernmenthighindividualindustrymaintainingmaintenancemakingmanufacturingmilitarypartsproductionstandardssupportingtechnologytesting
SHARED TOKENS (19): "aircraft", "aviation", "building", "civil", "government", "high", "individual", "industry", "maintaining", "maintenance", "making", "manufacturing", "military", "parts", "production", "standards", "supporting", "technology", "testing". | EXACT TITLE in aerospace_defense: "Aerospace manufacturer".
0.500
boisebroaderestablishedhistoricalhistoryidahoimpactlimitedmerelynorthwestofficialoregonpacificratherreachregionsectionssimplysouthwest
SHARED TOKENS (21): "boise", "broader", "established", "historical", "history", "idaho", "impact", "limited", "merely", "northwest", "official", "oregon", "pacific", "rather", "reach", "region", "sections", "simply", "south", "west".... | EXACT TITLE in aerospace_defense: "Pacific Northwest".
0.500
activeagenciesapplicationsaviationcapabilitiesconsequentlydesigneddifferentenforcementenvironmentalequipmenthazardshousingimprovingincreaseslawmarketmilitaryoperatesperformance
SHARED TOKENS (30): "active", "agencies", "applications", "aviation", "capabilities", "consequently", "designed", "different", "enforcement", "environmental", "equipment", "hazards", "housing", "improving", "increases", "law", "market", "military", "operates", "performance".... | EXACT TITLE in aerospace_defense: "Night-vision device".
0.500
acquiredairaircraftalliancecarriersdestinationsextendsformformationhistoryindependentinternationallaterlinesmajornetworkoperatesoperatingprincipalregional
SHARED TOKENS (21): "acquired", "air", "aircraft", "alliance", "carriers", "destinations", "extends", "form", "formation", "history", "independent", "international", "later", "lines", "major", "network", "operates", "operating", "principal", "regional".... | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
administrationaircraftaviationcodecommercialdesignedfaafederalflightgeneralgoverninglightingmaintenancemodeloperationspilotpilotspublicregulatedregulations
SHARED TOKENS (27): "administration", "aircraft", "aviation", "code", "commercial", "designed", "faa", "federal", "flight", "general", "governing", "lighting", "maintenance", "model", "operations", "pilot", "pilots", "public", "regulated", "regulations".... | EXACT TITLE in aerospace_defense: "Federal Aviation Regulations".
0.500
collectioncommunityespeciallyeventsfinancefinancialformfundinglargemedicalmethodsmodelorganizationplatformpracticeprojectprojectsrangerolesupport
SHARED TOKENS (22): "collection", "community", "especially", "events", "finance", "financial", "form", "funding", "large", "medical", "methods", "model", "organization", "platform", "practice", "project", "projects", "range", "role", "support".... | EXACT TITLE in aerospace_defense: "Crowdfunding".
0.500
Airport ↗ Q1248784 EXACT TITLE
activeadjacentairaircraftairportairportsapronsaviationbuildingscommercialcomplexcontainedcontrolemergencyemployersenvironmentalfacilitiesfacilityfixed-basegeneral
SHARED TOKENS (48): "active", "adjacent", "air", "aircraft", "airport", "airports", "aprons", "aviation", "buildings", "commercial", "complex", "contained", "control", "emergency", "employers", "environmental", "facilities", "facility", "fixed-base", "general".... | EXACT TITLE in transportation_infrastructure: "Airport". | EXACT TITLE in aerospace_defense: "Airport".
0.500
administrationaircraftapplicableapprovalauthorityaviationchangescivilcompletecompliancedocumentfaafederallocalmajorpowerproposedregulationsrepairsubstantial
SHARED TOKENS (20): "administration", "aircraft", "applicable", "approval", "authority", "aviation", "changes", "civil", "complete", "compliance", "document", "faa", "federal", "local", "major", "power", "proposed", "regulations", "repair", "substantial". | EXACT TITLE in aerospace_defense: "Supplemental type certificate".
0.500
administrationairaircraftairportairportsauthoritycertainconnectingdatadepartmentenforcementfacilitiesfederalflightforeignfreightgovernmentlawlocalmission
SHARED TOKENS (37): "administration", "air", "aircraft", "airport", "airports", "authority", "certain", "connecting", "data", "department", "enforcement", "facilities", "federal", "flight", "foreign", "freight", "government", "law", "local", "mission".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
anotherarmychaincivilcollectioncustomersdedicatedequipmentfacilityfieldfoodinformationlineslogisticsmaintainingmanagementmaterialsmilitarymodelmovement
SHARED TOKENS (37): "another", "army", "chain", "civil", "collection", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "lines", "logistics", "maintaining", "management", "materials", "military", "model", "movement".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in aerospace_defense: "Logistics".
0.500
administrationagenciesdepartmentdistrictfederalfinancialfunctionsgovernmentlocalofficeoperateoperatorsoverseesprogramsprovidersprovidingpublicrailregionalrequirements
SHARED TOKENS (26): "administration", "agencies", "department", "district", "federal", "financial", "functions", "government", "local", "office", "operate", "operators", "oversees", "programs", "providers", "providing", "public", "rail", "regional", "requirements".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
airportsassetsbroadbroaderbuildingscapitalcommunityconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthabitatinfrastructuremunicipaloperatorphysical
SHARED TOKENS (33): "airports", "assets", "broad", "broader", "buildings", "capital", "community", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "habitat", "infrastructure", "municipal", "operator", "physical".... | EXACT TITLE in transportation_infrastructure: "Public works". | EXACT TITLE in aerospace_defense: "Public works".
0.500
aircraftanalysiscivildevelopmentelectricalengineeringengineersequipmentfieldindustrialmanagementmanufacturingmaterialsmechanicsmechatronicsmedicalmovementphysicalproductrequires
SHARED TOKENS (26): "aircraft", "analysis", "civil", "development", "electrical", "engineering", "engineers", "equipment", "field", "industrial", "management", "manufacturing", "materials", "mechanics", "mechatronics", "medical", "movement", "physical", "product", "requires".... | EXACT TITLE in aerospace_defense: "Mechanical engineering".
0.500
approachcontrolelectricalengineeringfieldintegrationintendedmanufacturingmechanicsmechatronicsproduceproductsystemstechnicaltechnology
SHARED TOKENS (15): "approach", "control", "electrical", "engineering", "field", "integration", "intended", "manufacturing", "mechanics", "mechatronics", "produce", "product", "systems", "technical", "technology". | EXACT TITLE in transportation_infrastructure: "Mechatronics". | EXACT TITLE in aerospace_defense: "Mechatronics".
0.500
academicadvancedanalysisapplicationsarchitecturebecomebegancapabilitycompleteconcernscreateeconomicsengineeringenginesenvironmentfieldformalfoundedfundinggeneral
SHARED TOKENS (41): "academic", "advanced", "analysis", "applications", "architecture", "become", "began", "capability", "complete", "concerns", "create", "economics", "engineering", "engines", "environment", "field", "formal", "founded", "funding", "general".... | EXACT TITLE in aerospace_defense: "Artificial intelligence".
0.500
accessairallowingassociationauthoritiescompetitivecontractingcorridorsdevelopmenteconomicestatefeederfinancialfrequentlyfundinggeneralgovernmenthistoricalindustryinfrastructure
SHARED TOKENS (54): "access", "air", "allowing", "association", "authorities", "competitive", "contracting", "corridors", "development", "economic", "estate", "feeder", "financial", "frequently", "funding", "general", "government", "historical", "industry", "infrastructure".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
appliedconstructioncontextcontroldesignedequipmentfrequentlyfunctionshydraulicindustrialinformationlaborlargeoperationspowerpowerplantprimarystructuresystemsuses
SHARED TOKENS (22): "applied", "construction", "context", "control", "designed", "equipment", "frequently", "functions", "hydraulic", "industrial", "information", "labor", "large", "operations", "power", "powerplant", "primary", "structure", "systems", "uses".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
airportsapproveddepartmentfacilitiesfederalhighwayidentifiedimprovingindividualinterstatelocalmajormilitarynationalnetworkorganizationspipelineplanningrailsafety
SHARED TOKENS (26): "airports", "approved", "department", "facilities", "federal", "highway", "identified", "improving", "individual", "interstate", "local", "major", "military", "national", "network", "organizations", "pipeline", "planning", "rail", "safety".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
buildingbusinessequipmentindustrialinfrastructuremaintainingmaintenancemeaningoperationalpracticesresidentialsupportingtechnicaltermsutilities
SHARED TOKENS (15): "building", "business", "equipment", "industrial", "infrastructure", "maintaining", "maintenance", "meaning", "operational", "practices", "residential", "supporting", "technical", "terms", "utilities". | EXACT TITLE in transportation_infrastructure: "Maintenance". | EXACT TITLE in aerospace_defense: "Maintenance".
0.500
authoritybeganboundariescertaincitiescivilconcentratedconsolidatedcountiesdifferentdistrictentitiesformformergovernmentgovernmentsindependentlawlegallylocal
SHARED TOKENS (32): "authority", "began", "boundaries", "certain", "cities", "civil", "concentrated", "consolidated", "counties", "different", "district", "entities", "form", "former", "government", "governments", "independent", "law", "legally", "local".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in aerospace_defense: "County (United States)".
0.500
actactiveairaircraftarmyauthoritycertaincivilcomponentscontrolcorpsdepartmentdepartmentsestablishedexecutivefieldforcesindependentintegratedintelligence
SHARED TOKENS (36): "act", "active", "air", "aircraft", "army", "authority", "certain", "civil", "components", "control", "corps", "department", "departments", "established", "executive", "field", "forces", "independent", "integrated", "intelligence".... | EXACT TITLE in aerospace_defense: "United States Air Force".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationscomponentsconstructiondeterminingdevelopmentengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalownershipplanningpoints
SHARED TOKENS (30): "analysis", "boundaries", "civil", "communications", "components", "construction", "determining", "development", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "ownership", "planning", "points".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
actactivityairarmybasecivilcontrolcorpsdepartmentdifferentdirectdistinctforcesforeignmissionneedoperationoperationsrescuesignificant
SHARED TOKENS (23): "act", "activity", "air", "army", "base", "civil", "control", "corps", "department", "different", "direct", "distinct", "forces", "foreign", "mission", "need", "operation", "operations", "rescue", "significant".... | EXACT TITLE in aerospace_defense: "United States Special Operations Command".
0.500
architectureelectricalengineeringengineersfieldindividualintegrateintegrationintelligencelargeroperatingrequirespecializedsystemsthemtrainingwork
SHARED TOKENS (17): "architecture", "electrical", "engineering", "engineers", "field", "individual", "integrate", "integration", "intelligence", "larger", "operating", "require", "specialized", "systems", "them", "training", "work". | EXACT TITLE in aerospace_defense: "Computer engineering".
0.500
acquisitionbusinessconsolidatedconsolidationcontextentitiesentityfinancialgrouplargerlawstaxtogethertransfertreatment
SHARED TOKENS (15): "acquisition", "business", "consolidated", "consolidation", "context", "entities", "entity", "financial", "group", "larger", "laws", "tax", "together", "transfer", "treatment". | EXACT TITLE in transportation_infrastructure: "Consolidation (business)". | EXACT TITLE in aerospace_defense: "Consolidation (business)".
0.500
actadministrationagenciescivildepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublicrailregulationsresearchrights
SHARED TOKENS (23): "act", "administration", "agencies", "civil", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "rail", "regulations", "research", "rights".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
advancedagenciesairarmycollegecontractsdepartmentdepartmentsdevelopmentdirectlyexecutivefederalforcesfunctionsgovernmentintelligencelogisticsmanagementmilitarymission
SHARED TOKENS (38): "advanced", "agencies", "air", "army", "college", "contracts", "department", "departments", "development", "directly", "executive", "federal", "forces", "functions", "government", "intelligence", "logistics", "management", "military", "mission".... | EXACT TITLE in aerospace_defense: "United States Department of Defense".
0.500
actaddressingarmychangescontrolcorpsdirectlyengineersenvironmentalfederalformfundinggoverninggovernmentslawlawsmaintainingmajorownedparts
SHARED TOKENS (32): "act", "addressing", "army", "changes", "control", "corps", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "governments", "law", "laws", "maintaining", "major", "owned", "parts".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbridgecommunitycomplexconnectingconnectionconstructioncreatedesignedearlyengineeringengineersenvironmentfrequentlyindustrialintendedlocalmajormilesnetwork
SHARED TOKENS (37): "allowing", "bridge", "community", "complex", "connecting", "connection", "construction", "create", "designed", "early", "engineering", "engineers", "environment", "frequently", "industrial", "intended", "local", "major", "miles", "network".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in aerospace_defense: "Bridge".
0.500
academicapplicationsaviationbegancomponentscontrolcriticaldedicateddistinctelectricalengineeringengineersfieldhelpshistoryincorporatesinstitutionsknowledgemajormaterials
SHARED TOKENS (30): "academic", "applications", "aviation", "began", "components", "control", "critical", "dedicated", "distinct", "electrical", "engineering", "engineers", "field", "helps", "history", "incorporates", "institutions", "knowledge", "major", "materials".... | EXACT TITLE in aerospace_defense: "Materials science".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationapplieschangescollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddistributionenvironmentalfieldformgrowthhelpshigh
SHARED TOKENS (46): "agricultural", "agriculture", "application", "applies", "changes", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "distribution", "environmental", "field", "form", "growth", "helps", "high".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in aerospace_defense: "Irrigation".
0.500
abilityagreementauthoritybusinessescertainconstructioncontractsdirecteconomiceconomygovernmentgovernmentsgroupgrowthinternationallawslocalorganizationorganizationspractices
SHARED TOKENS (36): "ability", "agreement", "authority", "businesses", "certain", "construction", "contracts", "direct", "economic", "economy", "government", "governments", "group", "growth", "international", "laws", "local", "organization", "organizations", "practices".... | EXACT TITLE in aerospace_defense: "Government procurement".
0.500
accessallowingbegancommunicationsdatadecadesdevelopersdevelopmentearlyelectricalformindependentindividualinformationmeansmediaphysicalpowerreducedsingle
SHARED TOKENS (23): "access", "allowing", "began", "communications", "data", "decades", "developers", "development", "early", "electrical", "form", "independent", "individual", "information", "means", "media", "physical", "power", "reduced", "single".... | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Airspace ↗ Q272730 EXACT TITLE
airairspaceallocationauthoritiesaviationcivilclassificationcontrolcontrolledenforcementestablishedfaaflightguidelinesinformationinternationallegalmanagementmeasuresmilitary
SHARED TOKENS (32): "air", "airspace", "allocation", "authorities", "aviation", "civil", "classification", "control", "controlled", "enforcement", "established", "faa", "flight", "guidelines", "information", "international", "legal", "management", "measures", "military".... | EXACT TITLE in transportation_infrastructure: "Airspace". | EXACT TITLE in aerospace_defense: "Airspace".
0.500
activebusinesscapitalchangescontroldevelopmentexpansionfinancefinancialfinancingfirmsgeneralinvestmentlimitedmanagementoperationalownershipprivateproductproducts
SHARED TOKENS (27): "active", "business", "capital", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firms", "general", "investment", "limited", "management", "operational", "ownership", "private", "product", "products".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureairportsbuildingbuildingsbusinessescitiescomponentscranesdesigneddirectlyfacilityfunctionindustriallargemanufacturersmanufacturingmaterialspartsproductiontransport
SHARED TOKENS (22): "agriculture", "airports", "building", "buildings", "businesses", "cities", "components", "cranes", "designed", "directly", "facility", "function", "industrial", "large", "manufacturers", "manufacturing", "materials", "parts", "production", "transport".... | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in aerospace_defense: "Warehouse".
0.500
agenciesairportsbuildingscivilcomponentsconstructiondepartmentsengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalplaceprivate
SHARED TOKENS (26): "agencies", "airports", "buildings", "civil", "components", "construction", "departments", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical", "place", "private".... | EXACT TITLE in transportation_infrastructure: "Civil engineering". | EXACT TITLE in aerospace_defense: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
businesscorporationdirectlyexecutivefederalfoundedlimitedlinesmilesnationalnetworkoperateoperatesoperatororganizationownedpartsrailreportingrevenue
SHARED TOKENS (29): "business", "corporation", "directly", "executive", "federal", "founded", "limited", "lines", "miles", "national", "network", "operate", "operates", "operator", "organization", "owned", "parts", "rail", "reporting", "revenue".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
airaircraftapplicableaviationcertaincertificationcommercialcompliancedocumentestablishedgeneralintendedlawmanufacturingnationalprimaryproductionprogramrequirements
SHARED TOKENS (19): "air", "aircraft", "applicable", "aviation", "certain", "certification", "commercial", "compliance", "document", "established", "general", "intended", "law", "manufacturing", "national", "primary", "production", "program", "requirements". | EXACT TITLE in aerospace_defense: "Type certificate".
0.500
accidentanalysisappliedassetbecomecontrollingcriticaldesignedengineeringenvironmentenvironmentalequipmentespeciallyexecutivefunctionshazardsincidentmajormanagementmethods
SHARED TOKENS (37): "accident", "analysis", "applied", "asset", "become", "controlling", "critical", "designed", "engineering", "environment", "environmental", "equipment", "especially", "executive", "functions", "hazards", "incident", "major", "management", "methods".... | EXACT TITLE in aerospace_defense: "Safety-critical system".
0.500
airaircraftaopaassociationaviationbusinesseconomyflightgeneralinternationalorganizationorganizationsownerspilotpilotsrolesafetyservespaceutility
SHARED TOKENS (20): "air", "aircraft", "aopa", "association", "aviation", "business", "economy", "flight", "general", "international", "organization", "organizations", "owners", "pilot", "pilots", "role", "safety", "serve", "space", "utility". | EXACT TITLE in transportation_infrastructure: "Aircraft Owners and Pilots Association".
0.500
agenciesapplyapproachbusinessescomprehensivedestinationsfacilitiesfuturegovernmentincorporatesinfluencelinesmovemovementplanningpoliciesprepareprivateprocesspublic
SHARED TOKENS (24): "agencies", "apply", "approach", "businesses", "comprehensive", "destinations", "facilities", "future", "government", "incorporates", "influence", "lines", "move", "movement", "planning", "policies", "prepare", "private", "process", "public".... | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Evidence ↗ Q1347572 EXACT TITLE
accessapproachcertainconnectiondescribesdifferentestablisheventsevidencegeneralincreasesinformationknowledgelawlimitedmakesphysicalprivateproblemsproposition
SHARED TOKENS (25): "access", "approach", "certain", "connection", "describes", "different", "establish", "events", "evidence", "general", "increases", "information", "knowledge", "law", "limited", "makes", "physical", "private", "problems", "proposition".... | EXACT TITLE in transportation_infrastructure: "Evidence". | EXACT TITLE in aerospace_defense: "Evidence".
0.500
accessagenciesbeyondcitiescommunitycustomersdesigneddevelopedeconomicextendsformformalgovernmentlocaloperateoperatedoperatesoperatorsorganizationsprivate
SHARED TOKENS (33): "access", "agencies", "beyond", "cities", "community", "customers", "designed", "developed", "economic", "extends", "form", "formal", "government", "local", "operate", "operated", "operates", "operators", "organizations", "private".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
activeairapplicablearmybecomecomponentsdistrictfederalmakesmilitarynationaloverseesregionrole
SHARED TOKENS (14): "active", "air", "applicable", "army", "become", "components", "district", "federal", "makes", "military", "national", "oversees", "region", "role". | EXACT TITLE in aerospace_defense: "Air National Guard".
0.480
Hangar ↗ Q192375 EXACT TITLE
aircraftbuildingdesigneddirectgrouphangarhangarshomemaintenancenearrepairstoragestructureweather
SHARED TOKENS (14): "aircraft", "building", "designed", "direct", "group", "hangar", "hangars", "home", "maintenance", "near", "repair", "storage", "structure", "weather". | EXACT TITLE in transportation_infrastructure: "Hangar". | EXACT TITLE in aerospace_defense: "Hangar".
0.480
engineeringfunctionlaborlargemanufacturingmaterialspartsprocessproductproductsshapestructuresweldingwork
SHARED TOKENS (14): "engineering", "function", "labor", "large", "manufacturing", "materials", "parts", "process", "product", "products", "shape", "structures", "welding", "work". | EXACT TITLE in aerospace_defense: "Metal fabrication".
0.480
airaircraftaviationcapacitycargodevelopmentforcesintersectionmeansmilitarynationalprovidesupplytransport
SHARED TOKENS (14): "air", "aircraft", "aviation", "capacity", "cargo", "development", "forces", "intersection", "means", "military", "national", "provide", "supply", "transport". | EXACT TITLE in aerospace_defense: "Military aviation".
0.460
associationcorridorsenvironmentalespeciallyfrequentlyindustriallandmultiplerightsruralserveusersutility
SHARED TOKENS (13): "association", "corridors", "environmental", "especially", "frequently", "industrial", "land", "multiple", "rights", "rural", "serve", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.460
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferenthighintegratednetworkproviderequirementstechnologytransferuseswireless
SHARED TOKENS (13): "access", "context", "data", "different", "high", "integrated", "network", "provide", "requirements", "technology", "transfer", "uses", "wireless". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.460
aircraftappearauthorityaviationcivilcodefunctionsindividualinternationallicenseregistrationrelevantsingle
SHARED TOKENS (13): "aircraft", "appear", "authority", "aviation", "civil", "code", "functions", "individual", "international", "license", "registration", "relevant", "single". | EXACT TITLE in transportation_infrastructure: "Aircraft registration". | EXACT TITLE in aerospace_defense: "Aircraft registration".
0.460
controlsdifferentheightintersectionmajorpracticereflectsroadseparatespecifiedtrafficusesvehicles
SHARED TOKENS (13): "controls", "different", "height", "intersection", "major", "practice", "reflects", "road", "separate", "specified", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in aerospace_defense: "Intersection (road)".
0.460
conditionsdependdesigneddevelopmentdifferentfuellargeprocedurespropertyprotectedsignificantvehicleswork
SHARED TOKENS (13): "conditions", "depend", "designed", "development", "different", "fuel", "large", "procedures", "property", "protected", "significant", "vehicles", "work". | EXACT TITLE in aerospace_defense: "Wildfire suppression".
0.460
applycontrolcontrolledcontrolsdepartmentdestinationsgovernmentgovernmentslocalregulatedregulatesrequirestechnology
SHARED TOKENS (13): "apply", "control", "controlled", "controls", "department", "destinations", "government", "governments", "local", "regulated", "regulates", "requires", "technology". | EXACT TITLE in aerospace_defense: "Export control".
0.450
appliesbusinesscollectioncustomerdocumentationearlyespeciallyframeworkindustryinformationintegrationlaborlinemanagementmodelneededorganizationpoliciesproblemsproduct
SHARED TOKENS (31): "applies", "business", "collection", "customer", "documentation", "early", "especially", "framework", "industry", "information", "integration", "labor", "line", "management", "model", "needed", "organization", "policies", "problems", "product".... | URL->A (1): https://ispe.org/.
0.440
Bell 206 ↗ Q660969 EXACT TITLE
aircraftairframearmycommerciallydevelopedflightlatermodelplansprogramsingleutility
SHARED TOKENS (12): "aircraft", "airframe", "army", "commercially", "developed", "flight", "later", "model", "plans", "program", "single", "utility". | EXACT TITLE in aerospace_defense: "Bell 206".
0.440
Pedestrian ↗ Q221488 EXACT TITLE
citiescreatingearlyhistoricallynetworkprofessionalrecordruralsafetytraffictransportvehicles
SHARED TOKENS (12): "cities", "creating", "early", "historically", "network", "professional", "record", "rural", "safety", "traffic", "transport", "vehicles". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.440
Avionics ↗ Q221329 EXACT TITLE
aircraftaviationcommunicationsearlyfunctionsindividualmanagementmultipleplatformpolicesystemsystems
SHARED TOKENS (12): "aircraft", "aviation", "communications", "early", "functions", "individual", "management", "multiple", "platform", "police", "system", "systems". | EXACT TITLE in aerospace_defense: "Avionics".
0.420
analysisdatadescribingdevelopmentexplicitlyfieldframeworkintelligencemethodsperformancestudy
SHARED TOKENS (11): "analysis", "data", "describing", "development", "explicitly", "field", "framework", "intelligence", "methods", "performance", "study". | EXACT TITLE in aerospace_defense: "Machine learning".
0.420
Utility ↗ Q466707 EXACT TITLE
amongcertaincontextdevelopeddistincteconomicsfunctionfunctionsmaintainingrelationshiputility
SHARED TOKENS (11): "among", "certain", "context", "developed", "distinct", "economics", "function", "functions", "maintaining", "relationship", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in aerospace_defense: "Utility".
0.420
activityamongfoundedhighidahomeridianprogramspublicresearchstudentsuniversity
SHARED TOKENS (11): "activity", "among", "founded", "high", "idaho", "meridian", "programs", "public", "research", "students", "university". | EXACT TITLE in transportation_infrastructure: "Idaho State University". | EXACT TITLE in aerospace_defense: "Idaho State University".
0.420
differsfieldhighwayintersectionmovementpermitroadsystemtraffictransportuses
SHARED TOKENS (11): "differs", "field", "highway", "intersection", "movement", "permit", "road", "system", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.420
citiescoveredfieldgeneralgroupinformationinternationalnationalrescuesearchwater
SHARED TOKENS (11): "cities", "covered", "field", "general", "group", "information", "international", "national", "rescue", "search", "water". | EXACT TITLE in transportation_infrastructure: "Search and rescue". | EXACT TITLE in aerospace_defense: "Search and rescue".
0.420
boiseeasternexpansionformeridahooperatingoregonrailrestorationrouteserve
SHARED TOKENS (11): "boise", "eastern", "expansion", "former", "idaho", "operating", "oregon", "rail", "restoration", "route", "serve". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.420
Floodplain ↗ Q193110 EXACT TITLE
adjacentagriculturalbasecontroldevelopedfrequentlyhighlandnearvalleywater
SHARED TOKENS (11): "adjacent", "agricultural", "base", "control", "developed", "frequently", "high", "land", "near", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.400
businessdistributioneasternelectricalidahooperatesoregonpowerregulatedutility
SHARED TOKENS (10): "business", "distribution", "eastern", "electrical", "idaho", "operates", "oregon", "power", "regulated", "utility". | EXACT TITLE in aerospace_defense: "Idaho Power".
0.400
Snowplow ↗ Q14976 EXACT TITLE
especiallyfrequentlyintendedlargerailservingspecificsurfacestransportationvehicles
SHARED TOKENS (10): "especially", "frequently", "intended", "large", "rail", "serving", "specific", "surfaces", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
Sidewalk ↗ Q177749 EXACT TITLE
adjacentbuildingsdesignedlandprivateroadroadwaysidesouthstreet
SHARED TOKENS (10): "adjacent", "buildings", "designed", "land", "private", "road", "roadway", "side", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.380
airarmyboisechaingeneralidahomilitarynationaloffice
SHARED TOKENS (9): "air", "army", "boise", "chain", "general", "idaho", "military", "national", "office". | EXACT TITLE in aerospace_defense: "Idaho Air National Guard".
0.380
airarmydifferentfederalmilitarynationalorganizationsresponsiblesimultaneously
SHARED TOKENS (9): "air", "army", "different", "federal", "military", "national", "organizations", "responsible", "simultaneously". | EXACT TITLE in aerospace_defense: "Army National Guard".
0.370
airarmyboisedepartmentgovernmentidahomilitarynationalpreparesecurityserve
SHARED TOKENS (11): "air", "army", "boise", "department", "government", "idaho", "military", "national", "prepare", "security", "serve". | URL->B (2): https://www.imd.idaho.gov/idaho-air-national-guard/, https://www.imd.idaho.gov/idaho-national-guard/our-history/.
0.360
agriculturalairaircraftbegandesignedfoundedmanufacturingmodel
SHARED TOKENS (8): "agricultural", "air", "aircraft", "began", "designed", "founded", "manufacturing", "model". | EXACT TITLE in aerospace_defense: "Air Tractor".
0.340
aircraftcompliancecontinuinginspectionmaintenanceperformancerepair
SHARED TOKENS (7): "aircraft", "compliance", "continuing", "inspection", "maintenance", "performance", "repair". | EXACT TITLE in transportation_infrastructure: "Aircraft maintenance". | EXACT TITLE in aerospace_defense: "Aircraft maintenance".
0.340
Runway ↗ Q184590 EXACT TITLE
aircraftaviationdesignedfeetrunwayrunwayswater
SHARED TOKENS (7): "aircraft", "aviation", "designed", "feet", "runway", "runways", "water". | EXACT TITLE in transportation_infrastructure: "Runway". | EXACT TITLE in aerospace_defense: "Runway".
0.320
agriculturalairaircraftapplicationenginesjet
SHARED TOKENS (6): "agricultural", "air", "aircraft", "application", "engines", "jet". | EXACT TITLE in aerospace_defense: "Agricultural aircraft".
0.320
conditionsmaterialsoperatesystemvisiblevisual
SHARED TOKENS (6): "conditions", "materials", "operate", "system", "visible", "visual". | EXACT TITLE in aerospace_defense: "Image intensifier".
0.320
civilengineeringfieldnetworktraffictransportation
SHARED TOKENS (6): "civil", "engineering", "field", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.320
aircraftaviationbusinessbusinessesgeneraltransport
SHARED TOKENS (6): "aircraft", "aviation", "business", "businesses", "general", "transport". | EXACT TITLE in aerospace_defense: "Business aircraft".
0.300
accesscargochaindirecteconomicsespeciallyfreightgeneralgrouphighwayintendedinternationalitselflogisticsoperatingpracticepracticesrailregionspecialized
SHARED TOKENS (24): "access", "cargo", "chain", "direct", "economics", "especially", "freight", "general", "group", "highway", "intended", "international", "itself", "logistics", "operating", "practice", "practices", "rail", "region", "specialized"....
0.300
annualassociationcommunicationsconsumerdecadesdevelopmentgrowthindustryintegratedlawmakingmarketmultiplepowerproducingproductionreachrecordresearchrevenue
SHARED TOKENS (26): "annual", "association", "communications", "consumer", "decades", "development", "growth", "industry", "integrated", "law", "making", "market", "multiple", "power", "producing", "production", "reach", "record", "research", "revenue"....
0.300
acquisitionaircraftapplicationschaincommercialcontrolledconventionalcreatededicateddirectearlyforcesformfuturehighidentifiedimpactintelligencelargelarger
SHARED TOKENS (46): "acquisition", "aircraft", "applications", "chain", "commercial", "controlled", "conventional", "create", "dedicated", "direct", "early", "forces", "form", "future", "high", "identified", "impact", "intelligence", "large", "larger"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
becomebuildingcitiescommercialdevelopmentenvironmentenvironmentalexpansionformgrowthhousingindustrialinfrastructurelandlargemaintainingplanningpopulationprivateproperty
SHARED TOKENS (33): "become", "building", "cities", "commercial", "development", "environment", "environmental", "expansion", "form", "growth", "housing", "industrial", "infrastructure", "land", "large", "maintaining", "planning", "population", "private", "property"....
0.300
affectairaircraftairspaceauthoritycommercialconditionscontrolcontrolleddirectemergencyflightinformationmaintainsmilitaryneedoperationoperationspilotpilots
SHARED TOKENS (31): "affect", "air", "aircraft", "airspace", "authority", "commercial", "conditions", "control", "controlled", "direct", "emergency", "flight", "information", "maintains", "military", "need", "operation", "operations", "pilot", "pilots"....
0.300
acquisitionagencieschaptercodedescribesdocumentexecutivefederalfrequentlygovernmentmultipleneededprincipalproceduresprocurementproductsregulationsrulessupplierssystem
SHARED TOKENS (22): "acquisition", "agencies", "chapter", "code", "describes", "document", "executive", "federal", "frequently", "government", "multiple", "needed", "principal", "procedures", "procurement", "products", "regulations", "rules", "suppliers", "system"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalapprovedconditionscustomersdetermineindependentinspectionmaintenancepartsproblemproposedrepairroleshowingspecifictechnicianwork
SHARED TOKENS (17): "approval", "approved", "conditions", "customers", "determine", "independent", "inspection", "maintenance", "parts", "problem", "proposed", "repair", "role", "showing", "specific", "technician", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
becomeengineersenvironmentintegrationintersectionlinesmakesneednoisereducereducedrequireresearchresultingroadrulessafetysignificantthemtraffic
SHARED TOKENS (23): "become", "engineers", "environment", "integration", "intersection", "lines", "makes", "need", "noise", "reduce", "reduced", "require", "research", "resulting", "road", "rules", "safety", "significant", "them", "traffic"....
0.300
aircraftairportairspacecenterconditionsdispatchdispatchersflightforecastslegalmanagementoperationsperformancepilotsplanningprovideresponsibilitysystemwork
SHARED TOKENS (19): "aircraft", "airport", "airspace", "center", "conditions", "dispatch", "dispatchers", "flight", "forecasts", "legal", "management", "operations", "performance", "pilots", "planning", "provide", "responsibility", "system", "work".
0.300
creatingdemandformfunctionsmannermedicalmovementnetworkprivateprogramsprovidepublicratherrelevantrouteruralsharedtechnologytransportusers
SHARED TOKENS (21): "creating", "demand", "form", "functions", "manner", "medical", "movement", "network", "private", "programs", "provide", "public", "rather", "relevant", "route", "rural", "shared", "technology", "transport", "users"....
0.300
abilitycommunitydifferentemergencyeventsfederalgovernmentshazardslocalmanagementmitigationorganizationsprofessionalprovidingreducerequiresrescueresponsesearchterms
SHARED TOKENS (20): "ability", "community", "different", "emergency", "events", "federal", "governments", "hazards", "local", "management", "mitigation", "organizations", "professional", "providing", "reduce", "requires", "rescue", "response", "search", "terms".
0.300
businessescenterschangescitiesdevelopmenteconomicenvironmentalexpansionformationgrowthmodelmovementpopulationprocessruralshiftsouth
SHARED TOKENS (17): "businesses", "centers", "changes", "cities", "development", "economic", "environmental", "expansion", "formation", "growth", "model", "movement", "population", "process", "rural", "shift", "south".
0.300
Arms industry ↗ Q392933 KW CROSS HIGH
academicbasecommercialcommunicationscustomersdevelopmentengineeringentitiesequipmentfacilitiesfirmsforcesfunctionsgovernmentsindustrialindustryinstitutionslegalmilitarynetwork
SHARED TOKENS (37): "academic", "base", "commercial", "communications", "customers", "development", "engineering", "entities", "equipment", "facilities", "firms", "forces", "functions", "governments", "industrial", "industry", "institutions", "legal", "military", "network"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscitiesconnectingdifferentfreightinsidelinelinesmultipleoperateoperatesrailregionalsystemstrainstransport
SHARED TOKENS (16): "business", "cities", "connecting", "different", "freight", "inside", "line", "lines", "multiple", "operate", "operates", "rail", "regional", "systems", "trains", "transport".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedapproachclassificationscontrolcriticalenforcementguidelinesidentifiedimpactimprovingmeasuresmethodsoccupationalpracticesproduceprovidingpublicrapidlyremainrequiring
SHARED TOKENS (35): "applied", "approach", "classifications", "control", "critical", "enforcement", "guidelines", "identified", "impact", "improving", "measures", "methods", "occupational", "practices", "produce", "providing", "public", "rapidly", "remain", "requiring"....
0.300
Aviation fuel ↗ Q1875633 KW CROSS HIGH
airaircraftapplicationsaviationdesignedenginesfuelhandlingjetoperateperformancepowerpreserverequirementsroadspecifictransportation
SHARED TOKENS (17): "air", "aircraft", "applications", "aviation", "designed", "engines", "fuel", "handling", "jet", "operate", "performance", "power", "preserve", "requirements", "road", "specific", "transportation".
0.300
buildingbusinesscenterdedicateddesigneddevelopmentformgrowthintegratedlandnetworkplanningprivateproblempublicrailrelationshipresidentialservingspace
SHARED TOKENS (21): "building", "business", "center", "dedicated", "designed", "development", "form", "growth", "integrated", "land", "network", "planning", "private", "problem", "public", "rail", "relationship", "residential", "serving", "space"....
0.300
aircreateenginesfueluses
SHARED TOKENS (5): "air", "create", "engines", "fuel", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.300
activeairapplicationsarmycenterconcentrateddecadesdevelopmentenergyengineeringforcesmilitarypersonnelremainsresearchsystemstechnologythemvehicles
SHARED TOKENS (19): "active", "air", "applications", "army", "center", "concentrated", "decades", "development", "energy", "engineering", "forces", "military", "personnel", "remains", "research", "systems", "technology", "them", "vehicles".
0.300
Utility pole ↗ Q1144084 KW CROSS HIGH
applicationconcernscustomersdifferentdistributionelectricalequipmentlargelinelinesmovedpowerpublicreduceresidentialsafetysouthstreetsupportsystem
SHARED TOKENS (26): "application", "concerns", "customers", "different", "distribution", "electrical", "equipment", "large", "line", "lines", "moved", "power", "public", "reduce", "residential", "safety", "south", "street", "support", "system"....
0.300
advancedapprovedarmybecomebeganchaindevelopeddevelopmentinternationallaterlicensemodelmultipleoperatedprimaryproductionprogramprovidesecuritysensors
SHARED TOKENS (22): "advanced", "approved", "army", "become", "began", "chain", "developed", "development", "international", "later", "license", "model", "multiple", "operated", "primary", "production", "program", "provide", "security", "sensors"....
0.300
agreementarmyauthoritycontroldefinitionsdevelopmentfieldforcesindividualinformationlawfulmeaningmilitarymissionmissionsorganizationpersonnelphysicalproblemsprocedures
SHARED TOKENS (24): "agreement", "army", "authority", "control", "definitions", "development", "field", "forces", "individual", "information", "lawful", "meaning", "military", "mission", "missions", "organization", "personnel", "physical", "problems", "procedures"....
0.300
activeairaircraftamongbusinesscontroldesigneddevelopedfacilityflightforcesgeneralhelpsmanufacturingmilitarymissionsmultiplenationaloperationaloperators
SHARED TOKENS (31): "active", "air", "aircraft", "among", "business", "control", "designed", "developed", "facility", "flight", "forces", "general", "helps", "manufacturing", "military", "missions", "multiple", "national", "operational", "operators"....
0.300
acquiredaircraftbroadercivildevelopedjetmarketmarketsmilitaryoperatingproductionrunwaystrainingtransportwork
SHARED TOKENS (15): "acquired", "aircraft", "broader", "civil", "developed", "jet", "market", "markets", "military", "operating", "production", "runways", "training", "transport", "work".
0.300
cannotcertaincivilenforcementevidencelawlawspoliceprivateprocesspropertyproviderequirerulesearchwarrants
SHARED TOKENS (16): "cannot", "certain", "civil", "enforcement", "evidence", "law", "laws", "police", "private", "process", "property", "provide", "require", "rule", "search", "warrants".
0.300
administrationairanotherbuildingcenterscommercialconstructiondepartmentdistributiondivisioneconomyeducationenginesenvironmentalfederalfreightgoverninggovernshandlinghighway
SHARED TOKENS (51): "administration", "air", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "economy", "education", "engines", "environmental", "federal", "freight", "governing", "governs", "handling", "highway"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycertaindifferentestatefacilitygovernmenthighwaylandlegallineslocaloperateownershippartsphysicalprivaterealrightsroadroute
SHARED TOKENS (28): "authority", "certain", "different", "estate", "facility", "government", "highway", "land", "legal", "lines", "local", "operate", "ownership", "parts", "physical", "private", "real", "rights", "road", "route"....
0.300
applicationcertificationcustomerdesigneddevelopeddocumentguidelinesintegratedinternationalmakingmanagementorganizationorganizationsprocessproductqualityregulatoryrequirementsstandardsstatutory
SHARED TOKENS (24): "application", "certification", "customer", "designed", "developed", "document", "guidelines", "integrated", "international", "making", "management", "organization", "organizations", "process", "product", "quality", "regulatory", "requirements", "standards", "statutory"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
architecturebecomecitiescompetitivecreatecreatescurrentdecadesdescribesdevelopeddevelopmenteconomiceconomicseducationenvironmentalessentialgenerategeographygrowthimpact
SHARED TOKENS (52): "architecture", "become", "cities", "competitive", "create", "creates", "current", "decades", "describes", "developed", "development", "economic", "economics", "education", "environmental", "essential", "generate", "geography", "growth", "impact"....
0.300
alongsidecapacitycapitalcitiesconnectingconventionalcorridorsdedicateddesignedintegratenetworkpublicqualityrailreducereliabilitysinglesystemsystemstraffic
SHARED TOKENS (21): "alongside", "capacity", "capital", "cities", "connecting", "conventional", "corridors", "dedicated", "designed", "integrate", "network", "public", "quality", "rail", "reduce", "reliability", "single", "system", "systems", "traffic"....
0.300
accidentadoptedadvancedapplicationappliedcapacitychangescollectionconditionsdifferentemergencyfieldinformationinfrastructurelawsmanagementprovidereduceroadsafety
SHARED TOKENS (29): "accident", "adopted", "advanced", "application", "applied", "capacity", "changes", "collection", "conditions", "different", "emergency", "field", "information", "infrastructure", "laws", "management", "provide", "reduce", "road", "safety"....
0.300
creatingdepartmentdesigneddifferentevenmovementpathwaypermitprimaryproviderailroutesharedtransporttravelusers
SHARED TOKENS (16): "creating", "department", "designed", "different", "even", "movement", "pathway", "permit", "primary", "provide", "rail", "route", "shared", "transport", "travel", "users".
0.300
appearsespeciallyevenfacilitiesintersectionlargelawsplacepointsroadrulessafelysafetyschoolseparatestreetsurfacestogethertrafficusers
SHARED TOKENS (21): "appears", "especially", "even", "facilities", "intersection", "large", "laws", "place", "points", "road", "rules", "safely", "safety", "school", "separate", "street", "surfaces", "together", "traffic", "users"....
0.300
Aviation law ↗ Q1761534 KW CROSS HIGH
administrationairairportaviationbeyondbusinesscannotcertaincivilconcernsdirectlyfederalfieldflightfunctiongeneralgovernsinternationallawlaws
SHARED TOKENS (36): "administration", "air", "airport", "aviation", "beyond", "business", "cannot", "certain", "civil", "concerns", "directly", "federal", "field", "flight", "function", "general", "governs", "international", "law", "laws"....
0.300
appliedappliesapprovalassociationcontextdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactinternationalmajormakingmanagementmoveparticipationplan
SHARED TOKENS (35): "applied", "applies", "approval", "association", "context", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "international", "major", "making", "management", "move", "participation", "plan"....
0.300
actagreementsauthoritycertaincontroldevelopmentdocumentationenforcementforeigngovernmentsindustryinternationallawmanufacturersplacesprogramprojectreportrequiresrequiring
SHARED TOKENS (25): "act", "agreements", "authority", "certain", "control", "development", "documentation", "enforcement", "foreign", "governments", "industry", "international", "law", "manufacturers", "places", "program", "project", "report", "requires", "requiring"....
0.300
accessadvancedcapacitychangescitiescompletedconnectedconnectingcontainingdecadesdesignedevenhighwayimplieslimitsnetworkparkingplanspropertyproposed
SHARED TOKENS (37): "access", "advanced", "capacity", "changes", "cities", "completed", "connected", "connecting", "containing", "decades", "designed", "even", "highway", "implies", "limits", "network", "parking", "plans", "property", "proposed"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasterngeneralhighwayidahointersectioninterstatemajormilesnationalnearnorthwestofficialoregonpacificpositioningroadrouteruleswest
SHARED TOKENS (21): "caldwell", "eastern", "general", "highway", "idaho", "intersection", "interstate", "major", "miles", "national", "near", "northwest", "official", "oregon", "pacific", "positioning", "road", "route", "rules", "west"....
0.300
approvedbegandepartmenteducationenergyenforcementengineersenvironmentalestablishingexecutivefederalfederallyfinancialgovernmentgovernmentsindependentinformationlawslegallocal
SHARED TOKENS (36): "approved", "began", "department", "education", "energy", "enforcement", "engineers", "environmental", "establishing", "executive", "federal", "federally", "financial", "government", "governments", "independent", "information", "laws", "legal", "local"....
0.300
advancedallowinganalysisanotherapplicationappliedcivilcollectionconditionsdirectdocumentingelectricalengineeringequipmentexaminedfieldformfrequentlygrouphandling
SHARED TOKENS (47): "advanced", "allowing", "analysis", "another", "application", "applied", "civil", "collection", "conditions", "direct", "documenting", "electrical", "engineering", "equipment", "examined", "field", "form", "frequently", "group", "handling"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciescanyoncommercialconstructioncontrolcovereddecadesdevelopedeasterngovernmentshabitathighhistoryidahoirrigationlargelimitedmajormilesmilitary
SHARED TOKENS (45): "agencies", "canyon", "commercial", "construction", "control", "covered", "decades", "developed", "eastern", "governments", "habitat", "high", "history", "idaho", "irrigation", "large", "limited", "major", "miles", "military"....
0.300
departmentdepartmentsdirectlyeconomyexecutivefederalgovernmentmissionmovementplanreportssafeservingstrategicsystemtransportation
SHARED TOKENS (16): "department", "departments", "directly", "economy", "executive", "federal", "government", "mission", "movement", "plan", "reports", "safe", "serving", "strategic", "system", "transportation".
0.300
componentscriticaldataembeddedessentialexpandedfieldfinancefunctionsinformationinfrastructuremanagemeasuresnetworkphysicalpowerprovidereflectssecuritysignificance
SHARED TOKENS (25): "components", "critical", "data", "embedded", "essential", "expanded", "field", "finance", "functions", "information", "infrastructure", "manage", "measures", "network", "physical", "power", "provide", "reflects", "security", "significance"....
0.300
agricultureaircraftapplicationsassetsbecomecontrolcontrolleddevelopedenvironmentalessentialexpandedinfrastructuremilitarymissionsmonitoringpilotproductsimplysystemweather
SHARED TOKENS (20): "agriculture", "aircraft", "applications", "assets", "become", "control", "controlled", "developed", "environmental", "essential", "expanded", "infrastructure", "military", "missions", "monitoring", "pilot", "product", "simply", "system", "weather".
0.300
Pilatus PC-12 ↗ Q685211 KW CROSS HIGH
agenciesaircraftcargocorporatedepartmentsdesignedexecutiveforcesgovernmentincorporateslargeoperatorspoliceregionalsmalltransporttransportationutility
SHARED TOKENS (18): "agencies", "aircraft", "cargo", "corporate", "departments", "designed", "executive", "forces", "government", "incorporates", "large", "operators", "police", "regional", "small", "transport", "transportation", "utility".
0.300
actadabroadbusinesschangescivilcoveredemployerslaterlawnationalprotectionsprovidepublicrequirementsrequiresrights
SHARED TOKENS (17): "act", "ada", "broad", "business", "changes", "civil", "covered", "employers", "later", "law", "national", "protections", "provide", "public", "requirements", "requires", "rights".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontrolinformationintersectionlawslocalmovementsnationalneedpolicepositionedreduceroadsouthsystemsystemstechnologytrafficusers
SHARED TOKENS (20): "advanced", "capacity", "control", "information", "intersection", "laws", "local", "movements", "national", "need", "police", "positioned", "reduce", "road", "south", "system", "systems", "technology", "traffic", "users".
0.300
airbuildingcertaincircumstancesconditionscontainingcreatesenvironmentevenmaterialspersonnelphysicalpropertypublicregulationssafetyspecificsystemthemtrained
SHARED TOKENS (21): "air", "building", "certain", "circumstances", "conditions", "containing", "creates", "environment", "even", "materials", "personnel", "physical", "property", "public", "regulations", "safety", "specific", "system", "them", "trained"....
0.300
accessactadministrationadoptedavoidingbegancollectioncompleteconstructioncontrolledcreatingdecadesdesigneddevelopedestablishedextendsfederalfuelfundingfuture
SHARED TOKENS (44): "access", "act", "administration", "adopted", "avoiding", "began", "collection", "complete", "construction", "controlled", "creating", "decades", "designed", "developed", "established", "extends", "federal", "fuel", "funding", "future"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationadoptedairanalysisanotherapproacharchitecturebroaderbuildingsbusinesscapitalcitiescivilcodescommunicationscommunitycreatingdevelopmentdifferentdistribution
SHARED TOKENS (64): "administration", "adopted", "air", "analysis", "another", "approach", "architecture", "broader", "buildings", "business", "capital", "cities", "civil", "codes", "communications", "community", "creating", "development", "different", "distribution"....
0.300
activityanalysisboundariesdocumentationengineeringengineersenvironmentestablishedgeneralgovernmentlegallicenselocalmaintenancemannerpartsplanspracticeprocessproduct
SHARED TOKENS (40): "activity", "analysis", "boundaries", "documentation", "engineering", "engineers", "environment", "established", "general", "government", "legal", "license", "local", "maintenance", "manner", "parts", "plans", "practice", "process", "product"....
0.300
academiccollegecommunitydifferenteducationformhighinstitutionspolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (15): "academic", "college", "community", "different", "education", "form", "high", "institutions", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.300
academicapplicationcompatibleengineeringfacilitiesfieldmanagementmovementoccupationaloperationplanningprovidesafetechnologytransporttransportation
SHARED TOKENS (16): "academic", "application", "compatible", "engineering", "facilities", "field", "management", "movement", "occupational", "operation", "planning", "provide", "safe", "technology", "transport", "transportation".
0.300
actactiveagenciesairarmyauthorityauthorizedbuildingbusinesscapacitycivilclearancecomponentsconstructioncontrolcorpsdepartmentdirectdirectlyeconomy
SHARED TOKENS (71): "act", "active", "agencies", "air", "army", "authority", "authorized", "building", "business", "capacity", "civil", "clearance", "components", "construction", "control", "corps", "department", "direct", "directly", "economy"....
0.300
airarmyaviationcivildepartmentdepartmentsfieldforcesfoundedhighlandmajormaterialsmilitarynationaloperatedoperatessystemsterminaltraining
SHARED TOKENS (22): "air", "army", "aviation", "civil", "department", "departments", "field", "forces", "founded", "high", "land", "major", "materials", "military", "national", "operated", "operates", "systems", "terminal", "training"....
0.300
complexdescribesespeciallyindustrialindustrymeaningmilitarypolicypublicrelationshipsidesignificantsuppliessupplythemtogether
SHARED TOKENS (16): "complex", "describes", "especially", "industrial", "industry", "meaning", "military", "policy", "public", "relationship", "side", "significant", "supplies", "supply", "them", "together".
0.300
applicationcertificationcontroldevelopeddifferentdistributionelectricalengineeringengineersequipmenthistoricallyindividualinstituteinternationalmanagementmanufacturingmaterialsmechatronicsnationalneed
SHARED TOKENS (33): "application", "certification", "control", "developed", "different", "distribution", "electrical", "engineering", "engineers", "equipment", "historically", "individual", "institute", "international", "management", "manufacturing", "materials", "mechatronics", "national", "need"....
0.300
agriculturalairaircraftapplicationappliedcertaincommercialenginesenvironmentalfarmsforestryhazardslimitedproductproductspublicservesinglespecializedspecific
SHARED TOKENS (22): "agricultural", "air", "aircraft", "application", "applied", "certain", "commercial", "engines", "environmental", "farms", "forestry", "hazards", "limited", "product", "products", "public", "serve", "single", "specialized", "specific"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedbuildingsdevelopmentevenexpandedfunctionsgovernmentimpactlandlaterlegalownersownershippowerprivatepropertypublic
SHARED TOKENS (30): "acquisition", "another", "application", "authorized", "buildings", "development", "even", "expanded", "functions", "government", "impact", "land", "later", "legal", "owners", "ownership", "power", "private", "property", "public"....
0.300
accidentairaircraftapproacharmyaviationearlyforceshighindependentlargermilitarymodelspacificperformancepilotsprovidingrunwayseparatesouth
SHARED TOKENS (22): "accident", "air", "aircraft", "approach", "army", "aviation", "early", "forces", "high", "independent", "larger", "military", "models", "pacific", "performance", "pilots", "providing", "runway", "separate", "south"....
0.300
civilconstructionengineeringengineersfuturehighwaymaintenancematerialsoperationplanningprofessionalstandardsstructuraltraffictransportation
SHARED TOKENS (15): "civil", "construction", "engineering", "engineers", "future", "highway", "maintenance", "materials", "operation", "planning", "professional", "standards", "structural", "traffic", "transportation".
0.300
advancedagenciesaircraftambulanceauthoritiesbeganbusinessescertaincontactcorpsdepartmentdispatchemergencyfacilitieshistoricallyhospitalmedicalmodeloperateparts
SHARED TOKENS (42): "advanced", "agencies", "aircraft", "ambulance", "authorities", "began", "businesses", "certain", "contact", "corps", "department", "dispatch", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "parts"....
0.300
administrationagenciesamongchangescompliancecontrolcurrentdefinesdepartmentdesigneddevelopeddiffersdocumentfederalhighwaylawlocalnationalownedparking
SHARED TOKENS (30): "administration", "agencies", "among", "changes", "compliance", "control", "current", "defines", "department", "designed", "developed", "differs", "document", "federal", "highway", "law", "local", "national", "owned", "parking"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
buildingscannotdesignedevenhighwayinfrastructureinsidelargemanagemunicipalparkingpropertypublicrequireresidentialsmallstreetsurfacessystemswater
SHARED TOKENS (20): "buildings", "cannot", "designed", "even", "highway", "infrastructure", "inside", "large", "manage", "municipal", "parking", "property", "public", "require", "residential", "small", "street", "surfaces", "systems", "water".
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdefinitionsdifferentformindividuallinemeaningmultipleoperateoperatesoperatingoperationsrailsectionsystemsystemstechnology
SHARED TOKENS (23): "broader", "capability", "capacity", "conditions", "definitions", "different", "form", "individual", "line", "meaning", "multiple", "operate", "operates", "operating", "operations", "rail", "section", "system", "systems", "technology"....
0.300
applycircumstancesdecisionsearlyestablishedevidenceextendfederalgovernmentgovernmentshistorylaterlawlegallimitedlocalmeansneededphysicalplace
SHARED TOKENS (30): "apply", "circumstances", "decisions", "early", "established", "evidence", "extend", "federal", "government", "governments", "history", "later", "law", "legal", "limited", "local", "means", "needed", "physical", "place"....
0.300
administrationaircraftairframeaviationcertificationcodefaafederalmaintenancepowerplantregulationsrulessystemstechniciantitle
SHARED TOKENS (15): "administration", "aircraft", "airframe", "aviation", "certification", "code", "faa", "federal", "maintenance", "powerplant", "regulations", "rules", "systems", "technician", "title".
0.300
accessapproachcommunitycompletedesignedeconomicengineersenvironmentalhighwayhomeoperatedpolicypublicrequiressafesafetytraffictransportationtravelusers
SHARED TOKENS (21): "access", "approach", "community", "complete", "designed", "economic", "engineers", "environmental", "highway", "home", "operated", "policy", "public", "requires", "safe", "safety", "traffic", "transportation", "travel", "users"....
0.300
Oversize load ↗ Q680421 KW CROSS HIGH
airbridgeconstructioncranesequipmentfreighthighwayindustrialinfrastructurelargelegallimitsordinaryroadspecifiedtransporttransportationwater
SHARED TOKENS (18): "air", "bridge", "construction", "cranes", "equipment", "freight", "highway", "industrial", "infrastructure", "large", "legal", "limits", "ordinary", "road", "specified", "transport", "transportation", "water".
0.300
administrationappliedapplycertaincommercecontrolcontrolledcontrolsdesigneddirectentityequipmentgeneralguidelinesindustryintegratedmanufacturingproductsregulatesregulations
SHARED TOKENS (23): "administration", "applied", "apply", "certain", "commerce", "control", "controlled", "controls", "designed", "direct", "entity", "equipment", "general", "guidelines", "industry", "integrated", "manufacturing", "products", "regulates", "regulations"....
0.300
abilityairaircraftairframecapabilitiesdesigneddevelopeddirectfacilitiesforcesintendedlandlinesmaintenancemeasuresmissionsoperationperformancepermitsprogram
SHARED TOKENS (32): "ability", "air", "aircraft", "airframe", "capabilities", "designed", "developed", "direct", "facilities", "forces", "intended", "land", "lines", "maintenance", "measures", "missions", "operation", "performance", "permits", "program"....
0.300
Remote sensing ↗ Q199687 KW CROSS HIGH
acquisitionactiveaircraftamongapplicationsappliedcommercialcontactcurrenteconomicespeciallygeographyinformationintelligencelandmakingmilitaryon-sitephysicalplanning
SHARED TOKENS (21): "acquisition", "active", "aircraft", "among", "applications", "applied", "commercial", "contact", "current", "economic", "especially", "geography", "information", "intelligence", "land", "making", "military", "on-site", "physical", "planning"....
🫐 BERRY40 edges
0.260
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
easternhighwayidahointersectioninterstatelimitedmilesoregonroutesouthsystemwestwestern
SHARED TOKENS (13): "eastern", "highway", "idaho", "intersection", "interstate", "limited", "miles", "oregon", "route", "south", "system", "west", "western".
0.260
aircraftcontrollingcontrolsengineersflightindividualmechanicsoperatingoperatorspilotpilotsqualificationssystems
SHARED TOKENS (13): "aircraft", "controlling", "controls", "engineers", "flight", "individual", "mechanics", "operating", "operators", "pilot", "pilots", "qualifications", "systems".
0.260
aircraftresourceswater
SHARED TOKENS (3): "aircraft", "resources", "water". | EXACT TITLE in aerospace_defense: "Aerial firefighting".
0.260
becomechangesengineeringengineersespeciallymeasuresphysicalresponsibleroadrulesafetytrafficuses
SHARED TOKENS (13): "become", "changes", "engineering", "engineers", "especially", "measures", "physical", "responsible", "road", "rule", "safety", "traffic", "uses".
0.260
aircargocommercialenvironmentfreightinternationallandlogisticsmilitaryphysicalprocessproductstransport
SHARED TOKENS (13): "air", "cargo", "commercial", "environment", "freight", "international", "land", "logistics", "military", "physical", "process", "products", "transport".
0.260
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemarketingparkingpoolpublicrailroadsystemtransfertransportvehicles
SHARED TOKENS (13): "cities", "connections", "large", "marketing", "parking", "pool", "public", "rail", "road", "system", "transfer", "transport", "vehicles".
0.260
Pilatus PC-24 ↗ Q2094874 KW CROSS HIGH
aircraftbeganbusinesscapabilitycertificationcustomerdeliveryfaaflightjetrangesinglework
SHARED TOKENS (13): "aircraft", "began", "business", "capability", "certification", "customer", "delivery", "faa", "flight", "jet", "range", "single", "work".
0.240
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahopartspopulationrapidlyschoolschoolssharedwest
SHARED TOKENS (12): "ada", "boise", "canyon", "district", "idaho", "parts", "population", "rapidly", "school", "schools", "shared", "west".
0.240
aircraftcargofreighthandlingitselfmultiplerailreducedroadsecuritytransporttransportation
SHARED TOKENS (12): "aircraft", "cargo", "freight", "handling", "itself", "multiple", "rail", "reduced", "road", "security", "transport", "transportation".
0.240
airaircraftarmydevelopedforcesmajormilitaryoperationsprogramsystemtransportutility
SHARED TOKENS (12): "air", "aircraft", "army", "developed", "forces", "major", "military", "operations", "program", "system", "transport", "utility".
0.220
accessconnectingdesignedformerlocalmajormoveprovideresidentialroadtraffic
SHARED TOKENS (11): "access", "connecting", "designed", "former", "local", "major", "move", "provide", "residential", "road", "traffic".
0.220
controldepartmentforeigninternationallawmilitarynationalpolicyregulationssecuritytraffic
SHARED TOKENS (11): "control", "department", "foreign", "international", "law", "military", "national", "policy", "regulations", "security", "traffic".
0.220
applicationsappliesapproachdevelopmentengineeringmaintainingmanageprocesssystemstesttesting
SHARED TOKENS (11): "applications", "applies", "approach", "development", "engineering", "maintaining", "manage", "process", "systems", "test", "testing".
0.220
airaircraftcriticalemergencyespeciallymedicaloperationsproviderescuetransportvehicles
SHARED TOKENS (11): "air", "aircraft", "critical", "emergency", "especially", "medical", "operations", "provide", "rescue", "transport", "vehicles".
0.220
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentrylineresearchroadroadwaysafetyshowstrafficvehicles
SHARED TOKENS (11): "businesses", "economic", "entry", "line", "research", "road", "roadway", "safety", "shows", "traffic", "vehicles".
0.220
accessairappliedassetscontrolenergylandmilitaryoperationsspacesystems
SHARED TOKENS (11): "access", "air", "applied", "assets", "control", "energy", "land", "military", "operations", "space", "systems".
0.200
airaircraftarmycorpsdevelopedearlysmallstandardstrainingtransport
SHARED TOKENS (10): "air", "aircraft", "army", "corps", "developed", "early", "small", "standards", "training", "transport".
0.200
amongcurrentdifferentenergyfieldrangespacesystemtechnologyuses
SHARED TOKENS (10): "among", "current", "different", "energy", "field", "range", "space", "system", "technology", "uses".
0.200
Bell 412 ↗ Q815688 KW CROSS HIGH
commercialdevelopmentforceslicensemajormarketsmilitarytransportusersutility
SHARED TOKENS (10): "commercial", "development", "forces", "license", "major", "markets", "military", "transport", "users", "utility".
0.200
chartercitiescorporationcountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (10): "charter", "cities", "corporation", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.200
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
0.180
developedenforcementflightjetlawsingletrainingtransportuses
SHARED TOKENS (9): "developed", "enforcement", "flight", "jet", "law", "single", "training", "transport", "uses".
0.180
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahomunicipalpopulationsecondseparatestreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "municipal", "population", "second", "separate", "street".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahonampapopulationruralwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "eastern", "idaho", "nampa", "population", "rural", "western".
0.180
anotherapplicationsconsumerconvertelectricalindustrialpositionresponsesensors
SHARED TOKENS (9): "another", "applications", "consumer", "convert", "electrical", "industrial", "position", "response", "sensors".
0.160
aircraftcomponentsdesignedenginesflightpowersmallsystem
SHARED TOKENS (8): "aircraft", "components", "designed", "engines", "flight", "power", "small", "system".
0.140
agriculturalcitiesidaholandmajormilesnorthwest
SHARED TOKENS (7): "agricultural", "cities", "idaho", "land", "major", "miles", "northwest".
0.140
Bell 212 ↗ Q698242 KW CROSS HIGH
capacitycommercialmovedoperatorspilotproductionutility
SHARED TOKENS (7): "capacity", "commercial", "moved", "operators", "pilot", "production", "utility".
0.140
Air charter ↗ Q21074304 KW CROSS HIGH
airaircraftbusinesscharterindividualpurchasingtransportation
SHARED TOKENS (7): "air", "aircraft", "business", "charter", "individual", "purchasing", "transportation".
0.140
commerciallargelicensematerialsoperatepartsvehicles
SHARED TOKENS (7): "commercial", "large", "license", "materials", "operate", "parts", "vehicles".
0.140
canyonconnectinghighwayidahomeridiannampavalley
SHARED TOKENS (7): "canyon", "connecting", "highway", "idaho", "meridian", "nampa", "valley".
0.120
highwayidahointerstateroutetreasurevalley
SHARED TOKENS (6): "highway", "idaho", "interstate", "route", "treasure", "valley".
0.120
adaconnectingcountieshighwayidahoroute
SHARED TOKENS (6): "ada", "connecting", "counties", "highway", "idaho", "route".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahopopulationruralsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "population", "rural", "small".
0.120
Bell 204/205 ↗ Q2428191 KW CROSS HIGH
applicationscargoforestrymilitaryoperationstransport
SHARED TOKENS (6): "applications", "cargo", "forestry", "military", "operations", "transport".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahomilesnorthwestpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
0.100
Bell 407 ↗ Q815682 KW CROSS HIGH
armycivildevelopedusesutility
SHARED TOKENS (5): "army", "civil", "developed", "uses", "utility".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
Ayres Thrush ↗ Q3525993 KW CROSS HIGH
agriculturalaircraftapplicationconventionalcorporation
SHARED TOKENS (5): "agricultural", "aircraft", "application", "conventional", "corporation".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Aerospace Defense — Treasure Valley
HAIKU · HIGH GATE
How does Interstate 84 in Idaho support aerospace defense operations in the Treasure Valley?
Interstate 84 provides direct ground access connecting Boise Airport and Nampa Municipal Airport to supply chain distribution centers across the western region. The Federal Highway Administration maintains I-84 standards that enable transport of aerospace components and equipment between Boise, Nampa, and manufacturing facilities throughout Ada County.
What role does Nampa Municipal Airport play in aerospace defense infrastructure for the Treasure Valley?
Nampa Municipal Airport serves as a secondary aviation facility that complements Boise Airport for aerospace defense logistics and personnel transport. The Federal Aviation Administration certifies both facilities to support defense-related operations while the Union Pacific Railroad provides parallel freight connectivity for aerospace supply chain movement through Nampa, Idaho.
How do Boise State University and College of Western Idaho connect transportation and aerospace defense training in the Treasure Valley?
Boise State University and College of Western Idaho deliver workforce development programs that prepare students for aerospace defense careers requiring knowledge of both transportation systems and aviation operations. These institutions collaborate with the Federal Aviation Administration and local departments to align curriculum with Boise Airport and Nampa Municipal Airport infrastructure needs.
Why does electric power transmission infrastructure matter for aerospace defense facilities in the Boise area?
Electric power transmission systems managed by regional utilities supply uninterrupted power to aerospace defense manufacturing and research operations throughout Ada County and Nampa. The Idaho State Police coordinate security protocols along transmission corridors that serve critical facilities near Boise Airport and Interstate 84.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Aerospace Defense 18 QID bridges 243 edges 6,602 ext links 2026-07-17 23:38:38 UTC b8cf9dea91670f04
Transportation Infrastructure corridor ↗ Aerospace Defense corridor ↗ Aerospace Defense × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals