—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Veterinary Animal Services

20 Wikipedia bridge articles confirmed in both vertical ledgers. 262 deterministic cross-vertical edges. 7,451 external source links harvested. Every edge provenance-stamped. Every claim auditable.

20 QID Bridge Articles
262 Cross Edges
7,451 External Sources
299 Wikipedia Articles
25 🌲 Evergreen
183 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Veterinary Animal Services
QID Bridge Articles
20
confirmed Wikipedia overlap
Total Cross Edges
262
External Sources Harvested
7,451
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.1300  ·  type: exact_title_cross  ·  14 shared tokens
QID Bridge Titles (20)
Idaho State PoliceIdahoZoningTreasure ValleyApprenticeshipBoise State UniversityBoise, IdahoCollege of Western IdahoNampa, IdahoLand-use planningStar, IdahoUnited States Environmental Protection AgencySnake RiverAda County, IdahoGarden City, IdahoCaldwell, IdahoMeridian, IdahoKuna, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadawestcanyonpublicnorthwestwesterncapitaleasternlandriverlocalnamevalleycollegeprogramsnational
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:43:57 UTC
Content Hash
e55bfbe6351fa03f
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
20 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.130
QID OVERLAP: Q5987459 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (14): "agency", "began", "created", "creating", "department", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "police", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
agencybegancreatedcreatingdepartmentenforcementidaholawlegislaturemunicipalorganizationpolicepublicstatewide
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (31): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "divided", "eastern", "idaho", "incorporates", "land", "linked", "national", "northwest", "official", "people", "population", "prior".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in veterinary_animal_services: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistinctdividedeasternidahoincorporateslandlinkednationalnorthwestofficialpeoplepopulationpriorproductsriversectorseparatesignificantsmallsuppliestechnologyuseswest+1
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (27): "allowing", "building", "certain", "determine", "developed", "development", "different", "form", "government", "growth", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations", "regulatory", "residential".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in veterinary_animal_services: "Zoning".
allowingbuildingcertaindeterminedevelopeddevelopmentdifferentformgovernmentgrowthlandland-uselocalplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesizesystemsuseszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (19): "agricultural", "association", "boise", "commerce", "eastern", "historically", "idaho", "land", "local", "metropolitan", "name", "opportunities", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in veterinary_animal_services: "Treasure Valley".
agriculturalassociationboisecommerceeasternhistoricallyidaholandlocalmetropolitannameopportunitiesregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:branch). | SHARED TOKENS (19): "certification", "complete", "field", "formal", "helps", "labor", "level", "license", "people", "period", "placement", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
certificationcompletefieldformalhelpslaborlevellicensepeopleperiodplacementpotentialpracticepractitionersprofessionalregulatedstudysystemtraining
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Length Apprenticeships with a length of 2 years are for persons with weaker school results. The certificate awarded after successfully completing a 2-year apprenticeship is called "Attestation de formation professionnelle" (AFP) in French, "Eidgenössisches Berufsattest" (EBA) in German and "Certificato federale di formazione pratica" (CFP) in Italian. It could be translated as "Attestation of professional formation". Apprenticeship with a length of 3 or 4 years are the most common ones. The certificate awarded after successfully completing a 3 or 4-year apprenticeship is called "Certificat Fédéral de Capacité" (CFC) in French, "Eidgenössisches Fähigkeitszeugnis" (EFZ) in German and "Attestato federale di capacità" (AFC) in Italian. It could be translated as "Federal Certificate of Proficiency". Some crafts, such as electrician, are educated in lengths of 3 and 4 years. In this case, an Electrician with 4 years apprenticeship gets more theoretical background than one with 3 years apprenticeship. Some languages have different names for a craft depending on the length of the apprenticeship; this can be lost in translation. Each of the over 300 nationwide defined vocational profiles has defined framework – conditions as length of education, theoretical and practical learning goals and certification conditions. Age of the apprentices Typically an apprenticeship can commence for individuals once they are aged 15 or 18 after finishing general education. Some apprenticeships have a recommend or required age of 18.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "university", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in veterinary_animal_services: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationhealthidahoindependentprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "capital", "employers", "home", "idaho", "level", "locally", "major", "metropolitan", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in veterinary_animal_services: "Boise, Idaho".
adaboisecapitalemployershomeidaholevellocallymajormetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (32): "academic", "ada", "board", "boise", "canyon", "college", "community", "comprehensive", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in veterinary_animal_services: "College of Western Idaho".
academicadaboardboisecanyoncollegecommunitycomprehensivecwidevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentsservedsouthweststudentstechnicalthroughouttransfertreasurevalley+2
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (16): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "principal", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannamenampanorthwestpopulationprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (49): "act", "american", "applicable", "association", "authority", "behavior", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depend", "depends", "design", "development", "districts", "economic"....
actamericanapplicableassociationauthoritybehaviorchangescitiescommunitiescommunitycomprehensiveconditionscostscreatingdependdependsdesigndevelopmentdistrictseconomicenvironmentalexposurefacilitiesfunctiongoalhealthjurisdictionslandland-usemeans+19
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Star, Idaho
Q1516815 QID OVERLAP 0.800
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (15): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "middleton", "name", "parts", "population", "school", "shared", "star", "west".
adaboisecanyondistricthouseidahometropolitanmiddletonnamepartspopulationschoolsharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (30): "agency", "began", "department", "education", "enforcement", "environmental", "federal", "federally", "financial", "government", "house", "independent", "information", "january", "legal", "level", "local", "maintaining", "matters", "monitoring"....
agencybegandepartmenteducationenforcementenvironmentalfederalfederallyfinancialgovernmenthouseindependentinformationjanuarylegallevellocalmaintainingmattersmonitoringnationaloperationprogramsproposedpublicregionalresearchresponsibilityspecialistsstandards
The Environmental Protection Agency (EPA) is an independent agency of the United States government tasked with environmental protection matters. President Richard Nixon proposed the establishment of EPA on July 9, 1970; it began operation on December 2, 1970, after Nixon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
r is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
or is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
Snake River
Q272074 QID OVERLAP 0.800
QID OVERLAP: Q272074 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (36): "age", "agencies", "american", "canyon", "commercial", "construction", "control", "created", "developed", "eastern", "falls", "flood", "history", "idaho", "lake", "large", "limited", "major", "national", "near"....
ageagenciesamericancanyoncommercialconstructioncontrolcreateddevelopedeasternfallsfloodhistoryidaholakelargelimitedmajornationalnearnorthwestpartspolicyprivateprogramsproposedpublicregionriverrole+6
reas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success. The proposed removal of the four lower Snake River dams for fish passage is a significant ongoing policy debate in the Pacific Northwest. Course The Snake River starts to the north of Two Ocean Pass near the southern border of Yellowstone National Park, about 9,200 feet (2,800 m) above sea level in the Rocky Mountains of Wyoming. The river descends west through the high mountains of the Teton Wilderness meeting the Lewis River and continuing south into Jackson Lake in Grand Teton National Park, a natural glacial lake enlarged by Jackson Lake Dam. Joined by Pacific Creek and Buffalo Fork below the dam, it meanders southward through the alpine valley of Jackson Hole situated on the plain in front of the Teton Range to the west and the Gros Ventre Range to the east. Below the town of Jackson it forms the Snake River Canyon of Wyoming, turns west and crosses into Idaho, where the Palisades Dam forms Palisades Reservoir. From there it flows northwest through Swan Valley to join the Henrys Fork on an alluvial plain near Rexburg. The Henrys Fork is sometimes called the "North Fork" of the Snake River, while the section of the main Snake River above their confluence is sometimes called the "South Fork". Turning southwest, the river begins its long journey across the Snake River Plain, passing through Idaho Falls and receiving the Blackfoot River from the left before entering the 20-mile (32 km)-long American Falls Reservoir, formed by American Falls Dam. From American Falls it turns west, flowing through Minidoka Dam and Milner Dam, where large volumes of water are diverted for irrigation. Below Milner Dam it enters the Snake River Canyon of Idaho, where the river narrows, forming rapids and waterfalls. In the 70-mile (110 km) stretch between Milner Dam and the confluence with the Malad River near Hagerman Fossil Beds National Monument, the Snake River descends a total of 1,300 feet (400 m) over a series of cataracts and rapids, chief of which include Caldron Linn, Twin, Shoshone, Pillar, Auger, and Salmon Falls. Idaho Power operates several small hydroelectric plants along this stretch of the river.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitaldistricthomeidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
QID OVERLAP 0.720
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and veterinary_animal_services (tier:branch). | SHARED TOKENS (11): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "population", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalnamepopulationseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
242 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP242 edges
🌲 EVERGREEN5 edges
0.650
americanassociationcontinuingeducationfoodframeworkinformationmedicalopportunitiesorganizationproductsprofessionalprogramsresearchresourcessupports
SHARED TOKENS (16): "american", "association", "continuing", "education", "food", "framework", "information", "medical", "opportunities", "organization", "products", "professional", "programs", "research", "resources", "supports". | URL->B (1): http://avma.org/. | EXACT TITLE in veterinary_animal_services: "American Veterinary Medical Association".
0.650
acquisitionagencyboardcarrierscommerceconstructioncreatedeconomicfederalgovernmentindependentindustryinterstatejurisdictionmattersoversightregulationregulatoryrelevantserved
SHARED TOKENS (24): "acquisition", "agency", "board", "carriers", "commerce", "construction", "created", "economic", "federal", "government", "independent", "industry", "interstate", "jurisdiction", "matters", "oversight", "regulation", "regulatory", "relevant", "served".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationamericancommercialcostsfederalfundgeneralimprovelandpercentplanningprogrampublicrevenuesafetysizesold
SHARED TOKENS (18): "acquisition", "administration", "american", "commercial", "costs", "federal", "fund", "general", "improve", "land", "percent", "planning", "program", "public", "revenue", "safety", "size", "sold". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamongauthorityautomobileboisecanyoncapacitycapitalcentercitiesconventionalcostcostscrossdemanddistricteagleemployers
SHARED TOKENS (76): "ada", "additional", "agencies", "among", "authority", "automobile", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "cost", "costs", "cross", "demand", "district", "eagle", "employers".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.610
administrationagriculturecenterdepartmentdistributionfoodproductsregulateregulatesresponsiblesafetysignificantwork
SHARED TOKENS (13): "administration", "agriculture", "center", "department", "distribution", "food", "products", "regulate", "regulates", "responsible", "safety", "significant", "work". | URL->B (1): https://www.fda.gov/animal-veterinary. | EXACT TITLE in veterinary_animal_services: "Center for Veterinary Medicine".
🌿 BRANCH183 edges
0.570
agenciesagencyagriculturedepartmentfederalhealthinspectionnationalorganizationresponsiblewelfare
SHARED TOKENS (11): "agencies", "agency", "agriculture", "department", "federal", "health", "inspection", "national", "organization", "responsible", "welfare". | URL->B (1): http://www.aphis.usda.gov/. | EXACT TITLE in veterinary_animal_services: "Animal and Plant Health Inspection Service".
0.500
accommodateaccommodationassistancecertificationevenfunctionotherwisepeoplepoliciespublicregionregulationsstandardssupporttrainedtraining
SHARED TOKENS (16): "accommodate", "accommodation", "assistance", "certification", "even", "function", "otherwise", "people", "policies", "public", "region", "regulations", "standards", "support", "trained", "training". | EXACT TITLE in veterinary_animal_services: "Service animal".
0.500
amongapproximatelyboisecompetedivisionestablishedextensionfallsidaholateropenedoperatesproductionprofessionalpublicrepresentedresearchruralstatewidestudents
SHARED TOKENS (21): "among", "approximately", "boise", "compete", "division", "established", "extension", "falls", "idaho", "later", "opened", "operates", "production", "professional", "public", "represented", "research", "rural", "statewide", "students".... | EXACT TITLE in veterinary_animal_services: "University of Idaho".
0.500
Road ↗ Q34442 EXACT TITLE
accessdesigndistinctionlandlocalmovementpathsplaceprimaryprivatepublicroadroutestreettrafficwhose
SHARED TOKENS (16): "access", "design", "distinction", "land", "local", "movement", "paths", "place", "primary", "private", "public", "road", "route", "street", "traffic", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in veterinary_animal_services: "Road".
0.500
addressingaffectedassistancebuildingconstructioncontinuingdirectlyemergencyfoodfullgovernmenthealthimproveinfrastructurelimitedmanagementneedspeopleplacesprovide
SHARED TOKENS (32): "addressing", "affected", "assistance", "building", "construction", "continuing", "directly", "emergency", "food", "full", "government", "health", "improve", "infrastructure", "limited", "management", "needs", "people", "places", "provide".... | EXACT TITLE in veterinary_animal_services: "Disaster response".
0.500
assetassociatedbuildingconstructiondesigndevelopmenteconomicexpandfacilitiesfinancinghazardousimproveindustryinfrastructurepercentplanningprocessproductswork
SHARED TOKENS (19): "asset", "associated", "building", "construction", "design", "development", "economic", "expand", "facilities", "financing", "hazardous", "improve", "industry", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in veterinary_animal_services: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingcrossdesigneddrainageitselfneednoiseperformanceplacingpracticeprocessrequirementsroadselectionshapestructuretrafficwater
SHARED TOKENS (18): "allowing", "cross", "designed", "drainage", "itself", "need", "noise", "performance", "placing", "practice", "process", "requirements", "road", "selection", "shape", "structure", "traffic", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
agriculturebecomecollegecompletedepartmentdepartmentsdistincteducationentryfieldlevelmedicalprovidingrequireschoolstudytechnologytitleuniversity
SHARED TOKENS (19): "agriculture", "become", "college", "complete", "department", "departments", "distinct", "education", "entry", "field", "level", "medical", "providing", "require", "school", "study", "technology", "title", "university". | EXACT TITLE in veterinary_animal_services: "Veterinary education".
0.500
Wildfire ↗ Q169950 EXACT TITLE
controlledcreatecreatesdependdirecteconomicequipmenteventgrowthhealthlandland-uselevelmanagementopenphysicalpotentialpracticespropertyspaces
SHARED TOKENS (21): "controlled", "create", "creates", "depend", "direct", "economic", "equipment", "event", "growth", "health", "land", "land-use", "level", "management", "open", "physical", "potential", "practices", "property", "spaces".... | EXACT TITLE in veterinary_animal_services: "Wildfire".
0.500
canyonconstructionemergencygeneralhomeidahointegratedmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (16): "canyon", "construction", "emergency", "general", "home", "idaho", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
affectedaffectsbecomecarriersconditionscontactdistinctequipmentevidenceinsidelimitsmonitoringmultiplenearsmallwater
SHARED TOKENS (16): "affected", "affects", "become", "carriers", "conditions", "contact", "distinct", "equipment", "evidence", "inside", "limits", "monitoring", "multiple", "near", "small", "water". | EXACT TITLE in veterinary_animal_services: "Foot-and-mouth disease".
0.500
abilityaffectedcommunitydifferentemergencyeventsfederalhazardslocalmanagementneedsorganizationsprofessionalprovidingrecoveryreducerequiresrescueresponsesearch
SHARED TOKENS (20): "ability", "affected", "community", "different", "emergency", "events", "federal", "hazards", "local", "management", "needs", "organizations", "professional", "providing", "recovery", "reduce", "requires", "rescue", "response", "search". | EXACT TITLE in veterinary_animal_services: "Emergency management".
0.500
applicablebuildingcentercenterscommercialdemanddirectlydistributionequipmentfacilityfirmsfunctionhandlinginventorylaborlargemarketnameneedednetwork
SHARED TOKENS (34): "applicable", "building", "center", "centers", "commercial", "demand", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "inventory", "labor", "large", "market", "name", "needed", "network".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Food safety ↗ Q909821 EXACT TITLE
affectsavoidcannotcertificationchainconsumercreatesdescribingdevelopedenforcementfoodgrowthhandlinghazardshealthindustryinspectionmanagementmarketorganization
SHARED TOKENS (30): "affects", "avoid", "cannot", "certification", "chain", "consumer", "creates", "describing", "developed", "enforcement", "food", "growth", "handling", "hazards", "health", "industry", "inspection", "management", "market", "organization".... | EXACT TITLE in veterinary_animal_services: "Food safety".
0.500
accessactcomprehensivecontinuingcreatedfederalfederallygovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplanspopulationprocessprogramspublic
SHARED TOKENS (25): "access", "act", "comprehensive", "continuing", "created", "federal", "federally", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans", "population", "process", "programs", "public".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
broadercertaincitiescomprehensivedevelopmenteconomicenvironmentalgrowthindividualinfrastructurelandland-uselevelmanagementnationalneedsnetworkplacementplanningplans
SHARED TOKENS (33): "broader", "certain", "cities", "comprehensive", "development", "economic", "environmental", "growth", "individual", "infrastructure", "land", "land-use", "level", "management", "national", "needs", "network", "placement", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescommunityconditionscreateddevelopmentdifferentdistincteconomicelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirmsfunctionfunctioninggeneralgoal
SHARED TOKENS (47): "access", "agencies", "community", "conditions", "created", "development", "different", "distinct", "economic", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms", "function", "functioning", "general", "goal".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in veterinary_animal_services: "Infrastructure".
0.500
affectapplicationscareconditionscontroldiagnosisdifferentfoodhealthhelpsmanagementmedicalmonitoringprofessionalresearchsafetyscopespecializedsupplytechnicians
SHARED TOKENS (25): "affect", "applications", "care", "conditions", "control", "diagnosis", "different", "food", "health", "helps", "management", "medical", "monitoring", "professional", "research", "safety", "scope", "specialized", "supply", "technicians".... | EXACT TITLE in veterinary_animal_services: "Veterinary medicine".
0.500
accessaccessibilityamongbeganbehavioralcarecertaincommunitiescommunitycomplexcomprehensivecontroldesigneddevelopeddevelopmentdifferentdisabilitydistributioneconomicseducation
SHARED TOKENS (59): "access", "accessibility", "among", "began", "behavioral", "care", "certain", "communities", "community", "complex", "comprehensive", "control", "designed", "developed", "development", "different", "disability", "distribution", "economics", "education".... | EXACT TITLE in transportation_infrastructure: "Public health". | EXACT TITLE in veterinary_animal_services: "Public health".
0.500
Housing ↗ Q1247867 EXACT TITLE
accessactaffectsamongassistancebecomeconditionconstructiondebtdemanddepartmentdevelopeddirectdirectlydistincteconomiceducationemergencyemploymentfood
SHARED TOKENS (55): "access", "act", "affects", "among", "assistance", "become", "condition", "construction", "debt", "demand", "department", "developed", "direct", "directly", "distinct", "economic", "education", "emergency", "employment", "food".... | EXACT TITLE in transportation_infrastructure: "Housing". | EXACT TITLE in veterinary_animal_services: "Housing".
0.500
agriculturalannuallyconcentratedconcernsdevelopeddevelopmentdirectenvironmentenvironmentalfreegroupgrowthimproveincreaseindividualinternationallimitedlivingmedicalpeople
SHARED TOKENS (31): "agricultural", "annually", "concentrated", "concerns", "developed", "development", "direct", "environment", "environmental", "free", "group", "growth", "improve", "increase", "individual", "international", "limited", "living", "medical", "people".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in veterinary_animal_services: "Population growth".
0.500
Vaccination ↗ Q192995 EXACT TITLE
administrationagainstageamongcannotcenterscontaincontroldistincteffectiveevenevidencehealthlargelistsmajormedicalnationalorganizationpartly
SHARED TOKENS (37): "administration", "against", "age", "among", "cannot", "centers", "contain", "control", "distinct", "effective", "even", "evidence", "health", "large", "lists", "major", "medical", "national", "organization", "partly".... | EXACT TITLE in veterinary_animal_services: "Vaccination".
0.500
Zoo ↗ Q43501 EXACT TITLE
annuallybehaviorcollectionconcernsconditionsfacilitygardenhousingimproveopenedorganizationspeoplepublicstudywelfare
SHARED TOKENS (15): "annually", "behavior", "collection", "concerns", "conditions", "facility", "garden", "housing", "improve", "opened", "organizations", "people", "public", "study", "welfare". | EXACT TITLE in veterinary_animal_services: "Zoo".
0.500
academicamongcarecenterscriticaldistinctinstitutionalmechanismmedicalmodelsresearchresourcerolestudyuses
SHARED TOKENS (15): "academic", "among", "care", "centers", "critical", "distinct", "institutional", "mechanism", "medical", "models", "research", "resource", "role", "study", "uses". | EXACT TITLE in veterinary_animal_services: "Comparative medicine".
0.500
Flood ↗ Q8068 EXACT TITLE
accessagriculturalagricultureavoidbusinessescapacitychangescitiescommerceconditionscontrolsenvironmentenvironmentaleventsfloodhealthincreaseindustryinfluencelake
SHARED TOKENS (44): "access", "agricultural", "agriculture", "avoid", "businesses", "capacity", "changes", "cities", "commerce", "conditions", "controls", "environment", "environmental", "events", "flood", "health", "increase", "industry", "influence", "lake".... | EXACT TITLE in transportation_infrastructure: "Flood". | EXACT TITLE in veterinary_animal_services: "Flood".
0.500
communitydescribesdevelopmenteconomiceconomicsgrowthhistoricallyimproveindividualinfrastructurelocalmarketpeoplepoliciespolicyprocessqualityregionwest
SHARED TOKENS (19): "community", "describes", "development", "economic", "economics", "growth", "historically", "improve", "individual", "infrastructure", "local", "market", "people", "policies", "policy", "process", "quality", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecareclinicalcommunitydirecteffectivehealthinformationinstitutionaljurisdictionslinksmonitoringofficepharmacypracticeprimarypriorproductsprofessionalproviding
SHARED TOKENS (26): "become", "care", "clinical", "community", "direct", "effective", "health", "information", "institutional", "jurisdictions", "links", "monitoring", "office", "pharmacy", "practice", "primary", "prior", "products", "professional", "providing".... | EXACT TITLE in transportation_infrastructure: "Pharmacy". | EXACT TITLE in veterinary_animal_services: "Pharmacy".
0.500
adoptionageamonganalyticscarechangesclinicalcollectionconditionsdatadatedesigneddifferentdigitaleffectivehealthhealthcarehistoryimproveimprovements
SHARED TOKENS (42): "adoption", "age", "among", "analytics", "care", "changes", "clinical", "collection", "conditions", "data", "date", "designed", "different", "digital", "effective", "health", "healthcare", "history", "improve", "improvements".... | EXACT TITLE in veterinary_animal_services: "Electronic health record".
0.500
chaincomplexconsumercreatingdirectdirectlydistributionfacilitiesindependentlinkedmanagementmaterialsnetworkproductsstructuresupplysystemsystemsthemvalue
SHARED TOKENS (20): "chain", "complex", "consumer", "creating", "direct", "directly", "distribution", "facilities", "independent", "linked", "management", "materials", "network", "products", "structure", "supply", "system", "systems", "them", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain". | EXACT TITLE in veterinary_animal_services: "Supply chain".
0.500
administrationagencyauthoritycertificationcommercialcontrolcreateddepartmentfederalgovernmentinternationalorganizationpersonnelregulatesspacestandardssurroundingtraffictransportation
SHARED TOKENS (19): "administration", "agency", "authority", "certification", "commercial", "control", "created", "department", "federal", "government", "international", "organization", "personnel", "regulates", "space", "standards", "surrounding", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
approximatelyboardcollegecommunitycomprehensiveconcernseasternidaholakenearnorthwestpublicrivershowstudentswestern
SHARED TOKENS (16): "approximately", "board", "college", "community", "comprehensive", "concerns", "eastern", "idaho", "lake", "near", "northwest", "public", "river", "show", "students", "western". | EXACT TITLE in veterinary_animal_services: "North Idaho College".
0.500
affectsamongassociatedcarediagnosisdifferentexposurehandlinghistoricallylargemakingnodepeoplereportedruralthemtreatment
SHARED TOKENS (17): "affects", "among", "associated", "care", "diagnosis", "different", "exposure", "handling", "historically", "large", "making", "node", "people", "reported", "rural", "them", "treatment". | EXACT TITLE in veterinary_animal_services: "Plague (disease)".
0.500
acquiredacquisitionsadditionalbrandcarriersextendsformhistoryindependentinternationallatermajornetworkoperatesoperatingprincipalregionalroutestarthroughout
SHARED TOKENS (20): "acquired", "acquisitions", "additional", "brand", "carriers", "extends", "form", "history", "independent", "international", "later", "major", "network", "operates", "operating", "principal", "regional", "route", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Pet ↗ Q39201 EXACT TITLE
abilitycareconcernsgrouphomehospitalshousingintelligencelivingorganizationsownerspeoplephysicalpropertyprovideratherspecificstudytrained
SHARED TOKENS (19): "ability", "care", "concerns", "group", "home", "hospitals", "housing", "intelligence", "living", "organizations", "owners", "people", "physical", "property", "provide", "rather", "specific", "study", "trained". | EXACT TITLE in transportation_infrastructure: "Pet". | EXACT TITLE in veterinary_animal_services: "Pet".
0.500
Poultry ↗ Q178559 EXACT TITLE
abilitycommercialcontainingdifferentfoodgrowthinvolvinglatermarketpeopleplacepracticeprocessproductsreducesmallsourcesupplysystemsthem
SHARED TOKENS (20): "ability", "commercial", "containing", "different", "food", "growth", "involving", "later", "market", "people", "place", "practice", "process", "products", "reduce", "small", "source", "supply", "systems", "them". | EXACT TITLE in veterinary_animal_services: "Poultry".
0.500
administrationagencyapproximatelyauthoritycertainconnectingcreateddatadepartmentenforcementfacilitiesfederalgovernmentidentificationimprovelawlocaloperatedpartnerspersonnel
SHARED TOKENS (34): "administration", "agency", "approximately", "authority", "certain", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "government", "identification", "improve", "law", "local", "operated", "partners", "personnel".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
chaincollectioncostsequipmentfacilityfieldfoodinformationmaintainingmanagementmaterialsmodelmovementmovingneedsoperationalpartsphysicalplanningproduction
SHARED TOKENS (29): "chain", "collection", "costs", "equipment", "facility", "field", "food", "information", "maintaining", "management", "materials", "model", "movement", "moving", "needs", "operational", "parts", "physical", "planning", "production".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentimprovelocalofficeoperateoperatorspeopleprogramsprovidersprovidingpublic
SHARED TOKENS (28): "administration", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "improve", "local", "office", "operate", "operators", "people", "programs", "providers", "providing", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
broadercapitalcategorycommunityconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthealthhospitalsinfrastructurelong-termmunicipaloperatorphysicalprivate
SHARED TOKENS (29): "broader", "capital", "category", "community", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "health", "hospitals", "infrastructure", "long-term", "municipal", "operator", "physical", "private".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
actadministrationagencycommunitycontrolleddepartmentdistributionenforcementestablishedfederalgovernmentintelligenceinvolvingjurisdictionlawnationaloperationsratherreportsresponsible
SHARED TOKENS (21): "act", "administration", "agency", "community", "controlled", "department", "distribution", "enforcement", "established", "federal", "government", "intelligence", "involving", "jurisdiction", "law", "national", "operations", "rather", "reports", "responsible".... | EXACT TITLE in veterinary_animal_services: "Drug Enforcement Administration".
0.500
Quarantine ↗ Q182899 EXACT TITLE
actapplicationauthoritybroaderconnectiondiagnosisdifferentdistinctenforcementgovernedgovernmenthealthhistoryintendedlawmedicalmovementpeoplepopulationpower
SHARED TOKENS (26): "act", "application", "authority", "broader", "connection", "diagnosis", "different", "distinct", "enforcement", "governed", "government", "health", "history", "intended", "law", "medical", "movement", "people", "population", "power".... | EXACT TITLE in veterinary_animal_services: "Quarantine".
0.500
Ranch ↗ Q509028 EXACT TITLE
additionalamericancontrolfarmfederallandlargelimitedmanagementoperateoperationsownedpeoplepracticeprivatepropertysizestructuresthoughwest
SHARED TOKENS (21): "additional", "american", "control", "farm", "federal", "land", "large", "limited", "management", "operate", "operations", "owned", "people", "practice", "private", "property", "size", "structures", "though", "west".... | EXACT TITLE in transportation_infrastructure: "Ranch". | EXACT TITLE in veterinary_animal_services: "Ranch".
0.500
Sheep ↗ EXACT TITLE
ageagriculturalagricultureamongapplyassociatedbegancenterdescribinggrouphistorylargemajormakingmodelolderplaceproductionregionspecific
SHARED TOKENS (23): "age", "agricultural", "agriculture", "among", "apply", "associated", "began", "center", "describing", "group", "history", "large", "major", "making", "model", "older", "place", "production", "region", "specific".... | EXACT TITLE in veterinary_animal_services: "Sheep".
0.500
accessallowingarrangementsassociationcompetingcompetitivecontractingcoordinationcostsdevelopmenteconomicestatefinancialfixedgeneralgovernmenthistoricalindustryinfrastructureintegrated
SHARED TOKENS (48): "access", "allowing", "arrangements", "association", "competing", "competitive", "contracting", "coordination", "costs", "development", "economic", "estate", "financial", "fixed", "general", "government", "historical", "industry", "infrastructure", "integrated".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
Dog ↗ Q144 EXACT TITLE
abilityagricultureapproximatelyassociationbehaviorcapabilitiesdevelopeddevelopmentenvironmentformhouseinfluencemovementspeoplephysicalpolicepopulationpossessprocessshape
SHARED TOKENS (26): "ability", "agriculture", "approximately", "association", "behavior", "capabilities", "developed", "development", "environment", "form", "house", "influence", "movements", "people", "physical", "police", "population", "possess", "process", "shape".... | EXACT TITLE in veterinary_animal_services: "Dog".
0.500
constructioncontroldescribeddesignedequipmentfunctionsinformationinvolvinglaborlargemobileoperationsotherwisepeoplepowerprimarysourcestructuresystemsuses
SHARED TOKENS (20): "construction", "control", "described", "designed", "equipment", "functions", "information", "involving", "labor", "large", "mobile", "operations", "otherwise", "people", "power", "primary", "source", "structure", "systems", "uses". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcitiescreatinghistoricallymobilitynetworkpathspeopleprofessionalrecordruralsafetyspeedtraffictransportwider
SHARED TOKENS (17): "american", "associated", "cities", "creating", "historically", "mobility", "network", "paths", "people", "professional", "record", "rural", "safety", "speed", "traffic", "transport", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.500
Anthrax ↗ Q129104 EXACT TITLE
againstbecomecentercentersclinicalcontactcontaincontroldependdescribeddevelopeddevelopmentdiagnosisdirectlyevenexposureformgrouphistoricalpeople
SHARED TOKENS (30): "against", "become", "center", "centers", "clinical", "contact", "contain", "control", "depend", "described", "developed", "development", "diagnosis", "directly", "even", "exposure", "form", "group", "historical", "people".... | EXACT TITLE in veterinary_animal_services: "Anthrax".
0.500
applicationsassociatedbeyonddatadevelopmentenginesentitieseventsgraphhistoricallyknowledgelinkedmodelopenoperaterelationshipsrepresentationresearchscopesearch
SHARED TOKENS (22): "applications", "associated", "beyond", "data", "development", "engines", "entities", "events", "graph", "historically", "knowledge", "linked", "model", "open", "operate", "relationships", "representation", "research", "scope", "search".... | EXACT TITLE in transportation_infrastructure: "Knowledge graph". | EXACT TITLE in veterinary_animal_services: "Knowledge graph".
0.500
departmentfacilitiesfederalidentifiedindividualinterstatelocalmajormetropolitannationalnetworkorganizationspipelineplanningsafetyservingsystemtransporttransportation
SHARED TOKENS (19): "department", "facilities", "federal", "identified", "individual", "interstate", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
americanauthoritybegancertaincitiesconcentrateddifferentdistrictdistrictsdividedentitiesformformergovernmentindependentlawlegallylevellocallocally
SHARED TOKENS (30): "american", "authority", "began", "certain", "cities", "concentrated", "different", "district", "districts", "divided", "entities", "form", "former", "government", "independent", "law", "legally", "level", "local", "locally".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in veterinary_animal_services: "County (United States)".
0.500
centerscontrolhealthhospitalsincreaseinformationknowledgemonitoringorganizationorganizationspatternspracticepublicreportreportingrolesignificanttechnology
SHARED TOKENS (18): "centers", "control", "health", "hospitals", "increase", "information", "knowledge", "monitoring", "organization", "organizations", "patterns", "practice", "public", "report", "reporting", "role", "significant", "technology". | EXACT TITLE in veterinary_animal_services: "Disease surveillance".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalagriculturecommercialcommunitieseconomicenvironmentgeneralhealthlabormajorpracticesproduceproductsprovidepublicrolesolelysourcewelfare
SHARED TOKENS (19): "agricultural", "agriculture", "commercial", "communities", "economic", "environment", "general", "health", "labor", "major", "practices", "produce", "products", "provide", "public", "role", "solely", "source", "welfare". | EXACT TITLE in veterinary_animal_services: "Livestock".
0.500
One Health ↗ Q7092706 EXACT TITLE
addressingagricultureamongavoidcarecommunitiescomprehensivedevelopeddevelopmentenvironmentenvironmentalevidenceexaminedfoodgrouphealthincreasingindependentintegratedinterdependent
SHARED TOKENS (41): "addressing", "agriculture", "among", "avoid", "care", "communities", "comprehensive", "developed", "development", "environment", "environmental", "evidence", "examined", "food", "group", "health", "increasing", "independent", "integrated", "interdependent".... | EXACT TITLE in veterinary_animal_services: "One Health".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisconstructiondevelopmentdigitalenvironmentequipmentgovernmenthistorylandlawlegalmapsownershipplanningprofessionalpropertyresearchstructuralthemtransportation
SHARED TOKENS (21): "analysis", "construction", "development", "digital", "environment", "equipment", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "professional", "property", "research", "structural", "them", "transportation".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
additionalapproximatelyboardboisecollegecommunitycomprehensiveeasternfallsgovernedidaholargeprogramspublicregionstudentstechnicaltwinuniversityvalley
SHARED TOKENS (21): "additional", "approximately", "board", "boise", "college", "community", "comprehensive", "eastern", "falls", "governed", "idaho", "large", "programs", "public", "region", "students", "technical", "twin", "university", "valley".... | EXACT TITLE in veterinary_animal_services: "College of Southern Idaho".
0.500
agriculturalagricultureamongcannotcarechangesdevelopedfarmfarmshistorylandmajormanagementpartsplaceproductionproductsrequirescalesystems
SHARED TOKENS (21): "agricultural", "agriculture", "among", "cannot", "care", "changes", "developed", "farm", "farms", "history", "land", "major", "management", "parts", "place", "production", "products", "require", "scale", "systems".... | EXACT TITLE in veterinary_animal_services: "Animal husbandry".
0.500
Biology ↗ Q420 EXACT TITLE
agricultureamongapplicationsappliesdiscoverydistributionenvironmentalfunctiongrowthlivingmultipleorganizationpopulationrelationshipsselectionsharedstructurestudy
SHARED TOKENS (18): "agriculture", "among", "applications", "applies", "discovery", "distribution", "environmental", "function", "growth", "living", "multiple", "organization", "population", "relationships", "selection", "shared", "structure", "study". | EXACT TITLE in veterinary_animal_services: "Biology".
0.500
Rodeo ↗ Q207703 EXACT TITLE
associationcarecertaincompetitiveconstitutedesigneddividedequipmenteventeventsfederalgovernedindustrylaterlocalmakingnationalofficialorganizationplacing
SHARED TOKENS (32): "association", "care", "certain", "competitive", "constitute", "designed", "divided", "equipment", "event", "events", "federal", "governed", "industry", "later", "local", "making", "national", "official", "organization", "placing".... | EXACT TITLE in veterinary_animal_services: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
abilityagenciesallowingbusinessescapabilitiescollegecurrentdetermineemployersemploymenteventfieldgovernmentindustrylargelimitedmedicalnetworkopenopportunities
SHARED TOKENS (42): "ability", "agencies", "allowing", "businesses", "capabilities", "college", "current", "determine", "employers", "employment", "event", "field", "government", "industry", "large", "limited", "medical", "network", "open", "opportunities".... | EXACT TITLE in veterinary_animal_services: "Internship".
0.500
adaboisecentercommercialdepartmentfacilityfallsfieldfunctionsgeneralidahoincreaseinternationalnationaloperatedoperatesreceiverequiringsupportuses
SHARED TOKENS (21): "ada", "boise", "center", "commercial", "department", "facility", "falls", "field", "functions", "general", "idaho", "increase", "international", "national", "operated", "operates", "receive", "requiring", "support", "uses".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
administeredagencyagriculturalagricultureapproximatelyassistancecommercialcommunitiescurrentdepartmentdirectlyfederalfoodgovernmentnationalneedsproductionprogramprogramsreports
SHARED TOKENS (24): "administered", "agency", "agricultural", "agriculture", "approximately", "assistance", "commercial", "communities", "current", "department", "directly", "federal", "food", "government", "national", "needs", "production", "program", "programs", "reports".... | EXACT TITLE in veterinary_animal_services: "United States Department of Agriculture".
0.500
actadministrationagenciesagencyassistancecorridorcreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublicregulations
SHARED TOKENS (25): "act", "administration", "agencies", "agency", "assistance", "corridor", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingadministeredagencyassistancechangescodifiedcontrolcoordinationdirectlyenvironmentalfederalformgoverninginvolvinglawmaintainingmajornameowned
SHARED TOKENS (35): "act", "addressing", "administered", "agency", "assistance", "changes", "codified", "control", "coordination", "directly", "environmental", "federal", "form", "governing", "involving", "law", "maintaining", "major", "name", "owned".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingcommunitycomplexconnectingconnectionconstructioncontributionscreatecrossdesigndesignedenvironmentintendedlocalmajornetworkpermittedphysicalprovideproviding
SHARED TOKENS (31): "allowing", "community", "complex", "connecting", "connection", "construction", "contributions", "create", "cross", "design", "designed", "environment", "intended", "local", "major", "network", "permitted", "physical", "provide", "providing".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Rabies ↗ Q39222 EXACT TITLE
ageamongassociatedcarecontactcontractingcontrolcostcostsdependsdirecteffectiveevidenceexposuregrouphistoricallyhistorymedicalmovemovements
SHARED TOKENS (38): "age", "among", "associated", "care", "contact", "contracting", "control", "cost", "costs", "depends", "direct", "effective", "evidence", "exposure", "group", "historically", "history", "medical", "move", "movements".... | EXACT TITLE in veterinary_animal_services: "Rabies".
0.500
affectbehaviorbehavioralcareconcernsevenexistsfarmsfoodformalhistoryqualityresearchstandardsstudythereforeusesviewwelfare
SHARED TOKENS (19): "affect", "behavior", "behavioral", "care", "concerns", "even", "exists", "farms", "food", "formal", "history", "quality", "research", "standards", "study", "therefore", "uses", "view", "welfare". | EXACT TITLE in veterinary_animal_services: "Animal welfare".
0.500
Feedlot ↗ Q1400937 EXACT TITLE
actaffectagencyagriculturalamericanapprovalauthoritycertaincompleteconcentratedcontaincontrolleddifferentenvironmentenvironmentalfarmfarmsfoodgovernmentidentification
SHARED TOKENS (47): "act", "affect", "agency", "agricultural", "american", "approval", "authority", "certain", "complete", "concentrated", "contain", "controlled", "different", "environment", "environmental", "farm", "farms", "food", "government", "identification".... | EXACT TITLE in veterinary_animal_services: "Feedlot".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationapplieschangescollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributiondrainageenvironmentalfieldformfullgrowthhelps
SHARED TOKENS (43): "agricultural", "agriculture", "application", "applies", "changes", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distribution", "drainage", "environmental", "field", "form", "full", "growth", "helps".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
Raccoon ↗ Q121439 EXACT TITLE
againstamericanbehaviorcannotcitiesdistinguishenvironmentevidenceextendedhomeintelligencelistpotentialshowsubsequentlysurroundingthemthough
SHARED TOKENS (18): "against", "american", "behavior", "cannot", "cities", "distinguish", "environment", "evidence", "extended", "home", "intelligence", "list", "potential", "show", "subsequently", "surrounding", "them", "though". | EXACT TITLE in veterinary_animal_services: "Raccoon".
0.500
accessallowingbegandatadevelopmentdigitaldividedelectricalformindependentindividualinformationmeansmediaphysicalpowersignalstechnology
SHARED TOKENS (18): "access", "allowing", "began", "data", "development", "digital", "divided", "electrical", "form", "independent", "individual", "information", "means", "media", "physical", "power", "signals", "technology". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
businesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefinancialfinancingfirmsfundgenerallimitedlong-termmanagementoperationalotherwiseownership
SHARED TOKENS (30): "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "general", "limited", "long-term", "management", "operational", "otherwise", "ownership".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbusinessescitiesdesigneddirectlyfacilityfunctionlargematerialsmovingpartsproductiontransport
SHARED TOKENS (15): "agriculture", "associated", "building", "businesses", "cities", "designed", "directly", "facility", "function", "large", "materials", "moving", "parts", "production", "transport". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
agenciesconstructiondepartmentsdesigndistinguishenvironmentfirmsgovernmentinfrastructurelocallymunicipalnationalphysicalplaceprivateprofessionalpublicsectorstructuralsystems
SHARED TOKENS (20): "agencies", "construction", "departments", "design", "distinguish", "environment", "firms", "government", "infrastructure", "locally", "municipal", "national", "physical", "place", "private", "professional", "public", "sector", "structural", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyboardbusinesscorridordailydirectlyfederallimitedmetropolitannationalnetworkoperateoperatesoperatororganizationownedpartsreporting
SHARED TOKENS (26): "additional", "american", "approximately", "board", "business", "corridor", "daily", "directly", "federal", "limited", "metropolitan", "national", "network", "operate", "operates", "operator", "organization", "owned", "parts", "reporting".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
actadministrationagencyassociatedauthoritybegancontrolcurrentdepartmentdirectlyfederalfieldfoodformerhealthmedicalprimaryproductspublicregulated
SHARED TOKENS (27): "act", "administration", "agency", "associated", "authority", "began", "control", "current", "department", "directly", "federal", "field", "food", "former", "health", "medical", "primary", "products", "public", "regulated".... | EXACT TITLE in veterinary_animal_services: "Food and Drug Administration".
0.500
affectaffectedaffectsamongbecomeclassificationcontactcontainlimitedlinkedpotentialprimaryproductionsignificantspecific
SHARED TOKENS (15): "affect", "affected", "affects", "among", "become", "classification", "contact", "contain", "limited", "linked", "potential", "primary", "production", "significant", "specific". | EXACT TITLE in veterinary_animal_services: "Avian influenza".
0.500
agenciesapplybusinessescomprehensivedesignfacilitiesgovernmentincorporatesinfluencemovemovementneedspeopleplanningpoliciesprivateprocesspublicsystemtransport
SHARED TOKENS (21): "agencies", "apply", "businesses", "comprehensive", "design", "facilities", "government", "incorporates", "influence", "move", "movement", "needs", "people", "planning", "policies", "private", "process", "public", "system", "transport".... | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcitiescommunitydailydesigneddevelopedeconomicextendsfixedformformalgovernmentlocalmetropolitanmobilityoperateoperatedoperates
SHARED TOKENS (35): "access", "agencies", "beyond", "cities", "community", "daily", "designed", "developed", "economic", "extends", "fixed", "form", "formal", "government", "local", "metropolitan", "mobility", "operate", "operated", "operates".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
Horse ↗ Q726 EXACT TITLE
abilityageagricultureallowingapproximatelybeganbehaviorcontrolcreatingdevelopeddevelopmentdifferentdividedequipmentfullgeneralhistoricallylargepolicepossess
SHARED TOKENS (31): "ability", "age", "agriculture", "allowing", "approximately", "began", "behavior", "control", "creating", "developed", "development", "different", "divided", "equipment", "full", "general", "historically", "large", "police", "possess".... | EXACT TITLE in veterinary_animal_services: "Horse".
0.480
Broadband ↗ Q194163 EXACT TITLE
accessdatadifferentdigitalintegratedlevelnetworkproviderequirementssignalsspeedtechnologytransferuses
SHARED TOKENS (14): "access", "data", "different", "digital", "integrated", "level", "network", "provide", "requirements", "signals", "speed", "technology", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.480
controlscrossdesigndifferentintersectionjurisdictionslanemajorotherwisepracticeroadseparatetrafficuses
SHARED TOKENS (14): "controls", "cross", "design", "different", "intersection", "jurisdictions", "lane", "major", "otherwise", "practice", "road", "separate", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in veterinary_animal_services: "Intersection (road)".
0.460
Utility ↗ Q466707 EXACT TITLE
amongbehaviorcertaindecisiondevelopeddistincteconomicsfunctionfunctionsgoalmaintainingrelationshipsource
SHARED TOKENS (13): "among", "behavior", "certain", "decision", "developed", "distinct", "economics", "function", "functions", "goal", "maintaining", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in veterinary_animal_services: "Utility".
0.460
administrationagencydepartmentdivisionfederalmajorofficeprogramprogramspublicroadroletransportation
SHARED TOKENS (13): "administration", "agency", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.450
administrationbehaviorcarecertaincontrolfieldhomemajorpeopleproceduresprocessrequiringsizetechnicianwider
SHARED TOKENS (15): "administration", "behavior", "care", "certain", "control", "field", "home", "major", "people", "procedures", "process", "requiring", "size", "technician", "wider". | URL->B (1): http://www.navta.net/.
0.440
americancrossfieldintersectionmovementpermitroadsystemthoughtraffictransportuses
SHARED TOKENS (12): "american", "cross", "field", "intersection", "movement", "permit", "road", "system", "though", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in veterinary_animal_services: "Interchange (road)".
0.440
activityamongfallsidahomeridianpercentprogramspublicresearchstudentstwinuniversity
SHARED TOKENS (12): "activity", "among", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "twin", "university". | EXACT TITLE in transportation_infrastructure: "Idaho State University". | EXACT TITLE in veterinary_animal_services: "Idaho State University".
0.440
Cat ↗ Q146 EXACT TITLE
abilitycontactcontroldevelopedeventshouseincreasingintelligencenearpopulationrequiringsmall
SHARED TOKENS (12): "ability", "contact", "control", "developed", "events", "house", "increasing", "intelligence", "near", "population", "requiring", "small". | EXACT TITLE in transportation_infrastructure: "Cat". | EXACT TITLE in veterinary_animal_services: "Cat".
0.420
Mink ↗ Q17700 EXACT TITLE
actamericancontrolestablishedfarmsmedicalpreserveproductsthoughtreatmentwelfare
SHARED TOKENS (11): "act", "american", "control", "established", "farms", "medical", "preserve", "products", "though", "treatment", "welfare". | EXACT TITLE in veterinary_animal_services: "Mink".
0.420
academicauthoritycredentialcredentialsdocumentdocumentsidentificationindividualpeoplerelevantuser
SHARED TOKENS (11): "academic", "authority", "credential", "credentials", "document", "documents", "identification", "individual", "people", "relevant", "user". | EXACT TITLE in transportation_infrastructure: "Credential". | EXACT TITLE in veterinary_animal_services: "Credential".
0.420
Cattle ↗ Q830 EXACT TITLE
dividedeventfarmlargepartsproductsresponsibleseparatesmallthemwestern
SHARED TOKENS (11): "divided", "event", "farm", "large", "parts", "products", "responsible", "separate", "small", "them", "western". | EXACT TITLE in veterinary_animal_services: "Cattle".
0.400
Tularemia ↗ Q153861 EXACT TITLE
affectedcontactdiagnosisdirectlyformpeoplereportedsitetreatmentwater
SHARED TOKENS (10): "affected", "contact", "diagnosis", "directly", "form", "people", "reported", "site", "treatment", "water". | EXACT TITLE in veterinary_animal_services: "Tularemia".
0.400
Floodplain ↗ Q193110 EXACT TITLE
agriculturalcontroldevelopedfloodincreasinglandnearrivervalleywater
SHARED TOKENS (10): "agricultural", "control", "developed", "flood", "increasing", "land", "near", "river", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.400
acquisitionbusinessconsolidationentitiesentityfinancialgrouptaxationtransfertreatment
SHARED TOKENS (10): "acquisition", "business", "consolidation", "entities", "entity", "financial", "group", "taxation", "transfer", "treatment". | EXACT TITLE in transportation_infrastructure: "Consolidation (business)". | EXACT TITLE in veterinary_animal_services: "Consolidation (business)".
0.380
associationcreatedenvironmentallandmobilitymultiplepeopleruralserves
SHARED TOKENS (9): "association", "created", "environmental", "land", "mobility", "multiple", "people", "rural", "serves". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.380
Biosecurity ↗ Q803874 EXACT TITLE
agriculturedesigneddifferentfoodneededpeoplepopulationreducewelfare
SHARED TOKENS (9): "agriculture", "designed", "different", "food", "needed", "people", "population", "reduce", "welfare". | EXACT TITLE in veterinary_animal_services: "Biosecurity".
0.380
conditionscontrolhealthmanagementmedicalpracticesprofessionalroletreats
SHARED TOKENS (9): "conditions", "control", "health", "management", "medical", "practices", "professional", "role", "treats". | EXACT TITLE in veterinary_animal_services: "Veterinarian".
0.380
Dairy cattle ↗ Q2915 EXACT TITLE
abilitydistinctionhistoricallyindustrylargeproduceproductionproductsspecialized
SHARED TOKENS (9): "ability", "distinction", "historically", "industry", "large", "produce", "production", "products", "specialized". | EXACT TITLE in veterinary_animal_services: "Dairy cattle".
0.380
boiseeasternexpansionformeridaholakeoperatingroutethough
SHARED TOKENS (9): "boise", "eastern", "expansion", "former", "idaho", "lake", "operating", "route", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.360
Snowplow ↗ Q14976 EXACT TITLE
clearintendedlargeoutdoorreceiveservingspecifictransportation
SHARED TOKENS (8): "clear", "intended", "large", "outdoor", "receive", "serving", "specific", "transportation". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.360
Sidewalk ↗ Q177749 EXACT TITLE
americandesignedlandmobilityprivateroadsidestreet
SHARED TOKENS (8): "american", "designed", "land", "mobility", "private", "road", "side", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.360
agriculturalcontrolidentificationownershipprocessresearchspecifictrack
SHARED TOKENS (8): "agricultural", "control", "identification", "ownership", "process", "research", "specific", "track". | EXACT TITLE in veterinary_animal_services: "Animal identification".
0.340
designedgoaloperationoperationsprincipalproductionuses
SHARED TOKENS (7): "designed", "goal", "operation", "operations", "principal", "production", "uses". | EXACT TITLE in veterinary_animal_services: "Beef cattle".
0.340
Kennel ↗ Q2724542 EXACT TITLE
buildingcollectionmaterialsmeanspropertystructurethough
SHARED TOKENS (7): "building", "collection", "materials", "means", "property", "structure", "though". | EXACT TITLE in veterinary_animal_services: "Kennel".
0.340
academicagriculturalagricultureeconomicfieldpartspractice
SHARED TOKENS (7): "academic", "agricultural", "agriculture", "economic", "field", "parts", "practice". | EXACT TITLE in veterinary_animal_services: "Agricultural science".
0.320
agriculturalcommunitiesownerspermittedplacepolicy
SHARED TOKENS (6): "agricultural", "communities", "owners", "permitted", "place", "policy". | EXACT TITLE in veterinary_animal_services: "Animal shelter".
0.300
Elk ↗ Q180404 KW CROSS HIGH
americanamongdistinctdistinguishdistributionevidenceindustrylargenameopenpartsproductionregionshowssignaltransmittedwesternwider
SHARED TOKENS (18): "american", "among", "distinct", "distinguish", "distribution", "evidence", "industry", "large", "name", "open", "parts", "production", "region", "shows", "signal", "transmitted", "western", "wider".
0.300
accesschaincostsdirecteconomicsgeneralgroupintendedinternationalitselfmovingoperatingpracticepracticesregionspecializedtransporttransportation
SHARED TOKENS (18): "access", "chain", "costs", "direct", "economics", "general", "group", "intended", "international", "itself", "moving", "operating", "practice", "practices", "region", "specialized", "transport", "transportation".
0.300
Dairy farming ↗ KW CROSS HIGH
agriculturalagriculturecontrolcreateddevelopeddirectenvironmentalexpansionfarmfarmsgeneralgrowthhealthhistoryincreaseindustrylargelong-termpipelineplace
SHARED TOKENS (30): "agricultural", "agriculture", "control", "created", "developed", "direct", "environmental", "expansion", "farm", "farms", "general", "growth", "health", "history", "increase", "industry", "large", "long-term", "pipeline", "place"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedautomobilebecomebuildingcitiescommercialcostsdescribeddevelopmentenvironmentenvironmentalexpansionformgrowthhousinginfrastructurelandlargemaintaining
SHARED TOKENS (34): "agency", "associated", "automobile", "become", "building", "cities", "commercial", "costs", "described", "development", "environment", "environmental", "expansion", "form", "growth", "housing", "infrastructure", "land", "large", "maintaining"....
0.300
Cremation ↗ Q207315 EXACT TITLE
constitutehealthpartsremainssite
SHARED TOKENS (5): "constitute", "health", "parts", "remains", "site". | EXACT TITLE in veterinary_animal_services: "Cremation".
0.300
actcertaindisabilityexemptionsfederalhealthhealthcarehousingindividualneedneededpeoplepossessproviderreceiverequirementsrulesspecializedsupporttrained
SHARED TOKENS (20): "act", "certain", "disability", "exemptions", "federal", "health", "healthcare", "housing", "individual", "need", "needed", "people", "possess", "provider", "receive", "requirements", "rules", "specialized", "support", "trained".
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalautomobilebrandconditionsdeterminedigitalindependentinspectionneedspartsproposedrolespecifictechnicianwork
SHARED TOKENS (15): "approval", "automobile", "brand", "conditions", "determine", "digital", "independent", "inspection", "needs", "parts", "proposed", "role", "specific", "technician", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomedesignenvironmentfullincreaseintegrationintersectionmakesneednoisepermittedreducerequireresearchresultingroadrulessafetysignals
SHARED TOKENS (26): "associated", "become", "design", "environment", "full", "increase", "integration", "intersection", "makes", "need", "noise", "permitted", "reduce", "require", "research", "resulting", "road", "rules", "safety", "signals"....
0.300
actadministrationauthoritycontrolfederalfoodformlawmedicalnationalprincipalprovisionsregulationsrequirementssafetystudy
SHARED TOKENS (16): "act", "administration", "authority", "control", "federal", "food", "form", "law", "medical", "national", "principal", "provisions", "regulations", "requirements", "safety", "study".
0.300
creatingdemanddisabilityfixedformfunctionsmedicalmobilemovementneedsnetworkolderpeopleprivateprogramsprovidepublicratherrelevantroute
SHARED TOKENS (24): "creating", "demand", "disability", "fixed", "form", "functions", "medical", "mobile", "movement", "needs", "network", "older", "people", "private", "programs", "provide", "public", "rather", "relevant", "route"....
0.300
administrationagenciesagencyamongapplicantscarecertaincommercialcrossdifferentenvironmentalexaminedfederalgovernmenthealthindividualindustryjurisdictionlicenselicensed
SHARED TOKENS (39): "administration", "agencies", "agency", "among", "applicants", "care", "certain", "commercial", "cross", "different", "environmental", "examined", "federal", "government", "health", "individual", "industry", "jurisdiction", "license", "licensed"....
0.300
amonganalysisapplicationcareclinicalcomplexconcernsdatadecisiondevelopmentdiagnosisexaminedhealthhealthcareintelligenceinvolvingmedicalmonitoringplanningpublic
SHARED TOKENS (25): "among", "analysis", "application", "care", "clinical", "complex", "concerns", "data", "decision", "development", "diagnosis", "examined", "health", "healthcare", "intelligence", "involving", "medical", "monitoring", "planning", "public"....
0.300
americanbusinessescenterschangescitiesdevelopmenteconomicenvironmentalexpansiongrowthmodelmovementpatternspopulationprocessresidentsrural
SHARED TOKENS (17): "american", "businesses", "centers", "changes", "cities", "development", "economic", "environmental", "expansion", "growth", "model", "movement", "patterns", "population", "process", "residents", "rural".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesschargescitiescommunitiesconnectingdifferentdistrictsinsidemetropolitanmultipleoperateoperatespricingregionalsystemstransport
SHARED TOKENS (16): "business", "charges", "cities", "communities", "connecting", "different", "districts", "inside", "metropolitan", "multiple", "operate", "operates", "pricing", "regional", "systems", "transport".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
behaviorclassificationscontrolcriticalenforcementeventhealthidentifiedimproveleveloccupationalpracticesproduceprovidingpublicremainrequiringroadruralsafety
SHARED TOKENS (30): "behavior", "classifications", "control", "critical", "enforcement", "event", "health", "identified", "improve", "level", "occupational", "practices", "produce", "providing", "public", "remain", "requiring", "road", "rural", "safety"....
0.300
buildingbusinesscenterdesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepublicrelationshipresidentialscaleservingspacetransport
SHARED TOKENS (20): "building", "business", "center", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "space", "transport".
0.300
approximatelyboisedatadistrictdistrictsdividedevengovernmenthouseidaholegislaturelimitspeoplepopulationresidents
SHARED TOKENS (15): "approximately", "boise", "data", "district", "districts", "divided", "even", "government", "house", "idaho", "legislature", "limits", "people", "population", "residents".
0.300
activityadministrationagencieschangescontrolcreateddecisionsdivisioneconomiceducationenforcementenvironmentenvironmentalgoverninggovernmentincreaseinfluenceinternationalitselflaw
SHARED TOKENS (35): "activity", "administration", "agencies", "changes", "control", "created", "decisions", "division", "economic", "education", "enforcement", "environment", "environmental", "governing", "government", "increase", "influence", "international", "itself", "law"....
0.300
againstconcerningcostsdifferenteducationevenfoodgoverningissueitselfjurisdictionslaterpeoplepracticesproductionproductspropertyresearchspecificthough
SHARED TOKENS (23): "against", "concerning", "costs", "different", "education", "even", "food", "governing", "issue", "itself", "jurisdictions", "later", "people", "practices", "production", "products", "property", "research", "specific", "though"....
0.300
administrationagriculturalclinicalcomplianceeffectiveenvironmentenvironmentalfarmfoodgroupgrowthhealthimproveincreaseindustryjanuaryorganizationregulatorysafetystudy
SHARED TOKENS (24): "administration", "agricultural", "clinical", "compliance", "effective", "environment", "environmental", "farm", "food", "group", "growth", "health", "improve", "increase", "industry", "january", "organization", "regulatory", "safety", "study"....
0.300
administrationageagencyamericanbuildingcenterscommercialconstructiondepartmentdistributiondivisioneducationenginesenvironmentalfederalgoverninggovernshandlinghealthhome
SHARED TOKENS (49): "administration", "age", "agency", "american", "building", "centers", "commercial", "construction", "department", "distribution", "division", "education", "engines", "environmental", "federal", "governing", "governs", "handling", "health", "home"....
0.300
analysisclinicalcontaincreatingdatadesigneddigitalequipmentestablishesexposurefunctiongraphindustryintegratedlimitedmapsmediamedicalpowerprocedures
SHARED TOKENS (26): "analysis", "clinical", "contain", "creating", "data", "designed", "digital", "equipment", "establishes", "exposure", "function", "graph", "industry", "integrated", "limited", "maps", "media", "medical", "power", "procedures"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycertaincreatedcrossdifferentestatefacilityfullgovernmentlandlegallocaloperateotherwiseownershippartspathspeoplephysicalprivate
SHARED TOKENS (28): "authority", "certain", "created", "cross", "different", "estate", "facility", "full", "government", "land", "legal", "local", "operate", "otherwise", "ownership", "parts", "paths", "people", "physical", "private"....
0.300
actadditionalagriculturecarecoveragefacilitiesfacilityfarmfederalhousejurisdictionlawlicenselicensedmonitoringotherwisepoliciespracticesprimaryprovisions
SHARED TOKENS (27): "act", "additional", "agriculture", "care", "coverage", "facilities", "facility", "farm", "federal", "house", "jurisdiction", "law", "license", "licensed", "monitoring", "otherwise", "policies", "practices", "primary", "provisions"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelybecomecitiescommunitiescompetitiveconditioncreatecreatescurrentdescribesdevelopeddevelopmenteconomiceconomicseducationenvironmentalgenerategoalgrowthhealth
SHARED TOKENS (55): "approximately", "become", "cities", "communities", "competitive", "condition", "create", "creates", "current", "describes", "developed", "development", "economic", "economics", "education", "environmental", "generate", "goal", "growth", "health"....
0.300
addressingcaregoalhousingmedicalprocesspublicrecoveryrehabilitationrolespecializedtemporarythemtreatmentwelfarework
SHARED TOKENS (16): "addressing", "care", "goal", "housing", "medical", "process", "public", "recovery", "rehabilitation", "role", "specialized", "temporary", "them", "treatment", "welfare", "work".
0.300
addingautomobilebecomecapacityconditiondemanddepartmentsfixedincreasinglaneplanningpublicresultingroadroutespeedtraffictransporttransportation
SHARED TOKENS (19): "adding", "automobile", "become", "capacity", "condition", "demand", "departments", "fixed", "increasing", "lane", "planning", "public", "resulting", "road", "route", "speed", "traffic", "transport", "transportation".
0.300
accessadministrationagencyamericanannouncedassociationcapacitycenterschangescontroldepartmentdesigneddisabilityenvironmentalfederalfoodgoalgovernmenthealthimprove
SHARED TOKENS (38): "access", "administration", "agency", "american", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "disability", "environmental", "federal", "food", "goal", "government", "health", "improve"....
0.300
accessboisecapitalconnectscontainscreateddepartmentgardenhistoricalhistoryidaholandmunicipaloperatedregionriversocietystreetuniversitywest
SHARED TOKENS (21): "access", "boise", "capital", "connects", "contains", "created", "department", "garden", "historical", "history", "idaho", "land", "municipal", "operated", "region", "river", "society", "street", "university", "west"....
0.300
americancapacitycapitalcitiesconnectingconventionalcostdailydesigndesignednetworkpublicqualityreducespeedsystemsystemstraffictransportation
SHARED TOKENS (19): "american", "capacity", "capital", "cities", "connecting", "conventional", "cost", "daily", "design", "designed", "network", "public", "quality", "reduce", "speed", "system", "systems", "traffic", "transportation".
0.300
Goat ↗ Q2934 EXACT TITLE
amongeasternlivingpartssouthwest
SHARED TOKENS (5): "among", "eastern", "living", "parts", "southwest". | EXACT TITLE in veterinary_animal_services: "Goat".
0.300
adoptedadvancedapplicationcapacitychangescollectionconditionsdifferentemergencyfieldimproveincreaseinformationinfrastructuremanagementmobilityprovidereduceroadsafety
SHARED TOKENS (27): "adopted", "advanced", "application", "capacity", "changes", "collection", "conditions", "different", "emergency", "field", "improve", "increase", "information", "infrastructure", "management", "mobility", "provide", "reduce", "road", "safety"....
0.300
Pre-medical ↗ Q7239245 KW CROSS HIGH
applicationclinicaleducationentryformalmedicalpharmacypriorprocessprofessionalprogramsprovidingrequireresearchschoolsimultaneouslystudentstrack
SHARED TOKENS (18): "application", "clinical", "education", "entry", "formal", "medical", "pharmacy", "prior", "process", "professional", "programs", "providing", "require", "research", "school", "simultaneously", "students", "track".
0.300
controleconomicallymodelpartsresearch
SHARED TOKENS (5): "control", "economically", "model", "parts", "research". | EXACT TITLE in veterinary_animal_services: "Pseudorabies".
0.300
accommodateaggregatecreatingdepartmentdesigneddifferentdividedevenmovementpathspathwaypermitprimaryprovideroutesharedtransportuser
SHARED TOKENS (18): "accommodate", "aggregate", "creating", "department", "designed", "different", "divided", "even", "movement", "paths", "pathway", "permit", "primary", "provide", "route", "shared", "transport", "user".
0.300
approximatelycarecontrolfarmfarmsfoodhousingidentificationidentifyingintegratedlargemedicalownersplacerescuereturnsizetechnologyuses
SHARED TOKENS (19): "approximately", "care", "control", "farm", "farms", "food", "housing", "identification", "identifying", "integrated", "large", "medical", "owners", "place", "rescue", "return", "size", "technology", "uses".
0.300
americanassistancecreatedcrossevenfacilitiesintersectionjurisdictionslargeotherwiseplaceroadrulessafetyschoolseparatesignalsspeedstreettraffic
SHARED TOKENS (20): "american", "assistance", "created", "cross", "even", "facilities", "intersection", "jurisdictions", "large", "otherwise", "place", "road", "rules", "safety", "school", "separate", "signals", "speed", "street", "traffic".
0.300
Dog training ↗ Q38490 KW CROSS HIGH
analysisapplicationassociationbehaviordevelopedeffectiveenvironmentenvironmentaleventspracticerelationshipspecifictrainedtrainingtriggeruses
SHARED TOKENS (16): "analysis", "application", "association", "behavior", "developed", "effective", "environment", "environmental", "events", "practice", "relationship", "specific", "trained", "training", "trigger", "uses".
0.300
appliesapprovalassociationdecisiondecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyinginternationalmajormakingmanagementmoveparticipationplanplanspolicies
SHARED TOKENS (32): "applies", "approval", "association", "decision", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "international", "major", "making", "management", "move", "participation", "plan", "plans", "policies"....
0.300
carecommunitiescurrentdevelopedeconomicfinanceformhealthhealthcareindustryintegrationmedicalpercentpowerproductspurchasingrequirementssectorsystem
SHARED TOKENS (19): "care", "communities", "current", "developed", "economic", "finance", "form", "health", "healthcare", "industry", "integration", "medical", "percent", "power", "products", "purchasing", "requirements", "sector", "system".
0.300
accommodationadoptionageagenciesamericanapproximatelybehaviorcannotcareclassificationscommercialcreateddescribeddifferentenvironmentfacilitygeneralgrouphandlinghome
SHARED TOKENS (59): "accommodation", "adoption", "age", "agencies", "american", "approximately", "behavior", "cannot", "care", "classifications", "commercial", "created", "described", "different", "environment", "facility", "general", "group", "handling", "home"....
0.300
accessadvancedamericanautomobilecapacitychangescitiesconnectconnectedconnectingcontainingdesignedevenfreeincreasinglimitsnetworkopenedparkingpaths
SHARED TOKENS (36): "access", "advanced", "american", "automobile", "capacity", "changes", "cities", "connect", "connected", "connecting", "containing", "designed", "even", "free", "increasing", "limits", "network", "opened", "parking", "paths"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasternextendedgeneralidahointersectioninterstatemajornationalnearnorthwestofficialriverroadrouterulesthroughoutwestwestern
SHARED TOKENS (19): "caldwell", "eastern", "extended", "general", "idaho", "intersection", "interstate", "major", "national", "near", "northwest", "official", "river", "road", "route", "rules", "throughout", "west", "western".
0.300
accessagainstagricultureannuallyassociateddevelopmentdirectlyfundhealthinternationalmanagementmultipleorganizationpracticesprimaryprovidepublicreducerequireresearch
SHARED TOKENS (26): "access", "against", "agriculture", "annually", "associated", "development", "directly", "fund", "health", "international", "management", "multiple", "organization", "practices", "primary", "provide", "public", "reduce", "require", "research"....
0.300
Animal rights ↗ Q426 KW CROSS HIGH
actactivityaggregateallowingamericanassociatedcannotcentercertainenterfarmsfoodindependentitselflawlegallegallymaintainsmembershipmerely
SHARED TOKENS (32): "act", "activity", "aggregate", "allowing", "american", "associated", "cannot", "center", "certain", "enter", "farms", "food", "independent", "itself", "law", "legal", "legally", "maintains", "membership", "merely"....
0.300
authoritybuildingbusinesscapitalcenterscertaincommercecommercialcontainingestatefarmfunctionsgeneratehousingintendedlandlocalmedicalmultipleoffice
SHARED TOKENS (27): "authority", "building", "business", "capital", "centers", "certain", "commerce", "commercial", "containing", "estate", "farm", "functions", "generate", "housing", "intended", "land", "local", "medical", "multiple", "office"....
0.300
associatedcareclinicalcontactcontainingdescribeddiagnosisdistinctemergencyenvironmentenvironmentalfacilitiesgeneralgenerategenerationhazardoushealthhealthcarehomehospital
SHARED TOKENS (32): "associated", "care", "clinical", "contact", "containing", "described", "diagnosis", "distinct", "emergency", "environment", "environmental", "facilities", "general", "generate", "generation", "hazardous", "health", "healthcare", "home", "hospital"....
0.300
actaffectamongapplychangesconditioncontactcreateddescribesdirectdistributionenvironmentenvironmentalhealthincreaseindividualindustrymodelmovementpeople
SHARED TOKENS (25): "act", "affect", "among", "apply", "changes", "condition", "contact", "created", "describes", "direct", "distribution", "environment", "environmental", "health", "increase", "individual", "industry", "model", "movement", "people"....
0.300
connectscurrentdirectdirectlydistinctdistributioneasternelectricalevenformhandlinghistoricallyincreaseindustrylevellocalmajormarketmovementnetwork
SHARED TOKENS (27): "connects", "current", "direct", "directly", "distinct", "distribution", "eastern", "electrical", "even", "form", "handling", "historically", "increase", "industry", "level", "local", "major", "market", "movement", "network"....
0.300
accessibilityactadaagainstbusinesschangescostsdisabilityeffectiveemployershousejanuarylaterlawnationalprovidepublicrequirementsrequires
SHARED TOKENS (19): "accessibility", "act", "ada", "against", "business", "changes", "costs", "disability", "effective", "employers", "house", "january", "later", "law", "national", "provide", "public", "requirements", "requires".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontrolinformationintersectionlanelevellocalmovementsnationalneedpolicereduceroadsignalsignalssystemsystemstechnology
SHARED TOKENS (21): "advanced", "capacity", "competing", "control", "information", "intersection", "lane", "level", "local", "movements", "national", "need", "police", "reduce", "road", "signal", "signals", "system", "systems", "technology"....
0.300
buildingcertainconditionscontainingcreatesenvironmentevenhazardhazardoushealthidentificationmaterialspeoplepersonnelphysicalpropertypublicregulationsriskssafety
SHARED TOKENS (26): "building", "certain", "conditions", "containing", "creates", "environment", "even", "hazard", "hazardous", "health", "identification", "materials", "people", "personnel", "physical", "property", "public", "regulations", "risks", "safety"....
0.300
announcedcentercreateitselflaternetworkoperatesoperatingplansprincipalreportingroadroutesystemtransportationwestwestern
SHARED TOKENS (17): "announced", "center", "create", "itself", "later", "network", "operates", "operating", "plans", "principal", "reporting", "road", "route", "system", "transportation", "west", "western".
0.300
accessactadditionaladministrationadoptedannuallyapproximatelyavoidbegancollectioncompleteconstructioncontrolledcostcreatingdesigndesigneddevelopedestablishedexpand
SHARED TOKENS (47): "access", "act", "additional", "administration", "adopted", "annually", "approximately", "avoid", "began", "collection", "complete", "construction", "controlled", "cost", "creating", "design", "designed", "developed", "established", "expand"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationadoptedanalysisbroaderbusinesscapitalcategorycitiescodescommunitiescommunitycreatingdesigndevelopmentdifferentdistributioneconomicenvironmentenvironmental
SHARED TOKENS (60): "accessibility", "administration", "adopted", "analysis", "broader", "business", "capital", "category", "cities", "codes", "communities", "community", "creating", "design", "development", "different", "distribution", "economic", "environment", "environmental"....
0.300
activityanalysisdesigndocumentationenvironmentestablishedgeneralgovernmentjurisdictionslegallicenselicensedlicensurelocalpartsplanspracticepractitionersprocessproducts
SHARED TOKENS (36): "activity", "analysis", "design", "documentation", "environment", "established", "general", "government", "jurisdictions", "legal", "license", "licensed", "licensure", "local", "parts", "plans", "practice", "practitioners", "process", "products"....
0.300
Telehealth ↗ Q46994 KW CROSS HIGH
accessadministrationapplicationapplicationscareclinicalconditionsdatadefinesdigitaleducationevenfacilitieshealthhealthcarehomeimproveinformationintegrationlimited
SHARED TOKENS (40): "access", "administration", "application", "applications", "care", "clinical", "conditions", "data", "defines", "digital", "education", "even", "facilities", "health", "healthcare", "home", "improve", "information", "integration", "limited"....
0.300
academicbusinessescarecentersclinicalcommercialcomprehensivedecisionsdiagnosisfacilitieshealthhospitalsindependentinformationlong-termmanagementmedicaloperateotherwiseprovide
SHARED TOKENS (25): "academic", "businesses", "care", "centers", "clinical", "commercial", "comprehensive", "decisions", "diagnosis", "facilities", "health", "hospitals", "independent", "information", "long-term", "management", "medical", "operate", "otherwise", "provide"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
adoptedapplyauthoritybeganbuildingchargescodecodescomplianceconstructioncontroldepartmentsdesigndistrictelectricalenvironmentalestatefacilitygeneralhealth
SHARED TOKENS (50): "adopted", "apply", "authority", "began", "building", "charges", "code", "codes", "compliance", "construction", "control", "departments", "design", "district", "electrical", "environmental", "estate", "facility", "general", "health"....
0.300
affectsbehaviorbusinesscertificationconcernsconsumercreatescustomereconomicentryevidenceformfreegeneralgovernmentgrowthhealthindividuallawlicense
SHARED TOKENS (41): "affects", "behavior", "business", "certification", "concerns", "consumer", "creates", "customer", "economic", "entry", "evidence", "form", "free", "general", "government", "growth", "health", "individual", "law", "license"....
0.300
academicapplicationdesignfacilitiesfieldmanagementmovementoccupationaloperationpeopleplanningprovidetechnologytransporttransportation
SHARED TOKENS (15): "academic", "application", "design", "facilities", "field", "management", "movement", "occupational", "operation", "people", "planning", "provide", "technology", "transport", "transportation".
0.300
actadministeredagenciesapproximatelyauthorityauthorizedbuildingbusinesscapacityconstituteconstructioncontroldepartmentdesigndirectdirectlyenvironmentenvironmentalfacilitiesfederal
SHARED TOKENS (58): "act", "administered", "agencies", "approximately", "authority", "authorized", "building", "business", "capacity", "constitute", "construction", "control", "department", "design", "direct", "directly", "environment", "environmental", "facilities", "federal"....
0.300
fieldinvolvingnetworktraffictransportation
SHARED TOKENS (5): "field", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
Shortage ↗ Q2184645 EXACT TITLE
demandeconomiceconomicsmarketsupply
SHARED TOKENS (5): "demand", "economic", "economics", "market", "supply". | EXACT TITLE in transportation_infrastructure: "Shortage". | EXACT TITLE in veterinary_animal_services: "Shortage".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementarrangementbrandbusinesscapitalcertainchaincompeteconditionscorporatedirecteconomicentityexpansionexplicitlyfeesfinancialgrowthindividuallarge
SHARED TOKENS (43): "agreement", "arrangement", "brand", "business", "capital", "certain", "chain", "compete", "conditions", "corporate", "direct", "economic", "entity", "expansion", "explicitly", "fees", "financial", "growth", "individual", "large"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionapplicationauthorizedconnectdevelopmentevenfeefullfunctionsgovernmentjurisdictionslandlaterlegalmunicipalitiesownersownershippaymentpowerprivate
SHARED TOKENS (27): "acquisition", "application", "authorized", "connect", "development", "even", "fee", "full", "functions", "government", "jurisdictions", "land", "later", "legal", "municipalities", "owners", "ownership", "payment", "power", "private"....
0.300
Dog grooming ↗ Q38479 KW CROSS HIGH
actcarecertainconcernsdifferenthistoryknowledgelatermaintainingphysicalprocessprofessionalproviderecordrequireresponsiblethroughouttrainedwork
SHARED TOKENS (19): "act", "care", "certain", "concerns", "different", "history", "knowledge", "later", "maintaining", "physical", "process", "professional", "provide", "record", "require", "responsible", "throughout", "trained", "work".
0.300
additionaladvancedagenciesbeganbusinessescarecertaincontactdepartmentdispatchemergencyfacilitieshistoricallyhospitalmedicalmodeloperatepartspersonnelplaces
SHARED TOKENS (38): "additional", "advanced", "agencies", "began", "businesses", "care", "certain", "contact", "department", "dispatch", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "parts", "personnel", "places"....
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdefinesdepartmentdesigndesigneddevelopeddocumentfederallawlocalnationalopenowned
SHARED TOKENS (30): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "defines", "department", "design", "designed", "developed", "document", "federal", "law", "local", "national", "open", "owned"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
cannotconnectdesigndesigneddrainageevenfallshazardousinfrastructureinsidelargemunicipalparkingpropertypublicreceiverequireresidentialsewersmall
SHARED TOKENS (23): "cannot", "connect", "design", "designed", "drainage", "even", "falls", "hazardous", "infrastructure", "inside", "large", "municipal", "parking", "property", "public", "receive", "require", "residential", "sewer", "small"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdifferentformindividualmultipleoperateoperatesoperatingoperationssectionspeedsystemsystemstechnologytrafficuses
SHARED TOKENS (19): "broader", "capability", "capacity", "conditions", "different", "form", "individual", "multiple", "operate", "operates", "operating", "operations", "section", "speed", "system", "systems", "technology", "traffic", "uses".
0.300
Red fox ↗ Q8332 KW CROSS HIGH
abilityassociationcaredistributiondividedhistorylargelaterlistnamepartspopulationpriorrepresentedsignificantsizesmallthough
SHARED TOKENS (18): "ability", "association", "care", "distribution", "divided", "history", "large", "later", "list", "name", "parts", "population", "prior", "represented", "significant", "size", "small", "though".
0.300
authoritycontractingcontrolfinancialfoodgeneralhealthinformationinstitutionalinternationalmaintainsofficeprimaryproductsreferenceregionalriskssafetysupportingsystem
SHARED TOKENS (22): "authority", "contracting", "control", "financial", "food", "general", "health", "information", "institutional", "international", "maintains", "office", "primary", "products", "reference", "regional", "risks", "safety", "supporting", "system"....
0.300
Epizootiology ↗ Q4115091 KW CROSS HIGH
affectagriculturalappliescontrolcriticaldistributionenvironmentgoalhealthimprovelinkedpatternspercentpracticepublicrolestudysystems
SHARED TOKENS (18): "affect", "agricultural", "applies", "control", "critical", "distribution", "environment", "goal", "health", "improve", "linked", "patterns", "percent", "practice", "public", "role", "study", "systems".
0.300
accesscommunitycompletedesigndesignedeconomicenvironmentalhealthhomelivingoperatedpolicypractitionerspublicrequiressafetytraffictransportation
SHARED TOKENS (18): "access", "community", "complete", "design", "designed", "economic", "environmental", "health", "home", "living", "operated", "policy", "practitioners", "public", "requires", "safety", "traffic", "transportation".
0.300
activityagenciesauthorizationbusinessdepartmentsdeterminesgovernmentjurisdictionlicenselicenseslocalmultiplemunicipalitiesoperateoperatingpermitsphysicalrequires
SHARED TOKENS (18): "activity", "agencies", "authorization", "business", "departments", "determines", "government", "jurisdiction", "license", "licenses", "local", "multiple", "municipalities", "operate", "operating", "permits", "physical", "requires".
0.300
boisecitiescrossfallshomeidahointerstatemajormetropolitannearnorthwestriverrouteservestwin
SHARED TOKENS (15): "boise", "cities", "cross", "falls", "home", "idaho", "interstate", "major", "metropolitan", "near", "northwest", "river", "route", "serves", "twin".
🫐 BERRY54 edges
0.280
Q fever ↗ Q164818 EXACT TITLE
affectscontactevenperiod
SHARED TOKENS (4): "affects", "contact", "even", "period". | EXACT TITLE in veterinary_animal_services: "Q fever".
0.280
additionaladvanceddifferenteconomicfarmformergeneralgoaljurisdictionmanagementpracticeproceduressystemtreatment
SHARED TOKENS (14): "additional", "advanced", "different", "economic", "farm", "former", "general", "goal", "jurisdiction", "management", "practice", "procedures", "system", "treatment".
0.280
meanspracticetechnologytreatment
SHARED TOKENS (4): "means", "practice", "technology", "treatment". | EXACT TITLE in veterinary_animal_services: "Artificial insemination".
0.280
accessconnectingdesignedformerjurisdictionslocalmajormoveprovideresidentialroadservestrafficwider
SHARED TOKENS (14): "access", "connecting", "designed", "former", "jurisdictions", "local", "major", "move", "provide", "residential", "road", "serves", "traffic", "wider".
0.280
academiccollegecommunitydifferenteducationformopenpolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (14): "academic", "college", "community", "different", "education", "form", "open", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.280
Skunk ↗ Q43604020 EXACT TITLE
abilitydifferentnamewarning
SHARED TOKENS (4): "ability", "different", "name", "warning". | EXACT TITLE in veterinary_animal_services: "Skunk".
0.260
createenginesuses
SHARED TOKENS (3): "create", "engines", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
carecostcostsexpectationshealthinsurancelivingmarketmedicalownerspartlypoliciestreatment
SHARED TOKENS (13): "care", "cost", "costs", "expectations", "health", "insurance", "living", "market", "medical", "owners", "partly", "policies", "treatment".
0.260
Brucellosis ↗ Q156050 EXACT TITLE
affectsfunctionsmall
SHARED TOKENS (3): "affects", "function", "small". | EXACT TITLE in veterinary_animal_services: "Brucellosis".
0.260
americandepartmentdepartmentsdirectlyfederalgovernmentmovementpeopleplanreportsservingsystemtransportation
SHARED TOKENS (13): "american", "department", "departments", "directly", "federal", "government", "movement", "people", "plan", "reports", "serving", "system", "transportation".
0.240
Machine learning ↗ Q2539 KW CROSS HIGH
analysisapproximatelydatadescribeddescribingdevelopmentexplicitlyfieldframeworkintelligenceperformancestudy
SHARED TOKENS (12): "analysis", "approximately", "data", "described", "describing", "development", "explicitly", "field", "framework", "intelligence", "performance", "study".
0.240
becomechangesdesignimprovephysicalresponsibleroadrulesafetyspeedtrafficuses
SHARED TOKENS (12): "become", "changes", "design", "improve", "physical", "responsible", "road", "rule", "safety", "speed", "traffic", "uses".
0.240
Pet adoption ↗ Q7171565 KW CROSS HIGH
adoptioncurrentdeterminedifferenthomemedicalneedownersprovidepurchasingrelocationrescue
SHARED TOKENS (12): "adoption", "current", "determine", "different", "home", "medical", "need", "owners", "provide", "purchasing", "relocation", "rescue".
0.240
americanamongapplicationassociationcareconditionsmedicalspecializedtechnicianstreatmentworkworkers
SHARED TOKENS (12): "american", "among", "application", "association", "care", "conditions", "medical", "specialized", "technicians", "treatment", "work", "workers".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
citieslargemarketingmetropolitanparkingpeoplepoolpublicroadsystemtransfertransport
SHARED TOKENS (12): "cities", "large", "marketing", "metropolitan", "parking", "people", "pool", "public", "road", "system", "transfer", "transport".
0.240
allowingassistancehealthpracticeproceduresprofessionalrolescopesystemtechnicianthroughoutworkers
SHARED TOKENS (12): "allowing", "assistance", "health", "practice", "procedures", "professional", "role", "scope", "system", "technician", "throughout", "workers".
0.240
Zoonosis ↗ Q182672 KW CROSS HIGH
amongdifferentdirectdirectlymajorpossesspotentialrequireroleseparatethoughtransmitted
SHARED TOKENS (12): "among", "different", "direct", "directly", "major", "possess", "potential", "require", "role", "separate", "though", "transmitted".
0.240
Oversize load ↗ Q680421 KW CROSS HIGH
constructionequipmentinfrastructurelargelegallimitsordinaryroadsizetransporttransportationwater
SHARED TOKENS (12): "construction", "equipment", "infrastructure", "large", "legal", "limits", "ordinary", "road", "size", "transport", "transportation", "water".
0.220
Deer ↗ Q23390 KW CROSS HIGH
activitydividedeconomichistorylandremainsresourceroleseparatethroughoutwater
SHARED TOKENS (11): "activity", "divided", "economic", "history", "land", "remains", "resource", "role", "separate", "throughout", "water".
0.220
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitanmiddletonnampapopulationruralwestern
SHARED TOKENS (11): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "middleton", "nampa", "population", "rural", "western".
0.220
Pet sitting ↗ Q13414620 KW CROSS HIGH
actarrangementbusinesscarehomeorganizationplaceproviderspecializedtemporarytraining
SHARED TOKENS (11): "act", "arrangement", "business", "care", "home", "organization", "place", "provider", "specialized", "temporary", "training".
0.220
differentfacilitiesfunctioninggoalhospitalsimproveincorporatedplanpopulationspecifictreatment
SHARED TOKENS (11): "different", "facilities", "functioning", "goal", "hospitals", "improve", "incorporated", "plan", "population", "specific", "treatment".
0.220
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentryimprovelanepermittedresearchroadsafetyshowstraffic
SHARED TOKENS (11): "businesses", "economic", "entry", "improve", "lane", "permitted", "research", "road", "safety", "shows", "traffic".
0.200
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
easternidahointersectioninterstatelimitedpriorroutesystemwestwestern
SHARED TOKENS (10): "eastern", "idaho", "intersection", "interstate", "limited", "prior", "route", "system", "west", "western".
0.200
americancommercialenvironmentextendedinternationallandphysicalprocessproductstransport
SHARED TOKENS (10): "american", "commercial", "environment", "extended", "international", "land", "physical", "process", "products", "transport".
0.200
Psittacosis ↗ Q164727 EXACT TITLE
EXACT TITLE in veterinary_animal_services: "Psittacosis".
0.200
constructiondesignmaterialsoperationplanningprofessionalstandardsstructuraltraffictransportation
SHARED TOKENS (10): "construction", "design", "materials", "operation", "planning", "professional", "standards", "structural", "traffic", "transportation".
0.180
agencycontrolentitygovernmenthealthhistoricallyindividualpublicsafety
SHARED TOKENS (9): "agency", "control", "entity", "government", "health", "historically", "individual", "public", "safety".
0.180
Animal science ↗ Q168091 KW CROSS HIGH
broadercontroldescribedfarmfarmshistoricallymanagementproductionstudents
SHARED TOKENS (9): "broader", "control", "described", "farm", "farms", "historically", "management", "production", "students".
0.180
americanbrandbrandingcomplexidentificationlargesystemthoughwest
SHARED TOKENS (9): "american", "brand", "branding", "complex", "identification", "large", "system", "though", "west".
0.180
applicationclinicaldiagnosisdiscoverydividedmedicalresearchrolesafety
SHARED TOKENS (9): "application", "clinical", "diagnosis", "discovery", "divided", "medical", "research", "role", "safety".
0.180
abilityamericancannotcarehouseproviderathersocietythem
SHARED TOKENS (9): "ability", "american", "cannot", "care", "house", "provide", "rather", "society", "them".
0.180
commercialhazardouslargelicensematerialsoperatepartssizetrailers
SHARED TOKENS (9): "commercial", "hazardous", "large", "license", "materials", "operate", "parts", "size", "trailers".
0.160
agediagnosisenvironmentexposuremajorolderstudytreatment
SHARED TOKENS (8): "age", "diagnosis", "environment", "exposure", "major", "older", "study", "treatment".
0.160
analysisclinicaldiagnosiseasternhomemedicalrequireswest
SHARED TOKENS (8): "analysis", "clinical", "diagnosis", "eastern", "home", "medical", "requires", "west".
0.160
addressesgrowthincorporatespopulationproductionthroughoutvaluework
SHARED TOKENS (8): "addresses", "growth", "incorporates", "population", "production", "throughout", "value", "work".
0.160
agencyamericancontinuingdepartmentfederalgovernmentmanagementpeople
SHARED TOKENS (8): "agency", "american", "continuing", "department", "federal", "government", "management", "people".
0.160
canyonconnectingeagleidahomeridiannamparivervalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "river", "valley".
0.140
americanapplicationassociationcollegeeducationmedicalprocess
SHARED TOKENS (7): "american", "application", "association", "college", "education", "medical", "process".
0.140
boisecanyonidahometropolitanmiddletonnampapopulation
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
citiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (7): "cities", "governing", "legal", "limited", "local", "municipal", "owned".
0.140
againstclinicalcreatepotentialreducethoughtreatment
SHARED TOKENS (7): "against", "clinical", "create", "potential", "reduce", "though", "treatment".
0.140
costshandlingitselfmultipleroadtransporttransportation
SHARED TOKENS (7): "costs", "handling", "itself", "multiple", "road", "transport", "transportation".
0.140
actconditionsdesigneddistinctproceduresresourcessupporting
SHARED TOKENS (7): "act", "conditions", "designed", "distinct", "procedures", "resources", "supporting".
0.120
gardenidahointerstateroutetreasurevalley
SHARED TOKENS (6): "garden", "idaho", "interstate", "route", "treasure", "valley".
0.120
Neutering ↗ Q3482590 KW CROSS HIGH
adoptedlargeownersrequirerescuesystem
SHARED TOKENS (6): "adopted", "large", "owners", "require", "rescue", "system".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
applicationhealthimprovephysicalpublic
SHARED TOKENS (5): "application", "health", "improve", "physical", "public".
0.100
adaconnectingidahoroutestar
SHARED TOKENS (5): "ada", "connecting", "idaho", "route", "star".
0.100
agencydepartmentidahopreservingresponsible
SHARED TOKENS (5): "agency", "department", "idaho", "preserving", "responsible".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
0.100
Animal loss ↗ Q4764951 KW CROSS HIGH
becomeevenevidenceindividualotherwise
SHARED TOKENS (5): "become", "even", "evidence", "individual", "otherwise".
◈ Frequently Asked Questions
Transportation Infrastructure × Veterinary Animal Services — Treasure Valley
HAIKU · HIGH GATE
How do road conditions on Ada County's main highways affect emergency transport for animals requiring veterinary care?
Ada County's transportation network directly determines response times for mobile veterinary clinics and emergency animal transport from Nampa and Garden City to Boise's primary animal hospitals. Idaho State Police incident reports on I-84 and Highway 55 corridors document delays that impact whether emergency cases reach treatment facilities within critical windows.
What role does land-use planning in Boise play in determining where new veterinary clinics can locate relative to transportation hubs?
Boise's zoning ordinances and land-use planning decisions restrict veterinary facility placement based on proximity to major roads, parking capacity, and access requirements for the Treasure Valley's growing pet population. Ada County's comprehensive plan designates specific corridors where mixed-use developments combining animal services with transportation accessibility receive approval.
How does Treasure Valley population growth affect both transportation infrastructure needs and veterinary service availability?
The Treasure Valley's metropolitan expansion from Nampa through Boise to Garden City has increased vehicle traffic on regional routes while simultaneously creating demand for more veterinary clinics across the expanding service area. Transportation infrastructure investments must accommodate both commuter vehicles and the supply chains supporting veterinary pharmaceutical distribution and equipment delivery to clinics throughout Ada County.
Why do veterinary businesses in Boise, Idaho and Star require specific transportation access standards in their operational permits?
Boise and Star zoning codes mandate adequate road access and parking for veterinary facilities to handle emergency vehicle arrivals and pharmaceutical deliveries that cannot be delayed by traffic congestion. Idaho State Police and local planning departments coordinate on transportation capacity assessments before approving new animal service facilities in the Treasure Valley's western and eastern suburban zones.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Veterinary Animal Services 20 QID bridges 262 edges 7,451 ext links 2026-07-17 23:43:57 UTC b2729f25737ab1d2
Transportation Infrastructure corridor ↗ Veterinary Animal Services corridor ↗ Veterinary Animal Services × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals