—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Weather

20 Wikipedia bridge articles confirmed in both vertical ledgers. 240 deterministic cross-vertical edges. 6,491 external source links harvested. Every edge provenance-stamped. Every claim auditable.

20 QID Bridge Articles
240 Cross Edges
6,491 External Sources
275 Wikipedia Articles
24 🌲 Evergreen
182 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Weather
QID Bridge Articles
20
confirmed Wikipedia overlap
Total Cross Edges
240
External Sources Harvested
6,491
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  35 shared tokens
QID Bridge Titles (20)
IdahoTreasure ValleyFederal Aviation AdministrationSnake RiverFloodplainBoise State UniversityBoise AirportCivil engineeringNampa, IdahoUnited States Environmental Protection AgencyBoise, IdahoUnited States Army Corps of EngineersStorm drainAda County, IdahoStar, IdahoGarden City, IdahoCaldwell, IdahoMeridian, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanmileswestadanationalpublicnorthwestoregonriverwesterngovernmentcanyoncapitalvalleycontroldepartmentmilitary
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:44:18 UTC
Content Hash
9a82e5b28c03c787
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
20 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (35): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "eastern", "economy", "idaho", "incorporates", "land", "linked", "methods", "miles", "million", "mountain", "national", "northwest".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in weather: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistincteasterneconomyidahoincorporateslandlinkedmethodsmilesmillionmountainnationalnorthwestofficialoregonpacificpeoplepopulationproductsriversectorseparatesignificant+5
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (21): "agricultural", "association", "boise", "commerce", "eastern", "historically", "idaho", "land", "local", "lower", "metropolitan", "opportunities", "oregon", "primarily", "region", "resources", "river", "treasure", "urbanized", "valley".... | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in weather: "Treasure Valley".
agriculturalassociationboisecommerceeasternhistoricallyidaholandlocallowermetropolitanopportunitiesoregonprimarilyregionresourcesrivertreasureurbanizedvalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Federal Aviation Administration
Q335357 EXACT TITLE 1.000
QID OVERLAP: Q335357 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (22): "administration", "agency", "air", "airports", "authority", "aviation", "certification", "civil", "control", "created", "department", "faa", "federal", "government", "organization", "personnel", "powers", "regulates", "standards", "surrounding".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration". | EXACT TITLE in weather: "Federal Aviation Administration".
administrationagencyairairportsauthorityaviationcertificationcivilcontrolcreateddepartmentfaafederalgovernmentorganizationpersonnelpowersregulatesstandardssurroundingtraffictransportation
The Federal Aviation Administration (FAA) is a U.S. federal government agency within the U.S. Department of Transportation that regulates civil aviation in the United States and surrounding international waters. Its powers include air traffic control, certification of personnel and aircraft, setting standards for airports, and protection of U.S. assets during the launch or re-entry of commercial space vehicles. Powers over neighboring international waters were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S.
s were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in transportation_infrastructure (tier:branch) and weather (tier:evergreen). | SHARED TOKENS (45): "agencies", "american", "canyon", "central", "construction", "control", "created", "downstream", "drains", "eastern", "falls", "flood", "flows", "habitat", "high", "history", "idaho", "irrigation", "large", "limited".... | EXACT TITLE in weather: "Snake River".
agenciesamericancanyoncentralconstructioncontrolcreateddownstreamdrainseasternfallsfloodflowshabitathighhistoryidahoirrigationlargelimitedlonglongestlowermajormilesmilitarynationalnearnorthwestoregon+15
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Floodplain
Q193110 EXACT TITLE 1.000
QID OVERLAP: Q193110 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (15): "adjacent", "agricultural", "control", "discharge", "flood", "floodplain", "floodplains", "frequently", "high", "land", "near", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain". | EXACT TITLE in weather: "Floodplain".
adjacentagriculturalcontroldischargefloodfloodplainfloodplainsfrequentlyhighlandnearriverurbanvalleywater
A floodplain or flood plain or bottomlands is an area of land adjacent to a river. Floodplains stretch from the banks of a river channel to the base of the enclosing valley, and experience flooding during periods of high discharge. The soils usually consist of clays, silts, sands, and gravels deposited during floods. Because of regular flooding, floodplains frequently have high soil fertility since nutrients are deposited with the flood waters. This can encourage farming; some important agricultural regions, such as the Nile and Mississippi river basins, heavily exploit floodplains. Agricultural and urban regions have developed near or on floodplains to take advantage of the rich soil and freshwater.
Excluding famines and epidemics, some of the worst natural disasters in history (measured by fatalities) have been river floods, particularly in the Yellow River in China – see list of deadliest floods. The worst of these, and the worst natural disaster (excluding famine and epidemics), was the 1931 China floods, estimated to have killed millions. This had been preceded by the 1887 Yellow River flood, which killed around one million people and is the second-worst natural disaster in history. The extent of floodplain inundation depends partly on flood magnitude, defined by the return period. In the United States, the Federal Emergency Management Agency (FEMA) manages the National Flood Insurance Program (NFIP). The NFIP offers insurance to properties located within a flood-prone area, as defined by the Flood Insurance Rate Map (FIRM), which depicts various flood risks for a community. The FIRM typically focuses on the delineation of the 100-year flood inundation area, also known within the NFIP as the Special Flood Hazard Area. Where a detailed study of a waterway has been done, the 100-year floodplain will also include the floodway, the critical portion of the floodplain which includes the stream channel and any adjacent areas that must be kept free of encroachments that might block flood flows or restrict storage of flood waters. Another commonly encountered term is the Special Flood Hazard Area, which is any area subject to inundation by a 100-year flood. A problem is that any alteration of the watershed upstream of the point in question can potentially affect the ability of the watershed to handle water, and thus potentially affects the levels of the periodic floods. A large shopping center and parking lot, for example, may raise the levels of 5-year, 100-year, and other floods, but the maps are rarely adjusted and are frequently rendered obsolete by subsequent development. In order for a flood-prone property to qualify for government-subsidized insurance, a local community must adopt an ordinance that protects the floodway and requires that new residential structures built in Special Flood Hazard Areas be elevated to at least the level of the 100-year flood. Commercial structures can be elevated or floodproofed to or above this level. In some areas without detailed study information, structures may be required to be elevated to at least two feet above the surrounding grade. Many State and local governments have, in addition, adopted floodplain construction regulations which are more restrictive than those mandated by the NFIP. The US government also sponsors flood hazard mitigation efforts to reduce flood impacts. California's Hazard Mitigation Program is one funding source for mitigation projects. A number of whole towns such as English, Indiana, have been completely relocated to remove them from the floodplain. Other smaller-scale mitigation efforts include acquiring and demolishing flood-prone buildings or flood-proofing them. In some floodplains, such as the Inner Niger Delta of Mali, annual flooding events are a natural part of the local ecology and rural economy, allowing for the raising of crops through recessional agriculture. However, in Bangladesh, which occupies the Ganges Delta, the advantages provided by the richness of the alluvial soil of the floodplain are severely offset by frequent floods brought on by cyclones and annual monsoon rains.
Environmental pollutants in floodplain soils Floodplain soils tend to be high in eco-pollutants, especially persistent organic pollutant (POP) deposition.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (18): "activity", "among", "boise", "economics", "education", "engineering", "health", "high", "idaho", "independent", "million", "mountain", "program", "programs", "public", "research", "university", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in weather: "Boise State University".
activityamongboiseeconomicseducationengineeringhealthhighidahoindependentmillionmountainprogramprogramspublicresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (32): "ada", "air", "airport", "airports", "aviation", "boi", "boise", "center", "combined", "department", "faa", "falls", "field", "functions", "general", "gowen", "idaho", "increase", "interagency", "kboi".... | EXACT TITLE in transportation_infrastructure: "Boise Airport". | EXACT TITLE in weather: "Boise Airport".
adaairairportairportsaviationboiboisecentercombineddepartmentfaafallsfieldfunctionsgeneralgowenidahoincreaseinteragencykboimilesmilitarymillionnationaloperatedoperatesrequiringrightssupportterminal+2
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Civil engineering
Q77590 EXACT TITLE 1.000
QID OVERLAP: Q77590 in transportation_infrastructure (tier:evergreen) and weather (tier:branch). | SHARED TOKENS (28): "agencies", "airports", "buildings", "built", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "firms", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
agenciesairportsbuildingsbuiltcivilcomponentsconstructiondepartmentsdesigndistinguishengineeringfirmsgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalprivateprofessionalpublicroadssectorstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
essional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Transportation engineering is concerned with moving people and goods efficiently, safely, and in a manner conducive to a vibrant community. This involves specifying, designing, constructing, and maintaining transportation infrastructure which includes streets, canals, highways, rail systems, airports, ports, and mass transit.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (16): "boise", "canyon", "home", "idaho", "meaning", "meridian", "metropolitan", "miles", "northwest", "population", "principal", "second", "student", "university", "west", "western".
boisecanyonhomeidahomeaningmeridianmetropolitanmilesnorthwestpopulationprincipalsecondstudentuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (35): "agency", "began", "december", "department", "education", "energy", "enforcement", "engineers", "environmental", "epa", "equivalent", "executive", "federal", "financial", "government", "house", "independent", "information", "january", "legal"....
agencybegandecemberdepartmenteducationenergyenforcementengineersenvironmentalepaequivalentexecutivefederalfinancialgovernmenthouseindependentinformationjanuarylegallevellocalmattersmonitoringnationaloperationpowersprogramspublicregional+5
The Environmental Protection Agency (EPA) is an independent agency of the United States government tasked with environmental protection matters. President Richard Nixon proposed the establishment of EPA on July 9, 1970; it began operation on December 2, 1970, after Nixon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
r is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
or is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "counties", "employers", "feet", "home", "idaho", "level", "locally", "major", "metropolitan", "miles", "oregon", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployersfeethomeidaholevellocallymajormetropolitanmilesoregonpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
United States Army Corps of Engineers
Q1049334 QID OVERLAP 0.800
QID OVERLAP: Q1049334 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (65): "act", "agencies", "air", "approximately", "army", "authority", "budget", "building", "capacity", "civil", "combined", "components", "construction", "control", "corps", "department", "design", "direct", "directly", "economy"....
actagenciesairapproximatelyarmyauthoritybudgetbuildingcapacitycivilcombinedcomponentsconstructioncontrolcorpsdepartmentdesigndirectdirectlyeconomyenergyengineerengineeringengineersenvironmentalestablishfacilitiesfederalfloodform+35
37,000 civilian and military personnel, making it one of the world's largest public engineering, design, and construction management agencies. The USACE workforce is approximately 97% civilian and 3% active duty military. The civilian workforce is mainly located in the United States, Europe, and in select Middle East office locations. Civilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
proximately 97% civilian and 3% active duty military. The civilian workforce is mainly located in the United States, Europe, and in select Middle East office locations. Civilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
Storm drain
Q1139766 QID OVERLAP 0.800
QID OVERLAP: Q1139766 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (28): "buildings", "cannot", "combined", "connect", "design", "designed", "drainage", "drains", "even", "falls", "heavy", "highway", "infrastructure", "inside", "large", "manage", "municipal", "property", "public", "require"....
buildingscannotcombinedconnectdesigndesigneddrainagedrainsevenfallsheavyhighwayinfrastructureinsidelargemanagemunicipalpropertypublicrequireresidentialroadssidewalksstreetsurfacesurfacessystemswater
utters on most motorways, freeways and other busy roads, as well as towns in areas with heavy rainfall that leads to flooding, and coastal towns with regular storms. Even rain gutters from houses and buildings can connect to the storm drain. Since many storm drainage systems are gravity sewers that drain untreated storm water into rivers or streams, any hazardous substances poured into the drains will contaminate the destination bodies of water. Storm drains sometimes cannot manage the quantity of rain that falls in heavy rains or storms. Inundated drains can cause basement and street flooding. Many areas require detention tanks inside a property that temporarily hold runoff in heavy rains and restrict outlet flow to the public sewer. This reduces the risk of overwhelming the public sewer.
Cities that installed their sewage collection systems before the 1930s typically used single piping systems to transport both urban runoff and sewage. This type of collection system is referred to as a combined sewer system (CSS). The cities' rationale when combined sewers were built was that it would be cheaper to build just a single system. In these systems a sudden large rainfall that exceeds sewage treatment capacity is allowed to overflow directly from storm drains into receiving waters via structures called combined sewer overflows. Storm drains are typically installed at shallower depths than combined sewers. This is because combined sewers were designed to accept sewage flows from buildings with basements, in addition to receiving surface runoff from streets. About 860 communities in the US have combined sewer systems, serving about 40 million people. New York City, Washington, D.C., Seattle and other cities with combined systems have this problem due to a large influx of storm water after every heavy rain event. Some cities have dealt with this by adding large storage tanks or ponds to hold the water until it can be treated. Chicago has a system of tunnels, collectively called the Deep Tunnel, underneath the city for storing its stormwater. Many areas require detention tanks or roof detention systems that temporarily hold runoff in heavy rains and restrict outlet flow to the public sewer. This lessens the risk of overwhelming the public sewer in heavy rain. An overflow outlet may also connect higher on the outlet side of the detention tank. This overflow prevents the detention tank from completely filling.
Regulations and local building codes Building codes and local government ordinances vary significantly on the handling of storm drain runoff. New developments might be required to construct their storm drain processing capacity for returning the runoff to the water table and bioswales may be required in sensitive ecological areas to protect the watershed. In the United States, cities, suburban communities, and towns with over 100,000 population, smaller community drainage systems in urbanized areas, and additional municipal systems that are specifically designated by state agencies are required to obtain discharge permits for their storm sewer systems under the Clean Water Act. The Environmental Protection Agency (EPA) issued stormwater regulations for large cities in 1990 and for other communities in 1999. The permits require local governments to operate stormwater management programs, covering both construction of new buildings and facilities, and maintenance of their existing municipal drainage networks. For new construction projects, many municipalities require builders to obtain approval of the site drainage system and structural plans.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and weather (tier:branch). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "highway", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private", "roads", "second".
adaboisecapitaldistricthighwayhomeidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivateroadssecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.780
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (14): "ada", "boise", "canyon", "district", "growing", "house", "idaho", "metropolitan", "population", "rapidly", "schools", "shared", "star", "west".
adaboisecanyondistrictgrowinghouseidahometropolitanpopulationrapidlyschoolssharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Garden City, Idaho
QID OVERLAP 0.720
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and weather (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "second", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalpopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "idaho", "locally", "metropolitan", "miles", "oregon", "population", "west".
approximatelyboisecaldwellcanyonidaholocallymetropolitanmilesoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "population".
boisecaldwellcanyonidahomakingmetropolitanpopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.640
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and weather (tier:branch). | SHARED TOKENS (7): "ada", "boise", "eagle", "idaho", "miles", "northwest", "population".
adaboiseeagleidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
220 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP220 edges
🌲 EVERGREEN4 edges
0.650
agencydepartmentfederalfundingfuturegrantidahoinfrastructureitdmaintenanceoperationsorganizationplanningprogramsresponsibletransportation
SHARED TOKENS (16): "agency", "department", "federal", "funding", "future", "grant", "idaho", "infrastructure", "itd", "maintenance", "operations", "organization", "planning", "programs", "responsible", "transportation". | URL->A (1): https://itd.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho Transportation Department". | EXACT TITLE in weather: "Idaho Transportation Department".
0.650
agencyboardcarrierscommerceconstructioncreatedeconomicfederalgovernmentindependentindustryjurisdictionmatterspowersregulationregulatoryrelevantsubjectsurfacetraffic
SHARED TOKENS (22): "agency", "board", "carriers", "commerce", "construction", "created", "economic", "federal", "government", "independent", "industry", "jurisdiction", "matters", "powers", "regulation", "regulatory", "relevant", "subject", "surface", "traffic".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
administrationairportairportsamericanaviationcostsfederalfuelfundingfundsgeneralgrantimproveimprovementlandpercentplanningprogramprojectspublic
SHARED TOKENS (24): "administration", "airport", "airports", "american", "aviation", "costs", "federal", "fuel", "funding", "funds", "general", "grant", "improve", "improvement", "land", "percent", "planning", "program", "projects", "public".... | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
achdadaadditionalagenciesairamongauthoritiesauthoritybegunboisecanyoncapacitycapitalcentercitiesconventionalcostcostsdemanddistrict
SHARED TOKENS (77): "achd", "ada", "additional", "agencies", "air", "among", "authorities", "authority", "begun", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "cost", "costs", "demand", "district".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH182 edges
0.590
agencybegancreateddepartmentenforcementidaholawmunicipalorganizationpresentpublicstatewide
SHARED TOKENS (12): "agency", "began", "created", "department", "enforcement", "idaho", "law", "municipal", "organization", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.530
achdadaagencydistrictgardengovernmenthighwayidahoindependent
SHARED TOKENS (9): "achd", "ada", "agency", "district", "garden", "government", "highway", "idaho", "independent". | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Ada County Highway District". | EXACT TITLE in weather: "Ada County Highway District".
0.500
amongapproximatelyboiseextensionfallshighidaholateroperatesprimarilyproductionprofessionalpublicresearchschoolsstatewidestudentsuniversity
SHARED TOKENS (18): "among", "approximately", "boise", "extension", "falls", "high", "idaho", "later", "operates", "primarily", "production", "professional", "public", "research", "schools", "statewide", "students", "university". | EXACT TITLE in weather: "University of Idaho".
0.500
Road ↗ Q34442 EXACT TITLE
accessdesignlandlocalmovementpavementprimarilyprimaryprivatepublicroadroadssidewalksstreettrafficurban
SHARED TOKENS (16): "access", "design", "land", "local", "movement", "pavement", "primarily", "primary", "private", "public", "road", "roads", "sidewalks", "street", "traffic", "urban". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in weather: "Road".
0.500
Downburst ↗ Q4847219 EXACT TITLE
airairportairportsamongassociatedaviationboundariescapablecentralconditionscreatecreatedcrewsdecisionseveneventeventsfieldflightformation
SHARED TOKENS (42): "air", "airport", "airports", "among", "associated", "aviation", "boundaries", "capable", "central", "conditions", "create", "created", "crews", "decisions", "even", "event", "events", "field", "flight", "formation".... | EXACT TITLE in weather: "Downburst".
0.500
associatedbuildingbuildingsbuiltconstructiondesigndevelopmenteconomicequivalentexpandfacilitiesimproveindustrialindustryinfrastructuremaintenancepercentplanningprocessproducts
SHARED TOKENS (21): "associated", "building", "buildings", "built", "construction", "design", "development", "economic", "equivalent", "expand", "facilities", "improve", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "products".... | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in weather: "Construction".
0.500
Meteorology ↗ Q25261 EXACT TITLE
advancedagricultureapplicationsaviationbackbroaderclimateconstructiondataenergyeventsfieldforecastinteractionsinterdisciplinarylargelaterlocalmanagementmeasurement
SHARED TOKENS (41): "advanced", "agriculture", "applications", "aviation", "back", "broader", "climate", "construction", "data", "energy", "events", "field", "forecast", "interactions", "interdisciplinary", "large", "later", "local", "management", "measurement".... | EXACT TITLE in weather: "Meteorology".
0.500
Culvert ↗ Q4168092 EXACT TITLE
concretedesigneddrainageembeddedfrequentlyhighwayhydraulicitselfnaturalpracticeprocessrequirementsroadroadsselectionshapesstructuresurfacetrafficvehicle
SHARED TOKENS (21): "concrete", "designed", "drainage", "embedded", "frequently", "highway", "hydraulic", "itself", "natural", "practice", "process", "requirements", "road", "roads", "selection", "shapes", "structure", "surface", "traffic", "vehicle".... | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
administrationagencyarchivecenterscommercecommunitycurrentdatadepartmentenvironmentalgeneralgovernmentinformationnationalofficeoperatedoperatesorganizationsproductspublic
SHARED TOKENS (21): "administration", "agency", "archive", "centers", "commerce", "community", "current", "data", "department", "environmental", "general", "government", "information", "national", "office", "operated", "operates", "organizations", "products", "public".... | EXACT TITLE in weather: "National Centers for Environmental Information".
0.500
Frost ↗ Q4590598 EXACT TITLE
affectairappearsconditionscontactcontainsdependsdevelopmentdirectlyevenfallsformformationgrowinggrowthlargelargerlayerlevellong
SHARED TOKENS (33): "affect", "air", "appears", "conditions", "contact", "contains", "depends", "development", "directly", "even", "falls", "form", "formation", "growing", "growth", "large", "larger", "layer", "level", "long".... | EXACT TITLE in weather: "Frost".
0.500
academicanalysisanalyzeapplicationsbegunbroaderdatadatabasedateengineeringessentialgeographyindexindustryinformationinstitutionalinsuranceintegratedlogisticsmanage
SHARED TOKENS (37): "academic", "analysis", "analyze", "applications", "begun", "broader", "data", "database", "date", "engineering", "essential", "geography", "index", "industry", "information", "institutional", "insurance", "integrated", "logistics", "manage".... | EXACT TITLE in weather: "Geographic information system".
0.500
associationcorridorscreatedenvironmentalfrequentlygreenwaysindustriallandlandscapemobilitypeoplerightssurfaceurbanusersutility
SHARED TOKENS (16): "association", "corridors", "created", "environmental", "frequently", "greenways", "industrial", "land", "landscape", "mobility", "people", "rights", "surface", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)". | EXACT TITLE in weather: "Greenway (landscape)".
0.500
airairportairportsaviationcanyoncivilconstructionemergencyfaaflightgeneralhomeidahoindustrialintegratedmilitarymissionmountainmunicipalnational
SHARED TOKENS (26): "air", "airport", "airports", "aviation", "canyon", "civil", "construction", "emergency", "faa", "flight", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "mountain", "municipal", "national".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
Wildfire ↗ EXACT TITLE
budgetclimatecontrolledcreatecreatesdirecteconomiceventfuelsfundinggrowthhealthimpactimpactslandland-uselevelmanagementmitigationnatural
SHARED TOKENS (31): "budget", "climate", "controlled", "create", "creates", "direct", "economic", "event", "fuels", "funding", "growth", "health", "impact", "impacts", "land", "land-use", "level", "management", "mitigation", "natural".... | EXACT TITLE in weather: "Wildfire".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomecapacitycentralcitiesclimatecontainsdischargedistributionenvironmentalfieldformformationindustrialinfluencelandlevelmajormovement
SHARED TOKENS (42): "agricultural", "agriculture", "become", "capacity", "central", "cities", "climate", "contains", "discharge", "distribution", "environmental", "field", "form", "formation", "industrial", "influence", "land", "level", "major", "movement".... | EXACT TITLE in weather: "Groundwater".
0.500
affectedcommunitydifferentemergencyeventsfederalhazardsimpactsindividualslocalmanagementmitigationnaturalorganizationsprofessionalprovidingreducerequiresresponsesearch
SHARED TOKENS (21): "affected", "community", "different", "emergency", "events", "federal", "hazards", "impacts", "individuals", "local", "management", "mitigation", "natural", "organizations", "professional", "providing", "reduce", "requires", "response", "search".... | EXACT TITLE in weather: "Emergency management".
0.500
airbuildingcentercenterscoordinatededicateddeliverydemanddirectlydistributionfirmsfunctioninventorylaborlargelogisticsmarketneedednetworkoperate
SHARED TOKENS (32): "air", "building", "center", "centers", "coordinate", "dedicated", "delivery", "demand", "directly", "distribution", "firms", "function", "inventory", "labor", "large", "logistics", "market", "needed", "network", "operate".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
americanappliedaviationconditionsconsultingdatademandeventsinsurancelocalprocessprogramreportssnowsocietystudysurfaceweather
SHARED TOKENS (18): "american", "applied", "aviation", "conditions", "consulting", "data", "demand", "events", "insurance", "local", "process", "program", "reports", "snow", "society", "study", "surface", "weather". | EXACT TITLE in weather: "Forensic meteorology".
0.500
Rain ↗ Q7925 EXACT TITLE
airannualchangescitiesclassificationclimateconditionscontrastsdescribedeasternfallsforcesformheavyirrigationlandmajormovementpowerpresent
SHARED TOKENS (29): "air", "annual", "changes", "cities", "classification", "climate", "conditions", "contrasts", "described", "eastern", "falls", "forces", "form", "heavy", "irrigation", "land", "major", "movement", "power", "present".... | EXACT TITLE in transportation_infrastructure: "Rain". | EXACT TITLE in weather: "Rain".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingbuildingsdensitydeterminedevelopmentdifferentformgoverngovernmentgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulationsregulatory
SHARED TOKENS (28): "building", "buildings", "density", "determine", "development", "different", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations", "regulatory".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in weather: "Zoning".
0.500
accessactauthoritiescomprehensivecontinuingcooperativecreatedfederalformationfundingfundsfuturegovernedgovernmenthighwaylawlocalmetropolitanorganizationparticipation
SHARED TOKENS (31): "access", "act", "authorities", "comprehensive", "continuing", "cooperative", "created", "federal", "formation", "funding", "funds", "future", "governed", "government", "highway", "law", "local", "metropolitan", "organization", "participation".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalfrequencyhighintegratedlevelnetworkproviderequirementssignalsspeedtechnologyuses
SHARED TOKENS (16): "access", "context", "data", "different", "digital", "frequency", "high", "integrated", "level", "network", "provide", "requirements", "signals", "speed", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
actagencyappliedbecomebuiltdeliverydepartmentdevelopmentfederalfundinggenerationgovernmentirrigationjunelawmanagementmillionoperationpeoplepotential
SHARED TOKENS (34): "act", "agency", "applied", "become", "built", "delivery", "department", "development", "federal", "funding", "generation", "government", "irrigation", "june", "law", "management", "million", "operation", "people", "potential".... | EXACT TITLE in weather: "Bureau of Reclamation".
0.500
broadercitiescomprehensivedevelopmenteconomicenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargerlevelmanagemanagementmilitarynationalnetworkplacement
SHARED TOKENS (36): "broader", "cities", "comprehensive", "development", "economic", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "level", "manage", "management", "military", "national", "network", "placement".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciesairportsclimatecommunitycomponentsconditionscreateddevelopmentdifferentdistincteconomiceconomyemergencyenforcementenvironmentalessentialfacilitiesfirmsfrequently
SHARED TOKENS (47): "access", "agencies", "airports", "climate", "community", "components", "conditions", "created", "development", "different", "distinct", "economic", "economy", "emergency", "enforcement", "environmental", "essential", "facilities", "firms", "frequently".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in weather: "Infrastructure".
0.500
Snow ↗ Q7561 EXACT TITLE
affectsagricultureairamongchangesclimateconditionsformincreaseindividuallayermajorprimarilyprovidingshapessnowsurfacestransportationtravelwater
SHARED TOKENS (22): "affects", "agriculture", "air", "among", "changes", "climate", "conditions", "form", "increase", "individual", "layer", "major", "primarily", "providing", "shapes", "snow", "surfaces", "transportation", "travel", "water".... | EXACT TITLE in transportation_infrastructure: "Snow". | EXACT TITLE in weather: "Snow".
0.500
Climatology ↗ Q52139 EXACT TITLE
analysischangesclimateconditionconditionsdeterminefuturegeographymethodsmodelspacificphysicalresearchstudysubdivisionsystemtermsweather
SHARED TOKENS (18): "analysis", "changes", "climate", "condition", "conditions", "determine", "future", "geography", "methods", "models", "pacific", "physical", "research", "study", "subdivision", "system", "terms", "weather". | EXACT TITLE in weather: "Climatology".
0.500
agriculturalclimateconcentratedconsumptiondevelopmentdirectenvironmentalestimatesgrowinggrowthhighimpactimproveincreaseindividualindividualslimitedmedicalmillionnatural
SHARED TOKENS (34): "agricultural", "climate", "concentrated", "consumption", "development", "direct", "environmental", "estimates", "growing", "growth", "high", "impact", "improve", "increase", "individual", "individuals", "limited", "medical", "million", "natural".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in weather: "Population growth".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
backbecomecitiescreatedemanddirectlyeventsfallsheavylandlargemajornaturalpopulationpotentialreduceresourcesnowsurfaceterms
SHARED TOKENS (24): "back", "become", "cities", "create", "demand", "directly", "events", "falls", "heavy", "land", "large", "major", "natural", "population", "potential", "reduce", "resource", "snow", "surface", "terms".... | EXACT TITLE in weather: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
activityaffectedagricultureairannualavailabilitybackbecomeclimateconditionscostsdatedirectlyeconomiceconomyelectricenvironmentalforcesfuelfuture
SHARED TOKENS (48): "activity", "affected", "agriculture", "air", "annual", "availability", "back", "become", "climate", "conditions", "costs", "date", "directly", "economic", "economy", "electric", "environmental", "forces", "fuel", "future".... | EXACT TITLE in weather: "Drought".
0.500
Tornado ↗ Q8081 EXACT TITLE
adjacentaircentralconnectingcurrentdataeasternextendsfeetformhighhourlargemilesrapidlysurfacetravelwaterwestern
SHARED TOKENS (19): "adjacent", "air", "central", "connecting", "current", "data", "eastern", "extends", "feet", "form", "high", "hour", "large", "miles", "rapidly", "surface", "travel", "water", "western". | EXACT TITLE in weather: "Tornado".
0.500
Skywarn ↗ Q1278035 EXACT TITLE
beganconditionsdataemergencyeventsimprovelocalmanagersmethodsmissionnationalnetworkorganizationspersonnelprogrampublicreportssafetysystemswarning
SHARED TOKENS (22): "began", "conditions", "data", "emergency", "events", "improve", "local", "managers", "methods", "mission", "national", "network", "organizations", "personnel", "program", "public", "reports", "safety", "systems", "warning".... | EXACT TITLE in weather: "Skywarn".
0.500
Flood ↗ Q8068 EXACT TITLE
accessagriculturalagricultureappliedboundariesbuildingscapacitychangescitiescivilclimatecommerceconditionscontrolsengineeringenvironmentaleventsfloodfloodplainsfrequency
SHARED TOKENS (52): "access", "agricultural", "agriculture", "applied", "boundaries", "buildings", "capacity", "changes", "cities", "civil", "climate", "commerce", "conditions", "controls", "engineering", "environmental", "events", "flood", "floodplains", "frequency".... | EXACT TITLE in transportation_infrastructure: "Flood". | EXACT TITLE in weather: "Flood".
0.500
actamericanappliedassociationauthoritybehaviorcentralchangescitiescommunitiescommunitycomprehensiveconditionscostsdependsdesigndevelopmenteconomicenvironmentalessential
SHARED TOKENS (52): "act", "american", "applied", "association", "authority", "behavior", "central", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "depends", "design", "development", "economic", "environmental", "essential".... | EXACT TITLE in weather: "Land-use planning".
0.500
KTVB ↗ Q6339250 EXACT TITLE
advertisingairboisefallshistoryidaholargerlicensedlocalmaintainsmarketmedianearnetworknewsofficeoperatingoperationoperationsowned
SHARED TOKENS (30): "advertising", "air", "boise", "falls", "history", "idaho", "larger", "licensed", "local", "maintains", "market", "media", "near", "network", "news", "office", "operating", "operation", "operations", "owned".... | EXACT TITLE in weather: "KTVB".
0.500
boundariescertificationfieldlaborlevelpeoplepermanentplacementpotentialpracticepractitionersprofessionalreachregulatedstudysystemtraining
SHARED TOKENS (17): "boundaries", "certification", "field", "labor", "level", "people", "permanent", "placement", "potential", "practice", "practitioners", "professional", "reach", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
communitydescribesdevelopmenteconomiceconomicsfrequentlygrowthhistoricallyimproveincreasesindividualinfrastructurelocalmarketobjectivespeoplepoliciespolicyprocessquality
SHARED TOKENS (23): "community", "describes", "development", "economic", "economics", "frequently", "growth", "historically", "improve", "increases", "individual", "infrastructure", "local", "market", "objectives", "people", "policies", "policy", "process", "quality".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
amongapplicationsappliedcontactcurrenteconomicgeographyinformationlandmakingmilitaryon-sitephysicalplanningsensorssignalsignalssurfacesurveying
SHARED TOKENS (19): "among", "applications", "applied", "contact", "current", "economic", "geography", "information", "land", "making", "military", "on-site", "physical", "planning", "sensors", "signal", "signals", "surface", "surveying". | EXACT TITLE in weather: "Remote sensing".
0.500
Rain shadow ↗ Q747173 EXACT TITLE
airclimateconditioncreatesexpandedforecastsformincreaseslargemakingmountainpressureproducingreducedregionwaterweather
SHARED TOKENS (17): "air", "climate", "condition", "creates", "expanded", "forecasts", "form", "increases", "large", "making", "mountain", "pressure", "producing", "reduced", "region", "water", "weather". | EXACT TITLE in weather: "Rain shadow".
0.500
articlechainconsumercustomersdirectdirectlydistributionfacilitiesindependentlinkedlogisticsmanagementnetworkproductsstructuresupplysystemsystemsvalue
SHARED TOKENS (19): "article", "chain", "consumer", "customers", "direct", "directly", "distribution", "facilities", "independent", "linked", "logistics", "management", "network", "products", "structure", "supply", "system", "systems", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
additionalairairlinesbrandcarriersextendsformformationhistoryindependentlatermajornetworkoperatesoperatingprincipalregionalstar
SHARED TOKENS (18): "additional", "air", "airlines", "brand", "carriers", "extends", "form", "formation", "history", "independent", "later", "major", "network", "operates", "operating", "principal", "regional", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Hydrology ↗ Q42250 EXACT TITLE
analyzecivildatadistributiondrainageengineeringenvironmentalgeographymanagementmethodsmovementnaturalphysicalplanningpolicyqualityresearchresourcesstudysurface
SHARED TOKENS (21): "analyze", "civil", "data", "distribution", "drainage", "engineering", "environmental", "geography", "management", "methods", "movement", "natural", "physical", "planning", "policy", "quality", "research", "resources", "study", "surface".... | EXACT TITLE in weather: "Hydrology".
0.500
administrationagencyairairportairportsapproximatelyauthoritybudgetcombinedconnectingcreateddatadepartmentenforcementfacilitiesfederalflightgovernmentimprovelaw
SHARED TOKENS (37): "administration", "agency", "air", "airport", "airports", "approximately", "authority", "budget", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "flight", "government", "improve", "law".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
armychaincivilcollectionconsumptioncostscustomersdedicatedfieldinformationlogisticsmanagementmilitarymodelmovementoperationalphysicalplanningproductionproducts
SHARED TOKENS (29): "army", "chain", "civil", "collection", "consumption", "costs", "customers", "dedicated", "field", "information", "logistics", "management", "military", "model", "movement", "operational", "physical", "planning", "production", "products".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in weather: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentimprovelocalofficeoperateoperatorspeopleprimarilyprogramsprovidersproviding
SHARED TOKENS (30): "administration", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "improve", "local", "office", "operate", "operators", "people", "primarily", "programs", "providers", "providing".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
agricultureapplicationapproximatelybecomechangesconditionscurrentdatademanddetermineeconomyeventsforecastforecastsheavyincreaseslandmarketsmodelmodels
SHARED TOKENS (37): "agriculture", "application", "approximately", "become", "changes", "conditions", "current", "data", "demand", "determine", "economy", "events", "forecast", "forecasts", "heavy", "increases", "land", "markets", "model", "models".... | EXACT TITLE in weather: "Weather forecasting".
0.500
airportsbroaderbuildingscapitalcommunityconstructiondirectlyeconomicemploymentenvironmentalfacilitiesgovernmenthabitathealthinfrastructurelong-termmunicipaloperatorphysicalprivate
SHARED TOKENS (33): "airports", "broader", "buildings", "capital", "community", "construction", "directly", "economic", "employment", "environmental", "facilities", "government", "habitat", "health", "infrastructure", "long-term", "municipal", "operator", "physical", "private".... | EXACT TITLE in transportation_infrastructure: "Public works". | EXACT TITLE in weather: "Public works".
0.500
addingadditionalairannualapproximatelybecomebecomeschangesclassificationclimatecontactcontentfallsformheavylandlargelayerlocallymajor
SHARED TOKENS (33): "adding", "additional", "air", "annual", "approximately", "become", "becomes", "changes", "classification", "climate", "contact", "content", "falls", "form", "heavy", "land", "large", "layer", "locally", "major".... | EXACT TITLE in weather: "Precipitation".
0.500
accessairairlinesassociationauthoritiescoordinationcorridorscostsdevelopmenteconomicfinancialfrequentlyfundinggeneralgovernmenthistoricalindustryinfrastructureintegratedintended
SHARED TOKENS (49): "access", "air", "airlines", "association", "authorities", "coordination", "corridors", "costs", "development", "economic", "financial", "frequently", "funding", "general", "government", "historical", "industry", "infrastructure", "integrated", "intended".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
airassociatedchangesconditionconditionsdescribeddevelopmentdifferentdirectlyenergyformformationindexitselflocalmakingpotentialsurroundingsystemsvertical
SHARED TOKENS (21): "air", "associated", "changes", "condition", "conditions", "described", "development", "different", "directly", "energy", "form", "formation", "index", "itself", "local", "making", "potential", "surrounding", "systems", "vertical".... | EXACT TITLE in weather: "Atmospheric instability".
0.500
appliedconstructioncontextcontroldescribeddesignedengineerfrequentlyfunctionsheavyhydraulicindustrialinformationinvolvinglaborlargemobileoperationspeoplepower
SHARED TOKENS (25): "applied", "construction", "context", "control", "described", "designed", "engineer", "frequently", "functions", "heavy", "hydraulic", "industrial", "information", "involving", "labor", "large", "mobile", "operations", "people", "power".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcitieshistoricallymobilitynetworkpavementpeopleprofessionalrecordroadssafetysidewalksspeedtraffictransporturban
SHARED TOKENS (17): "american", "associated", "cities", "historically", "mobility", "network", "pavement", "people", "professional", "record", "roads", "safety", "sidewalks", "speed", "traffic", "transport", "urban". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.500
Hail ↗ Q37602 EXACT TITLE
airamericancodedistinctformformationgrowthhighlevelmeasuremethodsnearreachreportingrequiressnowstructuressurfacethoughwarnings
SHARED TOKENS (22): "air", "american", "code", "distinct", "form", "formation", "growth", "high", "level", "measure", "methods", "near", "reach", "reporting", "requires", "snow", "structures", "surface", "though", "warnings".... | EXACT TITLE in weather: "Hail".
0.500
actagenciesagencyagriculturalagricultureassistancebroaderclassificationcooperativedepartmentfarmimproveimprovementinvestmentlocalmanagersmissionnaturalprimaryprivate
SHARED TOKENS (27): "act", "agencies", "agency", "agricultural", "agriculture", "assistance", "broader", "classification", "cooperative", "department", "farm", "improve", "improvement", "investment", "local", "managers", "mission", "natural", "primary", "private".... | EXACT TITLE in weather: "Natural Resources Conservation Service".
0.500
airportsdepartmentfacilitiesfederalfundshighwayindividuallocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningroadssafetyservingstations
SHARED TOKENS (23): "airports", "department", "facilities", "federal", "funds", "highway", "individual", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "roads", "safety", "serving", "stations".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
americanauthoritybeganboundariescitiescivilconcentratedconsolidatedcountiesdifferentdistrictequivalentformgovernmentindependentlawlegallylevellocallocally
SHARED TOKENS (30): "american", "authority", "began", "boundaries", "cities", "civil", "concentrated", "consolidated", "counties", "different", "district", "equivalent", "form", "government", "independent", "law", "legally", "level", "local", "locally".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in weather: "County (United States)".
0.500
agriculturalairamongapplicationappliedbackdesigneddevelopmentdynamicelectricenvironmentaleventformationhealthhistoryimpactimpactsincreaseinvolvinglegal
SHARED TOKENS (39): "agricultural", "air", "among", "application", "applied", "back", "designed", "development", "dynamic", "electric", "environmental", "event", "formation", "health", "history", "impact", "impacts", "increase", "involving", "legal".... | EXACT TITLE in weather: "Cloud seeding".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationscomponentsconstructiondevelopmentdigitalengineeringestablishgovernmenthistorylandlawlegalownershipplanningprofessionalpropertyresearch
SHARED TOKENS (28): "analysis", "boundaries", "civil", "communications", "components", "construction", "development", "digital", "engineering", "establish", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "research".... | EXACT TITLE in transportation_infrastructure: "Surveying". | EXACT TITLE in weather: "Surveying".
0.500
actadministrationagenciesagencyassistancecivilcorridorcreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublic
SHARED TOKENS (26): "act", "administration", "agencies", "agency", "assistance", "civil", "corridor", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingagencyarmyassistancechangescontrolcoordinationcorpsdirectlyengineersenvironmentalepafederalformfundinggoverningimprovementinvolvinglaw
SHARED TOKENS (36): "act", "addressing", "agency", "army", "assistance", "changes", "control", "coordination", "corps", "directly", "engineers", "environmental", "epa", "federal", "form", "funding", "governing", "improvement", "involving", "law".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
bridgebuiltcommunityconcreteconnectingconnectionconstructioncreatedesigndesignedengineeringengineersfrequentlyheavyimpactsindustrialintendedlimitloadslocal
SHARED TOKENS (39): "bridge", "built", "community", "concrete", "connecting", "connection", "construction", "create", "design", "designed", "engineering", "engineers", "frequently", "heavy", "impacts", "industrial", "intended", "limit", "loads", "local".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in weather: "Bridge".
0.500
actaffectsagriculturalagricultureairclimatecontrolcosteconomyelectricelectricityenergyfuelsindustriallaborlimitlocallocallymanagementmillion
SHARED TOKENS (27): "act", "affects", "agricultural", "agriculture", "air", "climate", "control", "cost", "economy", "electric", "electricity", "energy", "fuels", "industrial", "labor", "limit", "local", "locally", "management", "million".... | EXACT TITLE in weather: "Air pollution".
0.500
actadministrationagencyassistanceavailabilitybuildingscommunitiescommunityconstructioncontrolcostcostscreateddecemberdesigneddevelopmentemergencyenforcementfederalflood
SHARED TOKENS (46): "act", "administration", "agency", "assistance", "availability", "buildings", "communities", "community", "construction", "control", "cost", "costs", "created", "december", "designed", "development", "emergency", "enforcement", "federal", "flood".... | EXACT TITLE in weather: "National Flood Insurance Program".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualclassificationclimatecommunitiesconditionscontextdifferentformationhighimpactphysicalprovideresourcesnowstudywater
SHARED TOKENS (17): "agriculture", "annual", "classification", "climate", "communities", "conditions", "context", "different", "formation", "high", "impact", "physical", "provide", "resource", "snow", "study", "water". | EXACT TITLE in weather: "Snowpack".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangescollectionconditionsconsolidationcontrolcontrolleddirectlydischargedistributeddistributiondownstreamdrainageenvironmentalfieldform
SHARED TOKENS (50): "agricultural", "agriculture", "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "controlled", "directly", "discharge", "distributed", "distribution", "downstream", "drainage", "environmental", "field", "form".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in weather: "Irrigation".
0.500
begancapableconditionsdatadepartmentsdetermineevenforecastsfutureimprovemodelsnationaloperatorspotentialresearchsnowspecializedstationsstructurestudy
SHARED TOKENS (21): "began", "capable", "conditions", "data", "departments", "determine", "even", "forecasts", "future", "improve", "models", "national", "operators", "potential", "research", "snow", "specialized", "stations", "structure", "study".... | EXACT TITLE in weather: "Weather radar".
0.500
accessbegancommunicationsdatadevelopersdevelopmentdigitalelectricformindependentindividualinformationmeansmediaphysicalpowerreducedsignalssingletechnology
SHARED TOKENS (21): "access", "began", "communications", "data", "developers", "development", "digital", "electric", "form", "independent", "individual", "information", "means", "media", "physical", "power", "reduced", "signals", "single", "technology".... | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
administrationadoptedagencycenterscollectioncommercecurrentdepartmentfederalforecastforecastsgeneralgovernmentinformationlocalmetropolitannationalorganizationsprimaryproducts
SHARED TOKENS (26): "administration", "adopted", "agency", "centers", "collection", "commerce", "current", "department", "federal", "forecast", "forecasts", "general", "government", "information", "local", "metropolitan", "national", "organizations", "primary", "products".... | EXACT TITLE in weather: "National Weather Service".
0.500
centralconditionsdatadecisionenvironmentalfieldforecastsinformationlevelmajormakingmeasuremodelsnetworkoperatorspavementprocessroadroadsstations
SHARED TOKENS (27): "central", "conditions", "data", "decision", "environmental", "field", "forecasts", "information", "level", "major", "making", "measure", "models", "network", "operators", "pavement", "process", "road", "roads", "stations".... | EXACT TITLE in weather: "Road weather information system".
0.500
airassociatedbecomebeyondcapablecreatedevelopmentfallsformformationfrequentlyheavylargelargerlayerlocallylongmeansmovemovement
SHARED TOKENS (36): "air", "associated", "become", "beyond", "capable", "create", "development", "falls", "form", "formation", "frequently", "heavy", "large", "larger", "layer", "locally", "long", "means", "move", "movement".... | EXACT TITLE in weather: "Thunderstorm".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureairportsassociatedbuildingbuildingscitiescomponentsdesigneddirectlyfunctionindustriallargeloadingproductionstandardtransport
SHARED TOKENS (16): "agriculture", "airports", "associated", "building", "buildings", "cities", "components", "designed", "directly", "function", "industrial", "large", "loading", "production", "standard", "transport". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyboardcorridordailydirectlyexecutivefederallimitedmetropolitanmilesmillionnationalnetworkoperateoperatesoperatororganizationowned
SHARED TOKENS (28): "additional", "american", "approximately", "board", "corridor", "daily", "directly", "executive", "federal", "limited", "metropolitan", "miles", "million", "national", "network", "operate", "operates", "operator", "organization", "owned".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicadaboardboisecanyoncommunitycomprehensivecountiesdevelopmenteasterneducationgovernedidaholargepopulationprimaryprogramspublicresidentssouthwest
SHARED TOKENS (27): "academic", "ada", "board", "boise", "canyon", "community", "comprehensive", "counties", "development", "eastern", "education", "governed", "idaho", "large", "population", "primary", "programs", "public", "residents", "southwest".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
climateconditionsdailydifferentdirectforecastshourinformationlandmeasurepressureprovideresearchsignificantspeedstudysurfaceweather
SHARED TOKENS (18): "climate", "conditions", "daily", "different", "direct", "forecasts", "hour", "information", "land", "measure", "pressure", "provide", "research", "significant", "speed", "study", "surface", "weather". | EXACT TITLE in weather: "Weather station".
0.500
Rangeland ↗ Q3364870 EXACT TITLE
agriculturalagricultureconcreteessentialfrequentlyfuelinitiativeirrigationlandloadsmanagenearorganizationpracticesprimarilyproduceratherreduceresulting
SHARED TOKENS (19): "agricultural", "agriculture", "concrete", "essential", "frequently", "fuel", "initiative", "irrigation", "land", "loads", "manage", "near", "organization", "practices", "primarily", "produce", "rather", "reduce", "resulting". | EXACT TITLE in weather: "Rangeland".
0.500
academicactadministrationaffectedagenciesagencyagricultureamongarchitecturearmyassessassociationboundariesbuildingcapacitycentercentersclimatecodeconditions
SHARED TOKENS (88): "academic", "act", "administration", "affected", "agencies", "agency", "agriculture", "among", "architecture", "army", "assess", "association", "boundaries", "building", "capacity", "center", "centers", "climate", "code", "conditions".... | EXACT TITLE in weather: "National Integrated Drought Information System".
0.500
Ozone ↗ Q36933 EXACT TITLE
airapplicationsconcentratedconsumerhazardhighindustriallaterlayerlevellowermakesnearpeoplephysicalpotentialpresentpressurestandardstructure
SHARED TOKENS (22): "air", "applications", "concentrated", "consumer", "hazard", "high", "industrial", "later", "layer", "level", "lower", "makes", "near", "people", "physical", "potential", "present", "pressure", "standard", "structure".... | EXACT TITLE in weather: "Ozone".
0.500
agenciescomprehensivedesignfacilitiesfuturegovernmentimpactsincorporatesinfluencemovemovementpeopleplannersplanningpoliciesprivateprocesspublicsitingsystem
SHARED TOKENS (22): "agencies", "comprehensive", "design", "facilities", "future", "government", "impacts", "incorporates", "influence", "move", "movement", "people", "planners", "planning", "policies", "private", "process", "public", "siting", "system".... | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Lightning ↗ Q33741 EXACT TITLE
airbecomeclimatedischargeenergyessentialeventincreaseinvolvingnaturalorganizationpressurerapidlyregionscalesecondsourcestudysystemsthough
SHARED TOKENS (21): "air", "become", "climate", "discharge", "energy", "essential", "event", "increase", "involving", "natural", "organization", "pressure", "rapidly", "region", "scale", "second", "source", "study", "systems", "though".... | EXACT TITLE in weather: "Lightning".
0.500
accessagenciesbeyondcitiescommunitycustomersdailydesigneddischargeeconomicextendsformgovernmentlocalmetropolitanmobilityoperateoperatedoperatesoperators
SHARED TOKENS (35): "access", "agencies", "beyond", "cities", "community", "customers", "daily", "designed", "discharge", "economic", "extends", "form", "government", "local", "metropolitan", "mobility", "operate", "operated", "operates", "operators".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
agriculturecapitalcommunitycontinuitycostcostsdifferentenergyindividualsinstitutionalirrigationlargelargerpersonnelpolicypracticepressureprimarilyproviderspublic
SHARED TOKENS (32): "agriculture", "capital", "community", "continuity", "cost", "costs", "different", "energy", "individuals", "institutional", "irrigation", "large", "larger", "personnel", "policy", "practice", "pressure", "primarily", "providers", "public".... | EXACT TITLE in weather: "Water supply".
0.480
changesclimatedistributionestablishfieldimproveinterdisciplinarylargemeasurementphysicalsnowstudysupplieswater
SHARED TOKENS (14): "changes", "climate", "distribution", "establish", "field", "improve", "interdisciplinary", "large", "measurement", "physical", "snow", "study", "supplies", "water". | EXACT TITLE in weather: "Snow science".
0.480
americanfieldhighwaymovementpermitroadroadsstandardsurfacesystemthoughtraffictransportuses
SHARED TOKENS (14): "american", "field", "highway", "movement", "permit", "road", "roads", "standard", "surface", "system", "though", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.480
agriculturalclimatecombinedirrigationlocalmanagementmeasurementmovementnaturalresourcerolesurfacesurfaceswater
SHARED TOKENS (14): "agricultural", "climate", "combined", "irrigation", "local", "management", "measurement", "movement", "natural", "resource", "role", "surface", "surfaces", "water". | EXACT TITLE in weather: "Evapotranspiration".
0.480
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericanbuildingsconcretedesignedlandmobilitypavementprimarilyprivateroadsidewalksstreetvehicle
SHARED TOKENS (14): "adjacent", "american", "buildings", "concrete", "designed", "land", "mobility", "pavement", "primarily", "private", "road", "sidewalks", "street", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk". | EXACT TITLE in weather: "Sidewalk".
0.480
administrationagencydepartmentfederalhighwaymajorofficeprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (14): "administration", "agency", "department", "federal", "highway", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.460
Utility ↗ Q466707 EXACT TITLE
amongbehaviorcontextdecisiondistincteconomicsfunctionfunctionsmeasureobjectiverelationshipsourceutility
SHARED TOKENS (13): "among", "behavior", "context", "decision", "distinct", "economics", "function", "functions", "measure", "objective", "relationship", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in weather: "Utility".
0.460
Aquifer ↗ Q208791 EXACT TITLE
beyondformationhomeindustriallandlayermajorpresentpressureregionsourcestudywater
SHARED TOKENS (13): "beyond", "formation", "home", "industrial", "land", "layer", "major", "present", "pressure", "region", "source", "study", "water". | EXACT TITLE in weather: "Aquifer".
0.460
articlecontrolsdesigndifferentmajormeetpracticeprimarilyroadroadsseparatetrafficuses
SHARED TOKENS (13): "article", "controls", "design", "different", "major", "meet", "practice", "primarily", "road", "roads", "separate", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.440
distributioneasternelectricitygenerationidahonaturaloperatesoregonpowerregulatedriverutility
SHARED TOKENS (12): "distribution", "eastern", "electricity", "generation", "idaho", "natural", "operates", "oregon", "power", "regulated", "river", "utility". | EXACT TITLE in weather: "Idaho Power".
0.420
actcoordinationdatafederalhouseimprovementlawpdfprovidingresearchweather
SHARED TOKENS (11): "act", "coordination", "data", "federal", "house", "improvement", "law", "pdf", "providing", "research", "weather". | EXACT TITLE in weather: "Weather Research and Forecasting Innovation Act of 2017".
0.420
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulationsresponsible
SHARED TOKENS (11): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations", "responsible". | EXACT TITLE in weather: "Idaho Department of Environmental Quality".
0.420
administrationagencycommerceconditionsdepartmenteconomicgovernmentmonitoringnationalregulatoryweather
SHARED TOKENS (11): "administration", "agency", "commerce", "conditions", "department", "economic", "government", "monitoring", "national", "regulatory", "weather". | EXACT TITLE in weather: "National Oceanic and Atmospheric Administration".
0.420
acteconomicenvironmentalformincreaseslocalmilitaryoperationsupplywaterweather
SHARED TOKENS (11): "act", "economic", "environmental", "form", "increases", "local", "military", "operation", "supply", "water", "weather". | EXACT TITLE in weather: "Weather modification".
0.420
conditionsdeterminefrequencyhighirrigationmanagersprocesssystemsystemswaterweather
SHARED TOKENS (11): "conditions", "determine", "frequency", "high", "irrigation", "managers", "process", "system", "systems", "water", "weather". | EXACT TITLE in weather: "Irrigation scheduling".
0.420
Flash flood ↗ Q860333 EXACT TITLE
associatedconditionsfloodfloodplainshazardheavylargenaturalsignificantsnowstructure
SHARED TOKENS (11): "associated", "conditions", "flood", "floodplains", "hazard", "heavy", "large", "natural", "significant", "snow", "structure". | EXACT TITLE in weather: "Flash flood".
0.400
appliesaviationdatadirectfrequencyproducesignalspecializedsystemsuses
SHARED TOKENS (10): "applies", "aviation", "data", "direct", "frequency", "produce", "signal", "specialized", "systems", "uses". | EXACT TITLE in weather: "Doppler radar".
0.400
activitybuiltenvironmentalhealthimpactsinterfacelandnaturalpublicurban
SHARED TOKENS (10): "activity", "built", "environmental", "health", "impacts", "interface", "land", "natural", "public", "urban". | EXACT TITLE in weather: "Wildland–urban interface".
0.400
Snowplow ↗ Q14976 EXACT TITLE
frequentlyintendedlargeoutdoorservingsnowsurfacestransportationvehiclewinter
SHARED TOKENS (10): "frequently", "intended", "large", "outdoor", "serving", "snow", "surfaces", "transportation", "vehicle", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
Mitigation ↗ Q6881760 EXACT TITLE
emergencyfrequentlyhazardslawmanagemanagementmitigationreduceresponsibilitysubject
SHARED TOKENS (10): "emergency", "frequently", "hazards", "law", "manage", "management", "mitigation", "reduce", "responsibility", "subject". | EXACT TITLE in transportation_infrastructure: "Mitigation". | EXACT TITLE in weather: "Mitigation".
0.380
Snowmelt ↗ Q1754697 EXACT TITLE
annualconditionscontroldrainagehighprojectssnowsurfacewater
SHARED TOKENS (9): "annual", "conditions", "control", "drainage", "high", "projects", "snow", "surface", "water". | EXACT TITLE in weather: "Snowmelt".
0.380
agriculturalcitiesidaholandmajormilesnorthwestprimarilyriver
SHARED TOKENS (9): "agricultural", "cities", "idaho", "land", "major", "miles", "northwest", "primarily", "river". | EXACT TITLE in weather: "Snake River Plain".
0.360
aircontrastscreateengineerenginesfuelnaturaluses
SHARED TOKENS (8): "air", "contrasts", "create", "engineer", "engines", "fuel", "natural", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.360
americanapplicationshydrologicinformationmissionorganizationprofessionalsociety
SHARED TOKENS (8): "american", "applications", "hydrologic", "information", "mission", "organization", "professional", "society". | EXACT TITLE in weather: "American Meteorological Society".
0.340
boiseeasternexpansionidahooperatingoregonthough
SHARED TOKENS (7): "boise", "eastern", "expansion", "idaho", "operating", "oregon", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.340
coveragedeterminefloodfloodplainsinsuranceinsurersproperty
SHARED TOKENS (7): "coverage", "determine", "flood", "floodplains", "insurance", "insurers", "property". | EXACT TITLE in weather: "Flood insurance".
0.340
civilengineeringfieldinvolvingnetworktraffictransportation
SHARED TOKENS (7): "civil", "engineering", "field", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.320
boisefeetidaholevelmountainnational
SHARED TOKENS (6): "boise", "feet", "idaho", "level", "mountain", "national". | EXACT TITLE in weather: "Boise Mountains".
0.320
airincreaseslayernearpropertyrelationship
SHARED TOKENS (6): "air", "increases", "layer", "near", "property", "relationship". | EXACT TITLE in weather: "Inversion (meteorology)".
0.300
accesschaincostsdirecteconomicsgeneralhighwayintendeditselflogisticslongoperatingpracticepracticesregionspecializedtrainstransporttransportation
SHARED TOKENS (19): "access", "chain", "costs", "direct", "economics", "general", "highway", "intended", "itself", "logistics", "long", "operating", "practice", "practices", "region", "specialized", "trains", "transport", "transportation".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcitiescostsdensedensitydescribeddevelopmentenvironmentalexpansionformgrowthindustrialinfrastructurelandlargemeasurepeople
SHARED TOKENS (34): "agency", "associated", "become", "building", "cities", "costs", "dense", "density", "described", "development", "environmental", "expansion", "form", "growth", "industrial", "infrastructure", "land", "large", "measure", "people"....
0.300
Drainage basin ↗ Q166620 KW CROSS HIGH
adjacentboundariesdrainageengineeringenvironmentalflowshydrologiclandpermanentplacesratherriversinglesurfacesystemtermsthoughwater
SHARED TOKENS (18): "adjacent", "boundaries", "drainage", "engineering", "environmental", "flows", "hydrologic", "land", "permanent", "places", "rather", "river", "single", "surface", "system", "terms", "though", "water".
0.300
activityaffectedairassociatedbecomedifferentevenforecasthealthhighindexindividualsmeasurenationalpeoplephysicalpublicqualityreducerisks
SHARED TOKENS (21): "activity", "affected", "air", "associated", "become", "different", "even", "forecast", "health", "high", "index", "individuals", "measure", "national", "people", "physical", "public", "quality", "reduce", "risks"....
0.300
agriculturalapplicationcurrenthealthresearch
SHARED TOKENS (5): "agricultural", "application", "current", "health", "research". | EXACT TITLE in weather: "Pesticide drift".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesignengineersimprovementincreaseintegrationlowermakesreducereducedrequireresearchresultingroadrulessafetysignalssignificant
SHARED TOKENS (24): "associated", "become", "central", "design", "engineers", "improvement", "increase", "integration", "lower", "makes", "reduce", "reduced", "require", "research", "resulting", "road", "rules", "safety", "signals", "significant"....
0.300
Particulate matter ↗ KW CROSS HIGH
affectairclimateenvironmentalexposurehealthimpactlevelmillionnaturaloutdoorprimarilyqualitystandardstravel
SHARED TOKENS (15): "affect", "air", "climate", "environmental", "exposure", "health", "impact", "level", "million", "natural", "outdoor", "primarily", "quality", "standards", "travel".
0.300
demandformfunctionsmannermedicalmobilemovementnetworkpeopleprivateprogramsprovidepublicratherrelevantsharedtechnologytransportusers
SHARED TOKENS (19): "demand", "form", "functions", "manner", "medical", "mobile", "movement", "network", "people", "private", "programs", "provide", "public", "rather", "relevant", "shared", "technology", "transport", "users".
0.300
americanbuiltcenterscentralchangescitiesdevelopmenteconomicenvironmentalexpansionformationgrowinggrowthmodelmovementpopulationprocessresidentsurban
SHARED TOKENS (19): "american", "built", "centers", "central", "changes", "cities", "development", "economic", "environmental", "expansion", "formation", "growing", "growth", "model", "movement", "population", "process", "residents", "urban".
0.300
KIVI-TV ↗ Q6331205 KW CROSS HIGH
advertisingboisefallsidaholicensedlocalmaintainsofficeoperatesownedprogramsseparateservingtwinunincorporatedvalley
SHARED TOKENS (16): "advertising", "boise", "falls", "idaho", "licensed", "local", "maintains", "office", "operates", "owned", "programs", "separate", "serving", "twin", "unincorporated", "valley".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
centralcitiescommunitiesconnectingdifferentelectrichourinsidemetropolitanoperateoperatesprimarilyregionalsystemstrainstransporturban
SHARED TOKENS (17): "central", "cities", "communities", "connecting", "different", "electric", "hour", "inside", "metropolitan", "operate", "operates", "primarily", "regional", "systems", "trains", "transport", "urban".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedbehaviorcontrolcriticalenforcementeventhealthimpactimprovelevelmethodsoccupationalpracticesproduceprovidingpublicrapidlyrequiringroadroads
SHARED TOKENS (31): "applied", "behavior", "control", "critical", "enforcement", "event", "health", "impact", "improve", "level", "methods", "occupational", "practices", "produce", "providing", "public", "rapidly", "requiring", "road", "roads"....
0.300
accessactagricultureanalysisbackbecomebroaderbuildingbuildingscapacitychangesclimatecommunitiescommunitydevelopmentdifferenteconomiceveneventevents
SHARED TOKENS (53): "access", "act", "agriculture", "analysis", "back", "become", "broader", "building", "buildings", "capacity", "changes", "climate", "communities", "community", "development", "different", "economic", "even", "event", "events"....
0.300
buildingcentercentraldedicateddensedesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivateproblempublicrelationshipresidentialscale
SHARED TOKENS (23): "building", "center", "central", "dedicated", "dense", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "problem", "public", "relationship", "residential", "scale"....
0.300
appliesbuildingcannotchangesclimatecostsdistributioneconomyeventeventsfloodplainsfrequencyhazardshealthheavyhistoricalhistoryimpactimpactsinfrastructure
SHARED TOKENS (33): "applies", "building", "cannot", "changes", "climate", "costs", "distribution", "economy", "event", "events", "floodplains", "frequency", "hazards", "health", "heavy", "historical", "history", "impact", "impacts", "infrastructure"....
0.300
Urban runoff ↗ Q4358090 KW CROSS HIGH
buildingbuiltcommunitiesconcretecreateddevelopmentdischargedrainseventsirrigationlandlandscapemajormunicipalpeopleremainsroadssidewalkssourcesurface
SHARED TOKENS (24): "building", "built", "communities", "concrete", "created", "development", "discharge", "drains", "events", "irrigation", "land", "landscape", "major", "municipal", "people", "remains", "roads", "sidewalks", "source", "surface"....
0.300
conditionscoveragecurrentdailydetermineenvironmentalitselflimitedlongmeansmodelspressureproducespeedsupportsurroundingtrackuseswaterweather
SHARED TOKENS (20): "conditions", "coverage", "current", "daily", "determine", "environmental", "itself", "limited", "long", "means", "models", "pressure", "produce", "speed", "support", "surrounding", "track", "uses", "water", "weather".
0.300
becomechangesdesignengineeringengineersgrowingimprovephysicalplannersresponsibleroadroadssafetyspeedsurfacetrafficurbanuses
SHARED TOKENS (18): "become", "changes", "design", "engineering", "engineers", "growing", "improve", "physical", "planners", "responsible", "road", "roads", "safety", "speed", "surface", "traffic", "urban", "uses".
0.300
administrationagencyairairlinesamericanbuildingcentersconcreteconstructiondepartmentdistributioneconomyeducationenginesenvironmentalfederalgoverninggovernshealthhighway
SHARED TOKENS (48): "administration", "agency", "air", "airlines", "american", "building", "centers", "concrete", "construction", "department", "distribution", "economy", "education", "engines", "environmental", "federal", "governing", "governs", "health", "highway"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecreateddifferentgovernmenthighwaylandlegallocaloperateownershippeoplephysicalprivaterightsroadroadsspeedtraffictransportation
SHARED TOKENS (22): "authority", "capable", "created", "different", "government", "highway", "land", "legal", "local", "operate", "ownership", "people", "physical", "private", "rights", "road", "roads", "speed", "traffic", "transportation"....
0.300
airportclimatecodecooperativedailydatadefinesdensitydetermineforecastforecastsinformationissuelevelmodelnetworkofficepressureprogramrecord
SHARED TOKENS (29): "airport", "climate", "code", "cooperative", "daily", "data", "defines", "density", "determine", "forecast", "forecasts", "information", "issue", "level", "model", "network", "office", "pressure", "program", "record"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecitiescommunitiesconditioncreatecreatescurrentdescribesdevelopmenteconomiceconomicseducationenvironmentalequivalentessentialforecastgenerategeography
SHARED TOKENS (57): "approximately", "architecture", "become", "cities", "communities", "condition", "create", "creates", "current", "describes", "development", "economic", "economics", "education", "environmental", "equivalent", "essential", "forecast", "generate", "geography"....
0.300
addingarticlebecomecapacityconditiondemanddensitydepartmentshighmodeledplanningpublicresultingroadroadsspeedtraffictransporttransportationurban
SHARED TOKENS (20): "adding", "article", "become", "capacity", "condition", "demand", "density", "departments", "high", "modeled", "planning", "public", "resulting", "road", "roads", "speed", "traffic", "transport", "transportation", "urban".
0.300
americancapacitycapitalcitiesconnectingconventionalcorridorscostdailydedicateddesigndesignedelectricintegratelowermillionnetworkpublicqualityreduce
SHARED TOKENS (27): "american", "capacity", "capital", "cities", "connecting", "conventional", "corridors", "cost", "daily", "dedicated", "design", "designed", "electric", "integrate", "lower", "million", "network", "public", "quality", "reduce"....
0.300
actadvancedagenciesairapplicationappliedbuildingschangescodecomplianceconditionscontroldatadesigndeterminedevelopmentemergencyepaeventfacilities
SHARED TOKENS (66): "act", "advanced", "agencies", "air", "application", "applied", "buildings", "changes", "code", "compliance", "conditions", "control", "data", "design", "determine", "development", "emergency", "epa", "event", "facilities"....
0.300
accidentadoptedadvancedapplicationappliedcapacitychangescollectionconditionsdifferentemergencyfieldimproveincreaseinformationinfrastructurelimitmanagementmobilityprovide
SHARED TOKENS (32): "accident", "adopted", "advanced", "application", "applied", "capacity", "changes", "collection", "conditions", "different", "emergency", "field", "improve", "increase", "information", "infrastructure", "limit", "management", "mobility", "provide"....
0.300
agenciesairportsauthoritiesaviationdesigneddevelopmentevenincreaselargemaintenanceroadroadssidewalkssnowsurfacesurfacestrafficvehiclewinter
SHARED TOKENS (19): "agencies", "airports", "authorities", "aviation", "designed", "development", "even", "increase", "large", "maintenance", "road", "roads", "sidewalks", "snow", "surface", "surfaces", "traffic", "vehicle", "winter".
0.300
Heat wave ↗ Q215864 KW CROSS HIGH
additionalagriculturalauthoritiesbecomeclimatedescribedeconomyeventeventsforecastformfrequencyhealthhotimpactincreaseindustrialinfrastructureissueland
SHARED TOKENS (29): "additional", "agricultural", "authorities", "become", "climate", "described", "economy", "event", "events", "forecast", "form", "frequency", "health", "hot", "impact", "increase", "industrial", "infrastructure", "issue", "land"....
0.300
Radiosonde ↗ Q852817 KW CROSS HIGH
dailydataessentialfallsfrequencyhighinformationmeasureoperatepositionpressurerathersourcespeedweather
SHARED TOKENS (15): "daily", "data", "essential", "falls", "frequency", "high", "information", "measure", "operate", "position", "pressure", "rather", "source", "speed", "weather".
0.300
anticipatedconcretedepartmentdesigneddifferentevenmovementpathwaypermitprimaryprovidesharedsidewalkssurfacetransporttravelurbanusers
SHARED TOKENS (18): "anticipated", "concrete", "department", "designed", "different", "even", "movement", "pathway", "permit", "primary", "provide", "shared", "sidewalks", "surface", "transport", "travel", "urban", "users".
0.300
americanappearsassistancecombinedcreatedevenfacilitiesgovernlargelowerroadroadsrulessafetyseparatesignalsspeedstreetsurfacestraffic
SHARED TOKENS (22): "american", "appears", "assistance", "combined", "created", "even", "facilities", "govern", "large", "lower", "road", "roads", "rules", "safety", "separate", "signals", "speed", "street", "surfaces", "traffic"....
0.300
analysisbackbroaderbuildingchangescitiesclimatecommunitiescontroldescribingengineeringeventsexposurefloodimpactincreaseindividualinfrastructurelandscapelevel
SHARED TOKENS (36): "analysis", "back", "broader", "building", "changes", "cities", "climate", "communities", "control", "describing", "engineering", "events", "exposure", "flood", "impact", "increase", "individual", "infrastructure", "landscape", "level"....
0.300
Tegna Inc. ↗ Q20648663 KW CROSS HIGH
americanapprovalcreateddigitalintegrationjunelaterlegalmarketsmedianetworkoperatedoperationsownedreachstationstemporaryterms
SHARED TOKENS (18): "american", "approval", "created", "digital", "integration", "june", "later", "legal", "markets", "media", "network", "operated", "operations", "owned", "reach", "stations", "temporary", "terms".
0.300
accessadministrationaffectsagencyauthoritiesbuildingcoordinatecreateddepartmentdevelopmentemergencyexecutivefederalfundingfundsgovernmentindividualsinfrastructurelocalmajor
SHARED TOKENS (31): "access", "administration", "affects", "agency", "authorities", "building", "coordinate", "created", "department", "development", "emergency", "executive", "federal", "funding", "funds", "government", "individuals", "infrastructure", "local", "major"....
0.300
appliedappliesapprovalassociationcontextdecisiondecisionsdefinesdevelopmentenvironmentalgovernedidentifyingimpactimpactsindividualsmajormakingmanagementmoveparticipation
SHARED TOKENS (37): "applied", "applies", "approval", "association", "context", "decision", "decisions", "defines", "development", "environmental", "governed", "identifying", "impact", "impacts", "individuals", "major", "making", "management", "move", "participation"....
0.300
accessadvancedamericanbuiltcapacitycentralchangescitiesconnectconnectedconnectingcontainingdesignedevenhighwaylongnetworkplanspropertyprovide
SHARED TOKENS (36): "access", "advanced", "american", "built", "capacity", "central", "changes", "cities", "connect", "connected", "connecting", "containing", "designed", "even", "highway", "long", "network", "plans", "property", "provide"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasterngeneralhighwayidaholongestmajormilesnationalnearnorthwestofficialoregonpacificriverroadroadsruleswestwestern
SHARED TOKENS (20): "caldwell", "eastern", "general", "highway", "idaho", "longest", "major", "miles", "national", "near", "northwest", "official", "oregon", "pacific", "river", "road", "roads", "rules", "west", "western".
0.300
authoritiesbegancontrolcontrolledfuelhazardincreaseslandlandscapelawmanagementmeaningnaturalpeoplepotentialpracticeprimarilyreducescale
SHARED TOKENS (19): "authorities", "began", "control", "controlled", "fuel", "hazard", "increases", "land", "landscape", "law", "management", "meaning", "natural", "people", "potential", "practice", "primarily", "reduce", "scale".
0.300
Natural disaster ↗ Q8065 KW CROSS HIGH
activityadditionalaffectsarchitecturebecomesbuildingbuildingsclimatecommunitydependsdistinguisheconomiceventexposurehazardhazardshighimpactimpactsland
SHARED TOKENS (33): "activity", "additional", "affects", "architecture", "becomes", "building", "buildings", "climate", "community", "depends", "distinguish", "economic", "event", "exposure", "hazard", "hazards", "high", "impact", "impacts", "land"....
0.300
americanannualcontrolledcoveragedecisionsdigitalequivalentjunemarketsmedianetworknewsoperatingoperatorstationssupport
SHARED TOKENS (16): "american", "annual", "controlled", "coverage", "decisions", "digital", "equivalent", "june", "markets", "media", "network", "news", "operating", "operator", "stations", "support".
0.300
Water cycle ↗ Q81041 KW CROSS HIGH
affectagricultureavailabilitychangescirculationclimatecontinuouscriticaldependsdifferentenergyessentialeventsformfrequencyhydrologiclandmaintenancemajormovement
SHARED TOKENS (35): "affect", "agriculture", "availability", "changes", "circulation", "climate", "continuous", "critical", "depends", "different", "energy", "essential", "events", "form", "frequency", "hydrologic", "land", "maintenance", "major", "movement"....
0.300
actagencyairamongassociatedclimatecontrolcoordinationcreateenforcementenvironmentalepafacilitiesfederalfuelsimpactindustrialintendedlawlayer
SHARED TOKENS (39): "act", "agency", "air", "among", "associated", "climate", "control", "coordination", "create", "enforcement", "environmental", "epa", "facilities", "federal", "fuels", "impact", "industrial", "intended", "law", "layer"....
0.300
americandepartmentdepartmentsdirectlyeconomyexecutivefederalgovernmentmissionmovementpeopleplanreportsservingsystemtransportation
SHARED TOKENS (16): "american", "department", "departments", "directly", "economy", "executive", "federal", "government", "mission", "movement", "people", "plan", "reports", "serving", "system", "transportation".
0.300
advancedairportarmyaviationboisebuildingcentralcontinuouscountiescurrentdecemberexpandedforecastforecastsidahoimprovejunelocalmaintainsnational
SHARED TOKENS (32): "advanced", "airport", "army", "aviation", "boise", "building", "central", "continuous", "counties", "current", "december", "expanded", "forecast", "forecasts", "idaho", "improve", "june", "local", "maintains", "national"....
0.300
accessaddressingaffectedanticipatedbuildingchangescitiesclimatecommunitiescommunityconnectedcoordinationcurrentdecisionsdeterminedevelopmenteconomicfinancialfloodfuture
SHARED TOKENS (60): "access", "addressing", "affected", "anticipated", "building", "changes", "cities", "climate", "communities", "community", "connected", "coordination", "current", "decisions", "determine", "development", "economic", "financial", "flood", "future"....
0.300
combinedconnectscurrentcustomersdeliverydirectdirectlydistinctdistributioneasternelectricelectricityenergyevenformfrequencyhistoricallyincreaseindustrylevel
SHARED TOKENS (34): "combined", "connects", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electric", "electricity", "energy", "even", "form", "frequency", "historically", "increase", "industry", "level"....
0.300
actadachangescivilcostsemployershouseindividualsjanuarylaterlawnationalprovidepublicrequirementsrequiresrights
SHARED TOKENS (17): "act", "ada", "changes", "civil", "costs", "employers", "house", "individuals", "january", "later", "law", "national", "provide", "public", "requirements", "requires", "rights".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontroldecemberelectricityflowsinformationlevellocalnationalreduceroadsignalsignalssystemsystemstechnologytrafficusers
SHARED TOKENS (19): "advanced", "capacity", "control", "december", "electricity", "flows", "information", "level", "local", "national", "reduce", "road", "signal", "signals", "system", "systems", "technology", "traffic", "users".
0.300
airbuildingconditionscontainingcreatesevenhazardhealthhotpeoplepersonnelphysicalpropertypublicregulationsriskssafetysubjectsystemtransport
SHARED TOKENS (20): "air", "building", "conditions", "containing", "creates", "even", "hazard", "health", "hot", "people", "personnel", "physical", "property", "public", "regulations", "risks", "safety", "subject", "system", "transport".
0.300
centercreateitselflatermilesnetworkoperatesoperatingpacificplansprincipalprojectreachreportingroadsystemtransportationwestwestern
SHARED TOKENS (19): "center", "create", "itself", "later", "miles", "network", "operates", "operating", "pacific", "plans", "principal", "project", "reach", "reporting", "road", "system", "transportation", "west", "western".
0.300
accessactadditionaladministrationadoptedapproximatelybeganbuiltcollectionconstructioncontrolledcostdensedesigndesignedequivalentexpandextendsfederalfuel
SHARED TOKENS (51): "access", "act", "additional", "administration", "adopted", "approximately", "began", "built", "collection", "construction", "controlled", "cost", "dense", "design", "designed", "equivalent", "expand", "extends", "federal", "fuel"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationadoptedairanalysisarchitecturebroaderbuildingsbuiltcapitalcitiescivilcodescommunicationscommunitiescommunitydesigndevelopmentdifferentdistributioneconomic
SHARED TOKENS (66): "administration", "adopted", "air", "analysis", "architecture", "broader", "buildings", "built", "capital", "cities", "civil", "codes", "communications", "communities", "community", "design", "development", "different", "distribution", "economic"....
0.300
activityanalysisbecomesboundariesdesignengineerengineeringengineersgeneralgovernmentlegallicensedlicensurelocalmaintenancemannerplanspracticepractitionersprocess
SHARED TOKENS (38): "activity", "analysis", "becomes", "boundaries", "design", "engineer", "engineering", "engineers", "general", "government", "legal", "licensed", "licensure", "local", "maintenance", "manner", "plans", "practice", "practitioners", "process"....
0.300
NEXRAD ↗ Q3088597 KW CROSS HIGH
activityadministrationagencyairaviationcommercedatadepartmentfaafederalmapmovementnationalnetworkoperatedoperatesoperatorsystemtechnicaltransportation
SHARED TOKENS (21): "activity", "administration", "agency", "air", "aviation", "commerce", "data", "department", "faa", "federal", "map", "movement", "national", "network", "operated", "operates", "operator", "system", "technical", "transportation"....
0.300
actairapplicationsbuildingcentercenterscitiesclimateconditionscorridorsdensedevelopmentdistinctenergyexpandexposuregrowingimpactincreaseincreases
SHARED TOKENS (35): "act", "air", "applications", "building", "center", "centers", "cities", "climate", "conditions", "corridors", "dense", "development", "distinct", "energy", "expand", "exposure", "growing", "impact", "increase", "increases"....
0.300
academicapplicationdesignengineeringfacilitiesfieldmanagementmovementoccupationaloperationpeopleplanningprovidetechnologytransporttransportation
SHARED TOKENS (16): "academic", "application", "design", "engineering", "facilities", "field", "management", "movement", "occupational", "operation", "people", "planning", "provide", "technology", "transport", "transportation".
0.300
academicaddressinganalyzedevelopmentengineeringenvironmentaleventsfieldgrowinghistoryintegratedintegrationinterdisciplinarymajornaturalphysicalpublicrequiringriverstudy
SHARED TOKENS (22): "academic", "addressing", "analyze", "development", "engineering", "environmental", "events", "field", "growing", "history", "integrated", "integration", "interdisciplinary", "major", "natural", "physical", "public", "requiring", "river", "study"....
0.300
affectagenciesassistancebudgetbuildingcapacityclimatecommunitiesconcretecostsdevelopmentdifferentestimateseventsfederalfinanceframeworkfundinggovernmenthazards
SHARED TOKENS (51): "affect", "agencies", "assistance", "budget", "building", "capacity", "climate", "communities", "concrete", "costs", "development", "different", "estimates", "events", "federal", "finance", "framework", "funding", "government", "hazards"....
0.300
activityboundariesclimatecontinuousdailydatadesigneddevelopmentenergyenvironmentalflowsinformationmonitoringmovementprimarilyproviderecordsnowsystemsweather
SHARED TOKENS (21): "activity", "boundaries", "climate", "continuous", "daily", "data", "designed", "development", "energy", "environmental", "flows", "information", "monitoring", "movement", "primarily", "provide", "record", "snow", "systems", "weather"....
0.300
applicationcivilcollectioncontroldesignengineerengineeringenvironmentalfacilitieshydraulicirrigationmeasurementmovementpowerprojectprojectsregulationriverstoragestructures
SHARED TOKENS (24): "application", "civil", "collection", "control", "design", "engineer", "engineering", "environmental", "facilities", "hydraulic", "irrigation", "measurement", "movement", "power", "project", "projects", "regulation", "river", "storage", "structures"....
0.300
administrationagencyarticleassociatedaviationcentercenterscitiescollectioncommercedefinesdepartmentdescribesequivalentforecastforecastsgeneralgovernmentlocalnational
SHARED TOKENS (31): "administration", "agency", "article", "associated", "aviation", "center", "centers", "cities", "collection", "commerce", "defines", "department", "describes", "equivalent", "forecast", "forecasts", "general", "government", "local", "national"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
applicationbuildingsconnectdevelopmentevenexpandedfunctionsgovernmentimpactlandlaterlegalmunicipalitiesownershippowerprivatepropertypublicrequireroads
SHARED TOKENS (25): "application", "buildings", "connect", "development", "even", "expanded", "functions", "government", "impact", "land", "later", "legal", "municipalities", "ownership", "power", "private", "property", "public", "require", "roads"....
0.300
adjacentannualbroadercapitalcentralclassificationclimateconcentratedeasternfallshotlargemeasurenorthwestpacificregionremainsseparatelysignificantsnow
SHARED TOKENS (24): "adjacent", "annual", "broader", "capital", "central", "classification", "climate", "concentrated", "eastern", "falls", "hot", "large", "measure", "northwest", "pacific", "region", "remains", "separately", "significant", "snow"....
0.300
civilconstructiondesignengineeringengineersflowsfuturehighwaymaintenanceoperationpavementplanningprofessionalroadsstandardsstructuraltraffictransportation
SHARED TOKENS (18): "civil", "construction", "design", "engineering", "engineers", "flows", "future", "highway", "maintenance", "operation", "pavement", "planning", "professional", "roads", "standards", "structural", "traffic", "transportation".
0.300
additionaladvancedagenciesauthoritiesbegancontactcorpsdepartmentdispatchemergencyfacilitieshistoricallymedicalmodeloperatepersonnelplacespresentprimaryprovide
SHARED TOKENS (35): "additional", "advanced", "agencies", "authorities", "began", "contact", "corps", "department", "dispatch", "emergency", "facilities", "historically", "medical", "model", "operate", "personnel", "places", "present", "primary", "provide"....
0.300
Derecho ↗ Q3023711 KW CROSS HIGH
associatedcommunityconventionaleveneventsformheavyjunemeaningmovemovementphysicalproductionrapidlyreachregionresponsiblestudiessystemsystems
SHARED TOKENS (22): "associated", "community", "conventional", "even", "events", "form", "heavy", "june", "meaning", "move", "movement", "physical", "production", "rapidly", "reach", "region", "responsible", "studies", "system", "systems"....
0.300
administrationagenciesamongchangescommunitiescompliancecontentcontrolcurrentdecemberdefinesdepartmentdesigndesignedfederalhighwaylawlocalnationalowned
SHARED TOKENS (32): "administration", "agencies", "among", "changes", "communities", "compliance", "content", "control", "current", "december", "defines", "department", "design", "designed", "federal", "highway", "law", "local", "national", "owned"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdifferentequivalentformheavyindividuallonglowermeaningoperateoperatesoperatingoperationsprimarilyspeedsystemsystemstechnology
SHARED TOKENS (23): "broader", "capacity", "conditions", "different", "equivalent", "form", "heavy", "individual", "long", "lower", "meaning", "operate", "operates", "operating", "operations", "primarily", "speed", "system", "systems", "technology"....
0.300
adoptedagencycentercurrentdatadepartmentfederalgeographygovernmenthazardslandscapemajormakesnaturalnearorganizationpeoplepublicregulatoryresearch
SHARED TOKENS (25): "adopted", "agency", "center", "current", "data", "department", "federal", "geography", "government", "hazards", "landscape", "major", "makes", "natural", "near", "organization", "people", "public", "regulatory", "research"....
0.300
Water balance ↗ Q1148989 KW CROSS HIGH
activityassessbudgetchangesclimatedifferentdrainageenvironmentalhydrologicirrigationlandlawmanagementplanningresourcesstoragesurveysystemwater
SHARED TOKENS (19): "activity", "assess", "budget", "changes", "climate", "different", "drainage", "environmental", "hydrologic", "irrigation", "land", "law", "management", "planning", "resources", "storage", "survey", "system", "water".
0.300
accesscommunitydesigndesignedeconomicengineersenvironmentalhealthhighwayhomeoperatedplannerspolicypractitionerspublicrequiressafetytraffictransportationtravel
SHARED TOKENS (22): "access", "community", "design", "designed", "economic", "engineers", "environmental", "health", "highway", "home", "operated", "planners", "policy", "practitioners", "public", "requires", "safety", "traffic", "transportation", "travel"....
0.300
Oversize load ↗ Q680421 KW CROSS HIGH
airbridgeconstructionheavyhighwayindustrialinfrastructurelargelegalloadsordinaryroadstandardtransporttransportationwater
SHARED TOKENS (16): "air", "bridge", "construction", "heavy", "highway", "industrial", "infrastructure", "large", "legal", "loads", "ordinary", "road", "standard", "transport", "transportation", "water".
0.300
boisecitiesfallshighwayhomeidahomajormetropolitanmilesmountainnearnorthwestoregonprimarilyrivertwin
SHARED TOKENS (16): "boise", "cities", "falls", "highway", "home", "idaho", "major", "metropolitan", "miles", "mountain", "near", "northwest", "oregon", "primarily", "river", "twin".
🫐 BERRY34 edges
0.290
airportaviationbecomedesignedoperationsstationsweather
SHARED TOKENS (7): "airport", "aviation", "become", "designed", "operations", "stations", "weather". | URL->B (1): https://www.faa.gov/air_traffic/weather/asos/.
0.280
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalbrandconditionscustomersdeterminedigitalindependentinspectionmaintenanceproblemrolestartvehiclework
SHARED TOKENS (14): "approval", "brand", "conditions", "customers", "determine", "digital", "independent", "inspection", "maintenance", "problem", "role", "start", "vehicle", "work".
0.280
Floodway ↗ Q19922690 EXACT TITLE
communitycontrolfloodroad
SHARED TOKENS (4): "community", "control", "flood", "road". | EXACT TITLE in weather: "Floodway".
0.280
airclimateconditionsfieldinteractionslayermajornaturalphysicalregionstudysystemsystemsweather
SHARED TOKENS (14): "air", "climate", "conditions", "field", "interactions", "layer", "major", "natural", "physical", "region", "study", "system", "systems", "weather".
0.260
Smudge pot ↗ Q7546587 EXACT TITLE
createslargewater
SHARED TOKENS (3): "creates", "large", "water". | EXACT TITLE in weather: "Smudge pot".
0.260
americancenterchaincorporatedailydigitalmedianetworknewsoperatorownedpeopleterms
SHARED TOKENS (13): "american", "center", "chain", "corporate", "daily", "digital", "media", "network", "news", "operator", "owned", "people", "terms".
0.260
climatedifferentpotential
SHARED TOKENS (3): "climate", "different", "potential". | EXACT TITLE in weather: "Semi-arid climate".
0.240
agenciesconditionsdevelopmentemergencyforecastformlandmanagementnationalpublicwarningweather
SHARED TOKENS (12): "agencies", "conditions", "development", "emergency", "forecast", "form", "land", "management", "national", "public", "warning", "weather".
0.240
academiccommunitydifferenteducationformhighpolicyprogramssecondarystudentsuniversityworkforce
SHARED TOKENS (12): "academic", "community", "different", "education", "form", "high", "policy", "programs", "secondary", "students", "university", "workforce".
0.240
Boundary layer ↗ Q752193 KW CROSS HIGH
affectedairconditionflowsforcesincreaseslayermakingnearresultingsurfacesurrounding
SHARED TOKENS (12): "affected", "air", "condition", "flows", "forces", "increases", "layer", "making", "near", "resulting", "surface", "surrounding".
0.220
Cold wave ↗ Q642683 KW CROSS HIGH
agricultureaircommercefallshighhourindustrynationalregionrequiringweather
SHARED TOKENS (11): "agriculture", "air", "commerce", "falls", "high", "hour", "industry", "national", "region", "requiring", "weather".
0.220
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemetropolitanpeoplepoolpublicroadsystemtransportvehicle
SHARED TOKENS (11): "cities", "connections", "large", "metropolitan", "people", "pool", "public", "road", "system", "transport", "vehicle".
0.220
accessconnectingdesignedlocalmajormoveprovideresidentialroadroadstraffic
SHARED TOKENS (11): "access", "connecting", "designed", "local", "major", "move", "provide", "residential", "road", "roads", "traffic".
0.200
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
easternhighwayidaholimitedlongmilesoregonsystemwestwestern
SHARED TOKENS (10): "eastern", "highway", "idaho", "limited", "long", "miles", "oregon", "system", "west", "western".
0.180
associatedbegandevelopmentfieldidahomountainoregonriverwest
SHARED TOKENS (9): "associated", "began", "development", "field", "idaho", "mountain", "oregon", "river", "west".
0.180
airamericanlandlogisticsmilitaryphysicalprocessproductstransport
SHARED TOKENS (9): "air", "american", "land", "logistics", "military", "physical", "process", "products", "transport".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitanparmapopulationwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "parma", "population", "western".
0.180
Stream gauge ↗ Q505774 KW CROSS HIGH
centraldatadischargeenvironmentallevelqualitystationssurfacewater
SHARED TOKENS (9): "central", "data", "discharge", "environmental", "level", "quality", "stations", "surface", "water".
0.180
canyonconnectingeaglehighwayidaholongmeridianrivervalley
SHARED TOKENS (9): "canyon", "connecting", "eagle", "highway", "idaho", "long", "meridian", "river", "valley".
0.160
citiescountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "cities", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.160
Expert witness ↗ Q663272 KW CROSS HIGH
certificationeducationevidencelawskillsspecializedtechnicaltraining
SHARED TOKENS (8): "certification", "education", "evidence", "law", "skills", "specialized", "technical", "training".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitanpercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "percent", "population".
0.140
costsitselfreducedroadtransporttransportationvehicle
SHARED TOKENS (7): "costs", "itself", "reduced", "road", "transport", "transportation", "vehicle".
0.140
Bike lane ↗ Q1378400 KW CROSS HIGH
economicentryimproveresearchroadsafetytraffic
SHARED TOKENS (7): "economic", "entry", "improve", "research", "road", "safety", "traffic".
0.120
KBOI-TV ↗ KW CROSS HIGH
boiseidahoownedstationsstreetunincorporated
SHARED TOKENS (6): "boise", "idaho", "owned", "stations", "street", "unincorporated".
0.120
adaconnectingcountieshighwayidahostar
SHARED TOKENS (6): "ada", "connecting", "counties", "highway", "idaho", "star".
0.100
gardenhighwayidahotreasurevalley
SHARED TOKENS (5): "garden", "highway", "idaho", "treasure", "valley".
0.100
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
airairlinesamericanboiseidaho
SHARED TOKENS (5): "air", "airlines", "american", "boise", "idaho".
0.100
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesigndesignedengineeringvehicle
SHARED TOKENS (5): "connected", "design", "designed", "engineering", "vehicle".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
authoritiesdevelopmentformlocalweather
SHARED TOKENS (5): "authorities", "development", "form", "local", "weather".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Weather — Treasure Valley
HAIKU · HIGH GATE
How do spring snowmelt events affect Snake River floodplain infrastructure in Ada County?
The United States Army Corps of Engineers manages floodplain easements along the Snake River to accommodate seasonal water volume increases that threaten transportation routes in Ada County and Boise. Civil engineering standards for bridge design in the Treasure Valley account for the 100-year flood event, which determines clearance heights and foundation depths for structures crossing the river.
Why does Boise Airport require specific weather monitoring protocols for aviation operations?
The Federal Aviation Administration mandates that Boise Airport maintain real-time weather observation systems because Treasure Valley wind patterns and visibility conditions directly impact runway operations and approach procedures. Storm drain capacity in the airport's vicinity must be designed by civil engineers to handle intense precipitation events without flooding taxiways or terminal access roads.
What role do storm drains play in protecting Nampa and Boise transportation networks during heavy precipitation?
Storm drain systems throughout Nampa and Boise are engineered by civil professionals to route runoff away from roadways, parking areas, and transit corridors during the Treasure Valley's concentrated summer thunderstorms. The United States Environmental Protection Agency oversees stormwater quality standards that these drains must meet, requiring infrastructure upgrades in Ada County to prevent transportation disruptions and water contamination.
How do winter weather conditions affect transportation safety on routes connecting Star, Idaho to metropolitan Boise?
Snow and ice accumulation on highways between Star and Boise requires civil engineering designs that account for Treasure Valley winter precipitation patterns, including increased drainage and anti-icing surface treatments. Boise State University's civil engineering department has studied how temperature fluctuations in the western canyon approaches create hazardous conditions that demand specialized maintenance protocols for regional transportation corridors.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Weather 20 QID bridges 240 edges 6,491 ext links 2026-07-17 23:44:18 UTC 8b26ba31be12923f
Transportation Infrastructure corridor ↗ Weather corridor ↗ Weather × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals