—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Sports Recreation

18 Wikipedia bridge articles confirmed in both vertical ledgers. 253 deterministic cross-vertical edges. 6,915 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
253 Cross Edges
6,915 External Sources
283 Wikipedia Articles
26 🌲 Evergreen
187 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Sports Recreation
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
253
External Sources Harvested
6,915
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Treasure Valley
score: 1.0000  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (18)
Treasure ValleyLand-use planningBoise State UniversityFloodplainNampa, IdahoStar, IdahoAmericans with Disabilities Act of 1990Boise, IdahoUrban planningEmergency medical servicesAda County, IdahoGarden City, IdahoCaldwell, IdahoMeridian, IdahoMunicipal corporationCanyon County, IdahoEagle, IdahoKuna, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanadasecondlandnameresourcescitiespublicwestcanyonmilescapitallocalrivervalleyhealthurban
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:43:26 UTC
Content Hash
36765a96513987dc
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (16): "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "name", "opportunities", "primarily", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in sports_recreation: "Treasure Valley".
associationboisehistoricallyidaholandlocalmetropolitannameopportunitiesprimarilyregionresourcesrivertreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and sports_recreation (tier:evergreen). | SHARED TOKENS (48): "act", "american", "applied", "association", "authority", "behavior", "central", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depends", "design", "development", "districts", "economic".... | EXACT TITLE in sports_recreation: "Land-use planning".
actamericanappliedassociationauthoritybehaviorcentralchangescitiescommunitiescommunitycomprehensiveconditionscostscreatingdependsdesigndevelopmentdistrictseconomicenvironmentalfacilitiesfoundedfunctionhealthlandland-usemanagemeansneeds+18
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "founded", "health", "high", "idaho", "independent", "master", "million", "mountain", "program", "programs".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in sports_recreation: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringfoundedhealthhighidahoindependentmastermillionmountainprogramprogramspublicresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Floodplain
Q193110 EXACT TITLE 0.980
QID OVERLAP: Q193110 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (14): "adjacent", "base", "body", "control", "developed", "floodplain", "floodplains", "frequently", "high", "land", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain". | EXACT TITLE in sports_recreation: "Floodplain".
adjacentbasebodycontroldevelopedfloodplainfloodplainsfrequentlyhighlandriverurbanvalleywater
A floodplain or flood plain or bottomlands is an area of land adjacent to a river. Floodplains stretch from the banks of a river channel to the base of the enclosing valley, and experience flooding during periods of high discharge. The soils usually consist of clays, silts, sands, and gravels deposited during floods. Because of regular flooding, floodplains frequently have high soil fertility since nutrients are deposited with the flood waters. This can encourage farming; some important agricultural regions, such as the Nile and Mississippi river basins, heavily exploit floodplains. Agricultural and urban regions have developed near or on floodplains to take advantage of the rich soil and freshwater.
Excluding famines and epidemics, some of the worst natural disasters in history (measured by fatalities) have been river floods, particularly in the Yellow River in China – see list of deadliest floods. The worst of these, and the worst natural disaster (excluding famine and epidemics), was the 1931 China floods, estimated to have killed millions. This had been preceded by the 1887 Yellow River flood, which killed around one million people and is the second-worst natural disaster in history. The extent of floodplain inundation depends partly on flood magnitude, defined by the return period. In the United States, the Federal Emergency Management Agency (FEMA) manages the National Flood Insurance Program (NFIP). The NFIP offers insurance to properties located within a flood-prone area, as defined by the Flood Insurance Rate Map (FIRM), which depicts various flood risks for a community. The FIRM typically focuses on the delineation of the 100-year flood inundation area, also known within the NFIP as the Special Flood Hazard Area. Where a detailed study of a waterway has been done, the 100-year floodplain will also include the floodway, the critical portion of the floodplain which includes the stream channel and any adjacent areas that must be kept free of encroachments that might block flood flows or restrict storage of flood waters. Another commonly encountered term is the Special Flood Hazard Area, which is any area subject to inundation by a 100-year flood. A problem is that any alteration of the watershed upstream of the point in question can potentially affect the ability of the watershed to handle water, and thus potentially affects the levels of the periodic floods. A large shopping center and parking lot, for example, may raise the levels of 5-year, 100-year, and other floods, but the maps are rarely adjusted and are frequently rendered obsolete by subsequent development. In order for a flood-prone property to qualify for government-subsidized insurance, a local community must adopt an ordinance that protects the floodway and requires that new residential structures built in Special Flood Hazard Areas be elevated to at least the level of the 100-year flood. Commercial structures can be elevated or floodproofed to or above this level. In some areas without detailed study information, structures may be required to be elevated to at least two feet above the surrounding grade. Many State and local governments have, in addition, adopted floodplain construction regulations which are more restrictive than those mandated by the NFIP. The US government also sponsors flood hazard mitigation efforts to reduce flood impacts. California's Hazard Mitigation Program is one funding source for mitigation projects. A number of whole towns such as English, Indiana, have been completely relocated to remove them from the floodplain. Other smaller-scale mitigation efforts include acquiring and demolishing flood-prone buildings or flood-proofing them. In some floodplains, such as the Inner Niger Delta of Mali, annual flooding events are a natural part of the local ecology and rural economy, allowing for the raising of crops through recessional agriculture. However, in Bangladesh, which occupies the Ganges Delta, the advantages provided by the richness of the alluvial soil of the floodplain are severely offset by frequent floods brought on by cyclones and annual monsoon rains.
Environmental pollutants in floodplain soils Floodplain soils tend to be high in eco-pollutants, especially persistent organic pollutant (POP) deposition.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (18): "according", "boise", "canyon", "college", "idaho", "meaning", "meridian", "metropolitan", "miles", "name", "nampa", "northwest", "population", "principal", "second", "university", "west", "western".
accordingboisecanyoncollegeidahomeaningmeridianmetropolitanmilesnamenampanorthwestpopulationprincipalseconduniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Star, Idaho
Q1516815 QID OVERLAP 0.800
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (15): "ada", "boise", "canyon", "district", "growing", "idaho", "metropolitan", "middleton", "name", "population", "school", "schools", "shared", "star", "west".
adaboisecanyondistrictgrowingidahometropolitanmiddletonnamepopulationschoolschoolssharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:branch). | SHARED TOKENS (20): "accessibility", "act", "ada", "business", "changes", "civil", "costs", "disabilities", "disability", "employers", "individuals", "law", "national", "prohibits", "provide", "public", "requirements", "requires", "rights", "supported".
accessibilityactadabusinesschangescivilcostsdisabilitiesdisabilityemployersindividualslawnationalprohibitsprovidepublicrequirementsrequiresrightssupported
ual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Under Title III, no individual may be discriminated against on the basis of disability with regards to the full and equal enjoyment of the goods, services, facilities, or accommodations of any place of public accommodation by any person who owns, leases, or operates a place of public accommodation. Public accommodations include most places of lodging (such as inns and hotels), recreation, transportation, education, and dining, along with stores, care providers, and places of public displays. Under Title III of the ADA, all new construction (construction, modification or alterations) after the effective date of the ADA (approximately July 1992) must be fully compliant with the Americans With Disabilities Act Accessibility Guidelines (ADAAG) found in the Code of Federal Regulations at 28 C.F.R., Part 36, Appendix A. Title III also has applications to existing facilities. One of the definitions of "discrimination" under Title III of the ADA is a "failure to remove" architectural barriers in existing facilities. See 42 U.S.C. § 12182(b)(2)(A)(iv). This means that even facilities that have not been modified or altered in any way after the ADA was passed still have obligations. The standard is whether "removing barriers" (typically defined as bringing a condition into compliance with the ADAAG) is "readily achievable", defined as "...easily accomplished without much difficulty or expense". The statutory definition of "readily achievable" calls for a balancing test between the cost of the proposed alteration and the wherewithal of the business and/or owners of the business. Thus, what might be "readily achievable" for a sophisticated and financially capable corporation might not be readily achievable for a small or local business. There are exceptions to this title; many private clubs and religious organizations may not be bound by Title III. With regard to historic properties (those properties that are listed or that are eligible for listing in the National Register of Historic Places, or properties designated as historic under state or local law), those facilities must still comply with the provisions of Title III of the ADA to the "maximum extent feasible" but if following the usual standards would "threaten to destroy the historic significance of a feature of the building" then alternative standards may be used. Under 2010 revisions of Department of Justice regulations, newly constructed or altered swimming pools, wading pools, and spas must have an accessible means of entrance and exit to pools for disabled people. However, the requirement is conditioned on whether providing access through a fixed lift is "readily achievable". Other requirements exist, based on pool size, include providing a certain number of accessible means of entry and exit, which are outlined in Section 242 of the standards. However, businesses are free to consider the differences in the application of the rules depending on whether the pool is new or altered, or whether the swimming pool was in existence before the effective date of the new rule.
ADA Amendments Act, 2008 The ADA defines a covered disability as a physical or mental impairment that substantially limits one or more major life activities, a history of having such an impairment, or being regarded as having such an impairment. The Equal Employment Opportunity Commission (EEOC) was charged with interpreting the 1990 law with regard to discrimination in employment. The EEOC developed regulations limiting an individual's impairment to one that "severely or significantly restricts" a major life activity. The ADAAA directed the EEOC to amend its regulations and replace "severely or significantly" with "substantially limits", a more lenient standard. On September 25, 2008, President George W. Bush signed the ADA Amendments Act of 2008 (ADAAA) into law. The amendment broadened the definition of "disability", thereby extending the ADA's protections to a greater number of people. The ADAAA also added to the ADA examples of "major life activities" including, but not limited to, "caring for oneself, performing manual tasks, seeing, hearing, eating, sleeping, walking, standing, lifting, bending, speaking, breathing, learning, reading, concentrating, thinking, communicating, and working" as well as the operation of several specified "major bodily functions". The act overturned a 1999 US Supreme Court case that held that an employee was not disabled if the impairment could be corrected by mitigating measures; it specifically provides that such impairment must be determined without considering such ameliorative measures. It also overturned the court's finding that an impairment that substantially limits one major life activity must also limit others to be considered a disability. In 2008, the United States House Committee on Education and Labor stated that the amendment "makes it absolutely clear that the ADA is intended to provide broad coverage to protect anyone who faces discrimination on the basis of disability." Thus the ADAAA led to broader coverage of impaired employees. Web Content Accessibility Guidelines, 2019 In October 2019, the Supreme Court declined to resolve a circuit split as to whether websites are covered by the ADA. The Court turned down an appeal from Domino's Pizza and let stand a U.S.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "downtown", "employers", "feet", "idaho", "level", "locally", "major", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownemployersfeetidaholevellocallymajormetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Urban planning
Q69883 QID OVERLAP 0.800
QID OVERLAP: Q69883 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (75): "accessibility", "administration", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "civil", "codes", "communications", "communities", "community", "creating", "design", "developing"....
accessibilityadministrationanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescivilcodescommunicationscommunitiescommunitycreatingdesigndevelopingdevelopmentdifferentdistributioneconomicelectricityengineeringenvironmentenvironmentalexistingfield+45
for land use and the built environment, including air, water, and the infrastructure passing into and out of urban areas, such as transportation, communications, and distribution networks, and their accessibility. Traditionally, urban planning followed a top-down approach in master planning the physical layout of human settlements. The primary concern was the public welfare, which included considerations of efficiency, sanitation, protection and use of the environment, as well as taking account of effects of the master plans on the social and economic activities. Over time, urban planning has adopted a focus on the social and environmental "bottom lines" that focuses on using planning as a tool to improve the health and well-being of people and maintain sustainability standards. In the mid-20th century, urban planning experts such as Jane Jacobs called on urban planners to take resident experiences and needs more into consideration. Urban planning answers questions about how people will live, work, and play in a given area and thus, guides orderly development in urban, suburban and rural areas. Although predominantly concerned with the planning of settlements and communities, urban planners are also responsible for planning the efficient transportation of goods, resources, people, and waste. The distribution of basic necessities such as water and electricity; a sense of inclusion and opportunity for people of all kinds, culture and needs; economic growth or business development; improving health and conserving areas of natural environmental significance that actively contribute to reduction in CO2 emissions as well as protecting heritage structures and built environments. Since most urban planning teams consist of highly educated individuals that work for city governments, recent debates focus on how to involve more community members in city planning processes. Urban planning is an interdisciplinary field that includes civil engineering, architecture, human geography, social science and design sciences. Practitioners of urban planning use research and analysis, strategic thinking, engineering architecture, urban design, public consultation, policy recommendations, implementation and management. It is closely related to the field of urban design and some urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
sses. Urban planning is an interdisciplinary field that includes civil engineering, architecture, human geography, social science and design sciences. Practitioners of urban planning use research and analysis, strategic thinking, engineering architecture, urban design, public consultation, policy recommendations, implementation and management. It is closely related to the field of urban design and some urban planners provide designs for streets, parks, buildings and other urban areas. Urban planners work with the cognate fields of civil engineering, landscape architecture, architecture, and public administration to achieve strategic, policy and sustainability goals. Early urban planners were often members of these cognate fields though in the 21st century, urban planning is a separate, independent professional discipline. The discipline of urban planning is the broader category that includes different sub-fields such as land-use planning, zoning, economic development, environmental planning, and transportation planning. Creating the plans requires a thorough understanding of penal codes and zonal codes of planning. Another important aspect of urban planning is that projects range from the large-scale planning of new towns and Greenfield projects to the transformation and renewal of existing cities, neighborhoods, and public spaces. Pierre Charles L'Enfant and Lúcio Costa are known for planning new capital cities, while Daniel Burnham's Plan of Chicago, Georges-Eugene Haussmann's renovation of Paris, and the urban renewal projects of Robert Moses exemplify the large-scale reshaping of existing urban environments.
Emergency medical services
Q860447 QID OVERLAP 0.800
QID OVERLAP: Q860447 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (32): "additional", "advanced", "agencies", "began", "businesses", "care", "contact", "department", "developing", "emergency", "facilities", "historically", "medical", "model", "operate", "personnel", "places", "primary", "provide", "public"....
additionaladvancedagenciesbeganbusinessescarecontactdepartmentdevelopingemergencyfacilitieshistoricallymedicalmodeloperatepersonnelplacesprimaryprovidepublicresourcessearchsubstantialsupportsystemstechnicalthemthoughtrainingtreatment+2
ave personnel who retain at least basic life support (BLS) certifications. In English-speaking countries, they are known as emergency medical technicians (EMTs) and paramedics, with the latter having additional training such as advanced life support (ALS) skills. Physicians and nurses may also provide pre-hospital care to varying degrees in certain countries, a model which is popular in Europe. History Precursors Emergency care in the field has been rendered in different forms since the beginning of recorded history. The New Testament contains the parable of the Good Samaritan, in which a man who has been beaten is cared for by a passing Samaritan. Luke 10:34 (NIV) – "He went to him and bandaged his wounds, pouring on oil and wine.
First aid consists of basic skills that are commonly taught to members of the public, such as cardiopulmonary resuscitation, bandaging wounds and saving someone from choking. Basic Life Support (BLS) is often the lowest level of training that can be held by those who treat patients on an ambulance. Commonly, it includes administering oxygen therapy, some drugs and a few invasive treatments. BLS personnel may either operate a BLS ambulance on their own, or assist a higher qualified crewmate on an ALS ambulance. In English-speaking countries, BLS ambulance crew members are known as emergency medical technicians, emergency care assistants or Primary care paramedics in Canada. Intermediate Life Support (ILS), also known as Limited Advanced Life Support (LALS), is positioned between BLS and ALS but is less common than both. It is commonly a BLS provider with a moderately expanded skill set (such as an AEMT, but where it is present it usually replaces BLS. Advanced Life Support (ALS) has a considerably expanded range of skills such as intravenous therapy, endotracheal intubation, cricothyrotomy and interpretation of electrocardiograms. The scope of this higher tier response varies considerably by country. Paramedics commonly provide ALS, but some countries require it to be a higher level of care and instead employ physicians in this role. Additionally Advanced Life Support includes administering therapeutic doses of electrical shock to those who are in cardiac arrest or using drugs to stimulate the heart, Airway therapy, and so on and so forth. Most ambulances are equipped with advanced Life Support equipment and have paramedics on board. While some fire departments have ambulances, first aid and squads utilize ambulances for emergency medical services. Critical Care Transport (CCT or CCP), also known as medical retrieval or rendez vous MICU protocol in some countries (Australia, NZ, Great Britain, and Francophone Canada) refers to the critical care transport of patients between hospitals (as opposed to pre-hospital). Such services are a key element in regionalized systems of hospital care where intensive care services are centralized to a few specialist hospitals. An example of this is the Emergency Medical Retrieval Service in Scotland.
Emergency medical technicians are usually able to perform a wide range of emergency care skills, such as automated defibrillation, care of spinal injuries and oxygen therapy. In few jurisdictions, some EMTs are able to perform duties as IV and IO cannulation, administration of a limited number of drugs (including but not limited to Epinephrine, Narcan, Oxygen, Aspirin, Nitroglycerin – dependent on country, state, and medical direction), more advanced airway procedures, CPAP, and limited cardiac monitoring. Most advanced procedures and skills are not within the national scope of practice for an EMT. As such most states require additional training and certifications to perform above the national curriculum standards. In the United States, an EMT certification requires intense courses and training in field skills. Certifications are state-specific and last varying durations, though National Registry certification simplifies the reciprocity process in many states.
Ada County, Idaho
Q109820 QID OVERLAP 0.780
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (14): "ada", "boise", "capital", "district", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "roads", "second", "streets".
adaboisecapitaldistrictidahojurisdictionlocalmetropolitannorthwestpopulationprivateroadssecondstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
QID OVERLAP 0.740
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "population", "second", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalnamepopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
M
Q2097994 QID OVERLAP 0.660
QID OVERLAP: Q2097994 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (8): "body", "cities", "counties", "governing", "legal", "local", "municipal", "owned".
bodycitiescountiesgoverninglegallocalmunicipalowned
Municipal corporation is the legal term for a local governing body, including (but not necessarily limited to) cities, counties, towns, townships, charter townships, villages, and boroughs. The term can also be used to describe municipally owned corporations. Municipal corporation as local self-government Municipal incorporation occurs when such municipalities become self-governing entities under the laws of the state or province in which they are located. Often, this event is marked by the award or declaration of a municipal charter.
There are 12 city corporations in Bangladesh. Two of them are located in the capital Dhaka and the remaining 10 are located in the most populous cities of the eight divisions. They carry out major works in the cities and perform socio-economic and civic functions. In addition, there are 330 municipalities in the eight divisions of Bangladesh. A city corporation is a much stronger and larger Local governing body than a municipal corporation.
Municipal corporation as local self-government Municipal incorporation occurs when such municipalities become self-governing entities under the laws of the state or province in which they are located. Often, this event is marked by the award or declaration of a municipal charter. A city charter or town charter or municipal charter is a legal document establishing a municipality, such as a city or town. Bangladesh There are 12 city corporations in Bangladesh. Two of them are located in the capital Dhaka and the remaining 10 are located in the most populous cities of the eight divisions. They carry out major works in the cities and perform socio-economic and civic functions. In addition, there are 330 municipalities in the eight divisions of Bangladesh. A city corporation is a much stronger and larger Local governing body than a municipal corporation.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.660
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (8): "ada", "boise", "downtown", "eagle", "idaho", "miles", "northwest", "population".
adaboisedowntowneagleidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "population".
adaadditionalboiseidahokunametropolitanpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
235 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP235 edges
🌲 EVERGREEN8 edges
0.650
academicadministrationbegancaldwellclassescollegeeducationenrollmentfoundedidahomajormedicalprivateprofessionalprogramsstandardstudents
SHARED TOKENS (17): "academic", "administration", "began", "caldwell", "classes", "college", "education", "enrollment", "founded", "idaho", "major", "medical", "private", "professional", "programs", "standard", "students". | URL->B (1): http://yoteathletics.com/. | EXACT TITLE in sports_recreation: "College of Idaho".
0.650
adaadjacentbaseboisebuiltcapacitycurrentfeetfieldgeneralgroupidahoimprovementsindependentlevelopenedoutdoorparkprivatelyriver
SHARED TOKENS (24): "ada", "adjacent", "base", "boise", "built", "capacity", "current", "feet", "field", "general", "group", "idaho", "improvements", "independent", "level", "opened", "outdoor", "park", "privately", "river".... | URL->B (1): https://www.boisehawks.com/ClubInfo/memorialstadiumFAQ. | EXACT TITLE in sports_recreation: "Memorial Stadium (Boise)".
0.650
associationboiseconditionsforestidaholandmilesmountainnationaloperatedorganizationprivaterecreationroadsnowwestern
SHARED TOKENS (16): "association", "boise", "conditions", "forest", "idaho", "land", "miles", "mountain", "national", "operated", "organization", "private", "recreation", "road", "snow", "western". | URL->B (1): http://www.bogusbasin.org/. | EXACT TITLE in sports_recreation: "Bogus Basin".
0.650
acquisitionagencyboardcommissionconstructioncreatedeconomicfederalgovernmentindependentjurisdictionlinesmattersoversightpipelinesregulationregulatoryrelevantservessubject
SHARED TOKENS (24): "acquisition", "agency", "board", "commission", "construction", "created", "economic", "federal", "government", "independent", "jurisdiction", "lines", "matters", "oversight", "pipelines", "regulation", "regulatory", "relevant", "serves", "subject".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
approximatelyboisebuildingbuiltcapacitycentralcommunicationscurrentdowntownfeetidaholevelmillionopenedprofessionalrightsstreettitlewestern
SHARED TOKENS (19): "approximately", "boise", "building", "built", "capacity", "central", "communications", "current", "downtown", "feet", "idaho", "level", "million", "opened", "professional", "rights", "street", "title", "western". | URL->B (2): http://www.idahosteelheads.com/, https://idahocentralarena.com/. | EXACT TITLE in sports_recreation: "Idaho Central Arena".
0.650
acquisitionadministrationamericancommercialcostsfederalfundinggeneralgrantslandlightingmanagedplanningprogramprojectspublicrevenuesafetysignage
SHARED TOKENS (19): "acquisition", "administration", "american", "commercial", "costs", "federal", "funding", "general", "grants", "land", "lighting", "managed", "planning", "program", "projects", "public", "revenue", "safety", "signage". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
americanannouncedboisecentraldivisiondowntownexpansionidaholocalmanagementmountainnationalprimaryprofessionalwestwestern
SHARED TOKENS (16): "american", "announced", "boise", "central", "division", "downtown", "expansion", "idaho", "local", "management", "mountain", "national", "primary", "professional", "west", "western". | URL->B (1): https://idahosteelheads.com/. | EXACT TITLE in sports_recreation: "Idaho Steelheads".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamonganotherauthoritybaseboisecanyoncapacitycapitalcentercitiesconventionalcostcostsdemanddestinationdistricteagle
SHARED TOKENS (80): "ada", "additional", "agencies", "among", "another", "authority", "base", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "cost", "costs", "demand", "destination", "district", "eagle".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH187 edges
0.590
agencybegancreatedcreatingdepartmentenforcementidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (12): "agency", "began", "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.590
adaamericanboiseclassidahoindependentmajornorthwestpartnerprofessionalshortunincorporated
SHARED TOKENS (12): "ada", "american", "boise", "class", "idaho", "independent", "major", "northwest", "partner", "professional", "short", "unincorporated". | URL->B (1): http://www.boisehawks.com/. | EXACT TITLE in sports_recreation: "Boise Hawks".
0.500
YMCA ↗ Q157169 EXACT TITLE
associationbodyclassesdevelopingdevelopmentfacilitiesfoundedindependentjunelocalmillionnationalorganizationorganizationspeoplepracticeprogramsprojectsregionalstated
SHARED TOKENS (22): "association", "body", "classes", "developing", "development", "facilities", "founded", "independent", "june", "local", "million", "national", "organization", "organizations", "people", "practice", "programs", "projects", "regional", "stated".... | EXACT TITLE in sports_recreation: "YMCA".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionfeatureslandlocalpathsplaceprimarilyprimaryprivatepublicroadroadsroutesidewalksstreetstreetstraffic
SHARED TOKENS (22): "access", "another", "design", "distinction", "features", "land", "local", "paths", "place", "primarily", "primary", "private", "public", "road", "roads", "route", "sidewalks", "street", "streets", "traffic".... | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in sports_recreation: "Road".
0.500
acresactagenciesagencyamericanamongapproximatelycreateddepartmentdescribedestateexistingfederalgeneralgovernmenthealthidaholandlandscapemanagement
SHARED TOKENS (34): "acres", "act", "agencies", "agency", "american", "among", "approximately", "created", "department", "described", "estate", "existing", "federal", "general", "government", "health", "idaho", "land", "landscape", "management".... | EXACT TITLE in sports_recreation: "Bureau of Land Management".
0.500
assetbuildingbuildingsbuiltconstructioncontributesdesigndevelopmenteconomicequivalentexpandextendfacilitiesinfrastructuremaintenanceplanningprocesswork
SHARED TOKENS (18): "asset", "building", "buildings", "built", "construction", "contributes", "design", "development", "economic", "equivalent", "expand", "extend", "facilities", "infrastructure", "maintenance", "planning", "process", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in sports_recreation: "Construction".
0.500
Stadium ↗ Q483110 EXACT TITLE
associationcapacitycodeseventeventsfeaturesfieldlargemanagementoutdoorplacestructuresystemsviewwaste
SHARED TOKENS (15): "association", "capacity", "codes", "event", "events", "features", "field", "large", "management", "outdoor", "place", "structure", "systems", "view", "waste". | EXACT TITLE in sports_recreation: "Stadium".
0.500
Culvert ↗ Q4168092 EXACT TITLE
drainageembeddedfrequentlyitselfmaterialpedestrianperformanceplacingpracticeprocessrequirementsroadroadsselectionshapestructuresurfacetrafficvehiclewater
SHARED TOKENS (20): "drainage", "embedded", "frequently", "itself", "material", "pedestrian", "performance", "placing", "practice", "process", "requirements", "road", "roads", "selection", "shape", "structure", "surface", "traffic", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelyboisecapitalcontainsdistincteconomyforestidaholandlinkedmilesmillionmountainnationalnorthwestofficialpeoplepopulationrestrictedriver
SHARED TOKENS (29): "approximately", "boise", "capital", "contains", "distinct", "economy", "forest", "idaho", "land", "linked", "miles", "million", "mountain", "national", "northwest", "official", "people", "population", "restricted", "river".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in sports_recreation: "Idaho".
0.500
americanamongboisechaindivisionfieldfoundedhighhistoryidaholocalopenedoutdoorparkrightsschoolschoolssubdivisionsurfacetrack
SHARED TOKENS (22): "american", "among", "boise", "chain", "division", "field", "founded", "high", "history", "idaho", "local", "opened", "outdoor", "park", "rights", "school", "schools", "subdivision", "surface", "track".... | EXACT TITLE in sports_recreation: "Albertsons Stadium".
0.500
announcedbusinessdevelopmentdisabilitieseventeventsformationgovernmentjunelocalmajormillionnationalorganizationparticipationpartnerspeoplerecurringregionaltraining
SHARED TOKENS (22): "announced", "business", "development", "disabilities", "event", "events", "formation", "government", "june", "local", "major", "million", "national", "organization", "participation", "partners", "people", "recurring", "regional", "training".... | EXACT TITLE in sports_recreation: "Special Olympics".
0.500
associationcorridorscreatedenvironmentalfrequentlylandlandscapemobilitymultipleparkparkspeoplerecreationalrightsserveservessurfaceurbanusersutility
SHARED TOKENS (20): "association", "corridors", "created", "environmental", "frequently", "land", "landscape", "mobility", "multiple", "park", "parks", "people", "recreational", "rights", "serve", "serves", "surface", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
canyoncivilconstructionemergencygeneralidahomissionmountainmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (17): "canyon", "civil", "construction", "emergency", "general", "idaho", "mission", "mountain", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
applicationbodybrandbuildingbusinesscorporatedesigndevelopmentdifferentemergencyenvironmenteventeventsformalfrequentlyidentifyingknowledgemanagementmarketmarketing
SHARED TOKENS (38): "application", "body", "brand", "building", "business", "corporate", "design", "development", "different", "emergency", "environment", "event", "events", "formal", "frequently", "identifying", "knowledge", "management", "market", "marketing".... | EXACT TITLE in transportation_infrastructure: "Event management".
0.500
associationboardbodycompetitivecurrentdedicateddevelopmenteducationgoverninggrowthmediamembershipnonprofitorganizationprofessionalpublicrulesstandards
SHARED TOKENS (18): "association", "board", "body", "competitive", "current", "dedicated", "development", "education", "governing", "growth", "media", "membership", "nonprofit", "organization", "professional", "public", "rules", "standards". | EXACT TITLE in sports_recreation: "Professional Disc Golf Association".
0.500
administrationauthoritycareclinicaleducationfunctionhealthhealthcaremanagementmedicalphysicalpracticeprimaryprivateprovidepublicresearchwomen
SHARED TOKENS (18): "administration", "authority", "care", "clinical", "education", "function", "health", "healthcare", "management", "medical", "physical", "practice", "primary", "private", "provide", "public", "research", "women". | EXACT TITLE in sports_recreation: "Physical therapy".
0.500
buildingcentercenterscommercialconsumersdedicateddeliverydemanddestinationsdirectlydistributionequipmentfacilityfirmsfunctioninventorylaborlargemarketname
SHARED TOKENS (35): "building", "center", "centers", "commercial", "consumers", "dedicated", "delivery", "demand", "destinations", "directly", "distribution", "equipment", "facility", "firms", "function", "inventory", "labor", "large", "market", "name".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
adaboisecanyoncitiescombinedcountiesidaholargermeridianmetropolitanmountainnampanorthwestpopulationsectiontreasurevalleywider
SHARED TOKENS (18): "ada", "boise", "canyon", "cities", "combined", "counties", "idaho", "larger", "meridian", "metropolitan", "mountain", "nampa", "northwest", "population", "section", "treasure", "valley", "wider". | EXACT TITLE in sports_recreation: "Boise metropolitan area".
0.500
Lacrosse ↗ Q185851 EXACT TITLE
americanbodycontactcreatecurrentdifferentequipmenteventeventsfieldformgovernedorganizationoutdoorpeopleprofessionalrulesuseswomen
SHARED TOKENS (19): "american", "body", "contact", "create", "current", "different", "equipment", "event", "events", "field", "form", "governed", "organization", "outdoor", "people", "professional", "rules", "uses", "women". | EXACT TITLE in sports_recreation: "Lacrosse".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingbuildingsdeterminedevelopeddevelopmentdifferentformgoverngovernmentgrowthguidelineslandland-uselocalpermissionplacesplanningpolicypropertyregulations
SHARED TOKENS (29): "building", "buildings", "determine", "developed", "development", "different", "form", "govern", "government", "growth", "guidelines", "land", "land-use", "local", "permission", "places", "planning", "policy", "property", "regulations".... | EXACT TITLE in transportation_infrastructure: "Zoning".
0.500
accessactcomprehensivecontinuingcreatedexistingfederalformationfundinggovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplanspopulationprocess
SHARED TOKENS (26): "access", "act", "comprehensive", "continuing", "created", "existing", "federal", "formation", "funding", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans", "population", "process".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Broadband ↗ Q194163 EXACT TITLE
accessdatadifferentdigitalfasterfrequencyhighimplementationlevelnetworkplannedproviderequirementstechnologytransferuses
SHARED TOKENS (16): "access", "data", "different", "digital", "faster", "frequency", "high", "implementation", "level", "network", "planned", "provide", "requirements", "technology", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
broadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualinfrastructurelandland-uselargerlawslevelmanagemanagementnationalneedsnetwork
SHARED TOKENS (35): "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "infrastructure", "land", "land-use", "larger", "laws", "level", "manage", "management", "national", "needs", "network".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
Urban park ↗ Q22746 EXACT TITLE
agenciesamongbudgetcitiesdesignfacilitiesfeaturesfitnessgardengovernmentgroupindividuallandlevellocalmaintenancemetropolitanmultiplemunicipalopen
SHARED TOKENS (32): "agencies", "among", "budget", "cities", "design", "facilities", "features", "fitness", "garden", "government", "group", "individual", "land", "level", "local", "maintenance", "metropolitan", "multiple", "municipal", "open".... | EXACT TITLE in sports_recreation: "Urban park".
0.500
accessagenciesbridgesclimatecommunityconditionsconnectivitycreateddevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirms
SHARED TOKENS (51): "access", "agencies", "bridges", "climate", "community", "conditions", "connectivity", "created", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in sports_recreation: "Infrastructure".
0.500
Trail ↗ Q628179 EXACT TITLE
appliedcommunitieshistoricallyintendedmotorizedpedestrianplacesrestrictedroadroutesharedterritorythoughtracktrailtravelvehicles
SHARED TOKENS (17): "applied", "communities", "historically", "intended", "motorized", "pedestrian", "places", "restricted", "road", "route", "shared", "territory", "though", "track", "trail", "travel", "vehicles". | EXACT TITLE in transportation_infrastructure: "Trail". | EXACT TITLE in sports_recreation: "Trail".
0.500
Kinesiology ↗ Q657632 EXACT TITLE
acquisitionactivityaddressesapplicationsbodycontrolfunctionhealthmeasuresmotionmotoroccupationalphysicalrehabilitationresearchstudysystems
SHARED TOKENS (17): "acquisition", "activity", "addresses", "applications", "body", "control", "function", "health", "measures", "motion", "motor", "occupational", "physical", "rehabilitation", "research", "study", "systems". | EXACT TITLE in sports_recreation: "Kinesiology".
0.500
State park ↗ EXACT TITLE
administrationentitiesequivalentestablishedfederalgeneralgovernmenthistorylevellocalmanagednationalopportunitiesparkparkspotentialprogramsratherrecreationalregional
SHARED TOKENS (27): "administration", "entities", "equivalent", "established", "federal", "general", "government", "history", "level", "local", "managed", "national", "opportunities", "park", "parks", "potential", "programs", "rather", "recreational", "regional".... | EXACT TITLE in sports_recreation: "State park".
0.500
accessactivitycitiescollectivelycompletedcreatedcyclingdemandenvironmentfacilitiesfreegeneralindividualoutdoorparksphysicalpopulationratherrecreationrecreational
SHARED TOKENS (23): "access", "activity", "cities", "collectively", "completed", "created", "cycling", "demand", "environment", "facilities", "free", "general", "individual", "outdoor", "parks", "physical", "population", "rather", "recreation", "recreational".... | EXACT TITLE in sports_recreation: "Outdoor recreation".
0.500
annuallyclimateconcentratedconsumptiondemographicdevelopeddevelopmentdirectenvironmentenvironmentalfreegroupgrowinggrowthhighincreaseindividualindividualsmedicalmillion
SHARED TOKENS (32): "annually", "climate", "concentrated", "consumption", "demographic", "developed", "development", "direct", "environment", "environmental", "free", "group", "growing", "growth", "high", "increase", "individual", "individuals", "medical", "million".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in sports_recreation: "Population growth".
0.500
Tennis ↗ Q847 EXACT TITLE
competitiveconnectionsdevelopedfieldformlevellineolderopenpeopleprofessionalrealrecreationalreturnreviewrulessinglesystemtechnologyusers
SHARED TOKENS (21): "competitive", "connections", "developed", "field", "form", "level", "line", "older", "open", "people", "professional", "real", "recreational", "return", "review", "rules", "single", "system", "technology", "users".... | EXACT TITLE in sports_recreation: "Tennis".
0.500
ageamongassociationbodiesconditiondevelopmenteducationeventexistencegoverninginformationlevellocalmultiplenationalneededparticipatingpolicyprimarypublic
SHARED TOKENS (29): "age", "among", "association", "bodies", "condition", "development", "education", "event", "existence", "governing", "information", "level", "local", "multiple", "national", "needed", "participating", "policy", "primary", "public".... | EXACT TITLE in sports_recreation: "Youth sports".
0.500
certificationcompletecontinuedemployerextendfieldformallaborlevellicensemasterpeoplepotentialpracticepractitionersprofessionalregulatedstudysystemtraining
SHARED TOKENS (20): "certification", "complete", "continued", "employer", "extend", "field", "formal", "labor", "level", "license", "master", "people", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmenteconomiceconomicsfrequentlygrowthhistoricallyincreasesindividualinfrastructurelocalmarketobjectivespeoplepoliciespolicyprocessquality
SHARED TOKENS (22): "according", "community", "describes", "development", "economic", "economics", "frequently", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "objectives", "people", "policies", "policy", "process", "quality".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
chaincomplexconsumerconsumersconvertcreatingcustomersdirectdirectlydistributionfacilitiesindependentlinkedmanagementmaterialsnetworkstructuresupplysystemsystems
SHARED TOKENS (22): "chain", "complex", "consumer", "consumers", "convert", "creating", "customers", "direct", "directly", "distribution", "facilities", "independent", "linked", "management", "materials", "network", "structure", "supply", "system", "systems".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalgovernmentorganizationpersonnelregulatesspacestandardssurroundingtraffictransportation
SHARED TOKENS (21): "administration", "agency", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "government", "organization", "personnel", "regulates", "space", "standards", "surrounding", "traffic", "transportation".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
beyondboiseconnectsdedicatedeagleextendsgreenbeltidahomeasuresmilesmotorizedmunicipalitiesparkspathspermitrecreationalresidentialriverroadroutes
SHARED TOKENS (29): "beyond", "boise", "connects", "dedicated", "eagle", "extends", "greenbelt", "idaho", "measures", "miles", "motorized", "municipalities", "parks", "paths", "permit", "recreational", "residential", "river", "road", "routes".... | EXACT TITLE in transportation_infrastructure: "Boise River Greenbelt". | EXACT TITLE in sports_recreation: "Boise River Greenbelt".
0.500
acquiredadvertisingagencybranddepartmentdifferententityeventfacilitiesfacilityfieldforminsurancelegalmajornameorganizationparkprofessionalprogram
SHARED TOKENS (26): "acquired", "advertising", "agency", "brand", "department", "different", "entity", "event", "facilities", "facility", "field", "form", "insurance", "legal", "major", "name", "organization", "park", "professional", "program".... | EXACT TITLE in sports_recreation: "Naming rights".
0.500
acquiredadditionalbranddestinationsextendsformformationhistoryindependentlinesmajornetworkoperatesoperatingprincipalregionalroutestar
SHARED TOKENS (18): "acquired", "additional", "brand", "destinations", "extends", "form", "formation", "history", "independent", "lines", "major", "network", "operates", "operating", "principal", "regional", "route", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Basketball ↗ Q5372 EXACT TITLE
additionalamericananotherassociationcentercollectcollegecompetedivisioneventsfieldfreelevellinemajornationalplanpointspowerprimary
SHARED TOKENS (29): "additional", "american", "another", "association", "center", "collect", "college", "compete", "division", "events", "field", "free", "level", "line", "major", "national", "plan", "points", "power", "primary".... | EXACT TITLE in sports_recreation: "Basketball".
0.500
Golf ↗ Q5377 EXACT TITLE
amongcannotcompletecontainingcreateddifferentforestindividuallandscapelevellinksmajoropenprofessionalstandardstandardizedwater
SHARED TOKENS (17): "among", "cannot", "complete", "containing", "created", "different", "forest", "individual", "landscape", "level", "links", "major", "open", "professional", "standard", "standardized", "water". | EXACT TITLE in sports_recreation: "Golf".
0.500
Kickboxing ↗ Q178678 EXACT TITLE
americanamongassociationbodiesbodycontactdevelopeddifferentdocumentationfeetfitnessfullgeneralgoverninghistoricallyindividualinfluencelevelnetworkofficial
SHARED TOKENS (26): "american", "among", "association", "bodies", "body", "contact", "developed", "different", "documentation", "feet", "fitness", "full", "general", "governing", "historically", "individual", "influence", "level", "network", "official".... | EXACT TITLE in sports_recreation: "Kickboxing".
0.500
americanassociationcategorychangescreatedcurrentdepartmenteventsfeaturesgovernmentlistslocalmajorparksperformanceplannersreceivingrecreationresponsereviews
SHARED TOKENS (23): "american", "association", "category", "changes", "created", "current", "department", "events", "features", "government", "lists", "local", "major", "parks", "performance", "planners", "receiving", "recreation", "response", "reviews".... | EXACT TITLE in sports_recreation: "Parks and Recreation".
0.500
administrationagencyapproximatelyauthoritybudgetcombinedconnectingcreateddatadepartmentenforcementfacilitiesfederalgovernmentidentificationlawlocalmissionoperatedpartners
SHARED TOKENS (38): "administration", "agency", "approximately", "authority", "budget", "combined", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "government", "identification", "law", "local", "mission", "operated", "partners".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincivilcollectionconsumptioncostscustomersdedicatedequipmentfacilityfieldfoodinformationlinesmanagedmanagementmaterialmaterialsmodel
SHARED TOKENS (33): "according", "another", "chain", "civil", "collection", "consumption", "costs", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "lines", "managed", "management", "material", "materials", "model".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencydepartmentdistrictexistingfederalfunctionsgovernmentgrantslocaloperateoperatorspeopleprimarilyprogramsproviderspublicregionalrequirements
SHARED TOKENS (27): "administration", "agencies", "agency", "department", "district", "existing", "federal", "functions", "government", "grants", "local", "operate", "operators", "people", "primarily", "programs", "providers", "public", "regional", "requirements".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbodybridgesbroaderbuildingscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthabitathealthinfrastructure
SHARED TOKENS (38): "assets", "body", "bridges", "broader", "buildings", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "habitat", "health", "infrastructure".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Swimming ↗ Q6388 EXACT TITLE
amongbodyconsumptionenvironmentequipmentfacilitiesfitnesshealthlevellocalmotionmovenationalpeopleperformanceplacepotentialpublicrecreationrecreational
SHARED TOKENS (26): "among", "body", "consumption", "environment", "equipment", "facilities", "fitness", "health", "level", "local", "motion", "move", "national", "people", "performance", "place", "potential", "public", "recreation", "recreational".... | EXACT TITLE in sports_recreation: "Swimming".
0.500
additionalanotherbusinesschangesdevelopeddifferenteventformincreaseindividualinfluencemultipleplaceprofessionalrealregulationsreviewrulessafetystreet
SHARED TOKENS (21): "additional", "another", "business", "changes", "developed", "different", "event", "form", "increase", "individual", "influence", "multiple", "place", "professional", "real", "regulations", "review", "rules", "safety", "street".... | EXACT TITLE in sports_recreation: "Mixed martial arts".
0.500
Hunting ↗ Q36963 EXACT TITLE
acquisitionbodycapacitycollectioncontroldistinguishembeddedenvironmentevenfoodformfundinglawlawfulmaintenancemanagemanagementmeansparksparticipating
SHARED TOKENS (37): "acquisition", "body", "capacity", "collection", "control", "distinguish", "embedded", "environment", "even", "food", "form", "funding", "law", "lawful", "maintenance", "manage", "management", "means", "parks", "participating".... | EXACT TITLE in sports_recreation: "Hunting".
0.500
Pickleball ↗ Q866224 EXACT TITLE
abilityaccordingassociationdevelopedestablishedfitnessgrowinggrowthhighincreaselinesmillionnorthwestofficialoperatingproducesprofessionalreportreturnrule
SHARED TOKENS (23): "ability", "according", "association", "developed", "established", "fitness", "growing", "growth", "high", "increase", "lines", "million", "northwest", "official", "operating", "produces", "professional", "report", "return", "rule".... | EXACT TITLE in sports_recreation: "Pickleball".
0.500
americanassociationbodybroadercombineddifferenteventeventsfieldgoverninghighindividuallongnamenationalpeopleplacerecordsregulationsroad
SHARED TOKENS (26): "american", "association", "body", "broader", "combined", "different", "event", "events", "field", "governing", "high", "individual", "long", "name", "national", "people", "place", "records", "regulations", "road".... | EXACT TITLE in sports_recreation: "Track and field".
0.500
accessassociationcompetitivecontractingcoordinationcorridorscostsdevelopmenteconomicestatefrequentlyfundinggeneralgovernmenthistoricalinfrastructureintendedinvestmentlocalmodel
SHARED TOKENS (52): "access", "association", "competitive", "contracting", "coordination", "corridors", "costs", "development", "economic", "estate", "frequently", "funding", "general", "government", "historical", "infrastructure", "intended", "investment", "local", "model".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
appliedconstructioncontroldescribedequipmentfrequentlyfunctionsinformationinvolvinglaborlargemotionoperationspeoplepowerprimarysourcestructuresystemstrain
SHARED TOKENS (22): "applied", "construction", "control", "described", "equipment", "frequently", "functions", "information", "involving", "labor", "large", "motion", "operations", "people", "power", "primary", "source", "structure", "systems", "train".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americancitiescreatinghistoricallymobilitymotornetworkpathspedestrianpeopleprofessionalrecordroadssafetyshortsidewalksstreetstrafficurbanvehicles
SHARED TOKENS (22): "american", "cities", "creating", "historically", "mobility", "motor", "network", "paths", "pedestrian", "people", "professional", "record", "roads", "safety", "short", "sidewalks", "streets", "traffic", "urban", "vehicles".... | EXACT TITLE in transportation_infrastructure: "Pedestrian". | EXACT TITLE in sports_recreation: "Pedestrian".
0.500
acresboisecontainscontinuedcoveringcreateddistrictsfacilitiesfeetforestidaholandmanagedmilesmotorizedmountainmultiplenationalpeoplepopulations
SHARED TOKENS (26): "acres", "boise", "contains", "continued", "covering", "created", "districts", "facilities", "feet", "forest", "idaho", "land", "managed", "miles", "motorized", "mountain", "multiple", "national", "people", "populations".... | EXACT TITLE in sports_recreation: "Boise National Forest".
0.500
departmentfacilitiesfederalidentifiedindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningroadssafetyservingstrategicsystemtransportation
SHARED TOKENS (19): "department", "facilities", "federal", "identified", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "roads", "safety", "serving", "strategic", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingamericanauthoritybegancitiescivilconcentratedcountiesdifferentdistrictdistrictsentitiesequivalentexistingformformergovernmentindependentlawlegally
SHARED TOKENS (36): "according", "american", "authority", "began", "cities", "civil", "concentrated", "counties", "different", "district", "districts", "entities", "equivalent", "existing", "form", "former", "government", "independent", "law", "legally".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in sports_recreation: "County (United States)".
0.500
Baseball ↗ Q5369 EXACT TITLE
americanbasecentralcivildevelopedfieldhistorylegallylevelmajornationalolderplacepointsprofessionalreceiverecordsregulationssimilarlysource
SHARED TOKENS (25): "american", "base", "central", "civil", "developed", "field", "history", "legally", "level", "major", "national", "older", "place", "points", "professional", "receive", "records", "regulations", "similarly", "source".... | EXACT TITLE in sports_recreation: "Baseball".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilcommunicationsconstructiondevelopmentdigitalengineeringenvironmentequipmentestablishfeaturesgovernmenthistorylandlawlegalmapsownershipplanningpoints
SHARED TOKENS (29): "analysis", "civil", "communications", "construction", "development", "digital", "engineering", "environment", "equipment", "establish", "features", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "points".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Concussion ↗ Q326921 EXACT TITLE
affectsamonganotherbicyclebodychangesconditionconditionscontactdirectdisabilityevidencehistoryincreaseinformationlevelmedicalmotorpeoplephysical
SHARED TOKENS (40): "affects", "among", "another", "bicycle", "body", "changes", "condition", "conditions", "contact", "direct", "disability", "evidence", "history", "increase", "information", "level", "medical", "motor", "people", "physical".... | EXACT TITLE in sports_recreation: "Concussion".
0.500
adabaseboisecentercombinedcommercialcommissiondepartmentdowntownfacilityfieldforestfunctionsgeneralidahoincreaseinteragencymilesmillionnational
SHARED TOKENS (29): "ada", "base", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "facility", "field", "forest", "functions", "general", "idaho", "increase", "interagency", "miles", "million", "national".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
associationdistinguishenvironmentgeneralgovernedincreaselandscapelargemountainmoveoutdoorperformanceplaceprimaryroadsignificanttracktrail
SHARED TOKENS (18): "association", "distinguish", "environment", "general", "governed", "increase", "landscape", "large", "mountain", "move", "outdoor", "performance", "place", "primary", "road", "significant", "track", "trail". | EXACT TITLE in sports_recreation: "Trail running".
0.500
actadministrationagenciesagencycivilcorridorcreateddepartmentdevelopmentfederalgovernmentmanagementnationaloperatespolicyprogramsprovidepublicregulationsrehabilitation
SHARED TOKENS (25): "act", "administration", "agencies", "agency", "civil", "corridor", "created", "department", "development", "federal", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "rehabilitation".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingadministeredagencychangescontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninginvolvinglawlawsmajornameowned
SHARED TOKENS (34): "act", "addressing", "administered", "agency", "changes", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "involving", "law", "laws", "major", "name", "owned".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
bridgebridgesbuiltcommunitycomplexconnectingconnectionconstructedconstructioncreatedesignengineeringengineersenvironmentfrequentlyintendedlocalmajormilesnetwork
SHARED TOKENS (37): "bridge", "bridges", "built", "community", "complex", "connecting", "connection", "constructed", "construction", "create", "design", "engineering", "engineers", "environment", "frequently", "intended", "local", "major", "miles", "network".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in sports_recreation: "Bridge".
0.500
appliedauthoritybecomesbeganbodiesbuildingbuildingscodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictelectricalengineersenvironmentalestate
SHARED TOKENS (51): "applied", "authority", "becomes", "began", "bodies", "building", "buildings", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "electrical", "engineers", "environmental", "estate".... | EXACT TITLE in sports_recreation: "Building code".
0.500
Softball ↗ Q171038 EXACT TITLE
accessibleagedependsequipmentfasterfeetfieldhighitselflargerlevelmakingmilesmotionpeopleprimaryprofessionalrecreationalreturnrules
SHARED TOKENS (24): "accessible", "age", "depends", "equipment", "faster", "feet", "field", "high", "itself", "larger", "level", "making", "miles", "motion", "people", "primary", "professional", "recreational", "return", "rules".... | EXACT TITLE in sports_recreation: "Softball".
0.500
Irrigation ↗ Q11453 EXACT TITLE
applicationappliescentralchangescollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddistributiondrainageenvironmentalfieldformfullgrowthhigh
SHARED TOKENS (43): "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "distribution", "drainage", "environmental", "field", "form", "full", "growth", "high".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in sports_recreation: "Irrigation".
0.500
abilityaffectsagencyagreementapproximatelyauthoritybodybusinessescapableconstructioncontractsdirecteconomiceconomygovernmentgroupgrowthlawslocalnonprofit
SHARED TOKENS (39): "ability", "affects", "agency", "agreement", "approximately", "authority", "body", "businesses", "capable", "construction", "contracts", "direct", "economic", "economy", "government", "group", "growth", "laws", "local", "nonprofit".... | EXACT TITLE in sports_recreation: "Government procurement".
0.500
accessbegancommunicationsdatadevelopersdevelopmentdigitalelectricalforestformindependentindividualinformationmeansmediaphysicalpowersingletechnologyusers
SHARED TOKENS (20): "access", "began", "communications", "data", "developers", "development", "digital", "electrical", "forest", "form", "independent", "individual", "information", "means", "media", "physical", "power", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
additionalannuallybeganbuiltcurrentdivisionestablishedfreelevelmarketsnationalnationallyoperatespathwayplacesplannedpremierprimarilyprofessionalsystem
SHARED TOKENS (21): "additional", "annually", "began", "built", "current", "division", "established", "free", "level", "markets", "national", "nationally", "operates", "pathway", "places", "planned", "premier", "primarily", "professional", "system".... | EXACT TITLE in sports_recreation: "USL Super League".
0.500
amongannualcapacityconditionscontrolenvironmentalhighirrigationlandmakingmanagementpeoplephysicalpopulationpopulationsprocessproducerecreational
SHARED TOKENS (18): "among", "annual", "capacity", "conditions", "control", "environmental", "high", "irrigation", "land", "making", "management", "people", "physical", "population", "populations", "process", "produce", "recreational". | EXACT TITLE in sports_recreation: "Wildlife management".
0.500
activebusinesscapitalcategorychangescontroldescribeddevelopmentexpansionfinancefirmsgeneralinvestmentlong-termmanagementoperationalownershippartnershipsprivateprivate-equity
SHARED TOKENS (26): "active", "business", "capital", "category", "changes", "control", "described", "development", "expansion", "finance", "firms", "general", "investment", "long-term", "management", "operational", "ownership", "partnerships", "private", "private-equity".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
approximatelyboisecapacitycommunitycurrenteventsfeetidaholevelnorthwestshowsspaceuniversitywestwestern
SHARED TOKENS (15): "approximately", "boise", "capacity", "community", "current", "events", "feet", "idaho", "level", "northwest", "shows", "space", "university", "west", "western". | EXACT TITLE in sports_recreation: "ExtraMile Arena".
0.500
agenciesbridgesbuildingsbuiltcivilconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalpipelines
SHARED TOKENS (27): "agencies", "bridges", "buildings", "built", "civil", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "pipelines".... | EXACT TITLE in transportation_infrastructure: "Civil engineering". | EXACT TITLE in sports_recreation: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyboardbusinesscorridordirectlyfederalfoundedlinesmanagedmetropolitanmilesmillionnationalnetworkoperateoperatesoperatororganization
SHARED TOKENS (30): "additional", "american", "approximately", "board", "business", "corridor", "directly", "federal", "founded", "lines", "managed", "metropolitan", "miles", "million", "national", "network", "operate", "operates", "operator", "organization".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicadaboardboisecanyonclassescollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprograms
SHARED TOKENS (30): "academic", "ada", "board", "boise", "canyon", "classes", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in sports_recreation: "College of Western Idaho".
0.500
activityboardcompetitiveconditionsdevelopeddistinctequipmentfeaturesfeetinvolvingparticipationrecreationalsinglesnowspecializedsurfacewinter
SHARED TOKENS (17): "activity", "board", "competitive", "conditions", "developed", "distinct", "equipment", "features", "feet", "involving", "participation", "recreational", "single", "snow", "specialized", "surface", "winter". | EXACT TITLE in sports_recreation: "Snowboarding".
0.500
accessibleadvancedadvertisingbuildingsdesignfeesgeneralgovernmentjointlylandscapelargerlegallimitsopenoutdoorownedownersownershipparksparticipation
SHARED TOKENS (38): "accessible", "advanced", "advertising", "buildings", "design", "fees", "general", "government", "jointly", "landscape", "larger", "legal", "limits", "open", "outdoor", "owned", "owners", "ownership", "parks", "participation".... | EXACT TITLE in transportation_infrastructure: "Public space".
0.500
administrationamericananalysisassociationcareconditionsemergencyhealthhealthcaremedicaloperatingplacespracticeprofessionalprogramsrehabilitationresponsibilityschoolstrainingtreatment
SHARED TOKENS (21): "administration", "american", "analysis", "association", "care", "conditions", "emergency", "health", "healthcare", "medical", "operating", "places", "practice", "professional", "programs", "rehabilitation", "responsibility", "schools", "training", "treatment".... | EXACT TITLE in sports_recreation: "Athletic training".
0.500
agenciesbusinessescomprehensivedesigndestinationsfacilitiesgovernmentinfluencelinesmoveneedspeopleplannersplanningpoliciesprivateprocesspublicstreetssystem
SHARED TOKENS (21): "agencies", "businesses", "comprehensive", "design", "destinations", "facilities", "government", "influence", "lines", "move", "needs", "people", "planners", "planning", "policies", "private", "process", "public", "streets", "system".... | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
activeactivityadministrationagenciesamericanamongassociationboardcarecenterscertificationcommunitycomprehensiveconditionscontroldepartmentdisabilitieseducationemergencyemerging
SHARED TOKENS (60): "active", "activity", "administration", "agencies", "american", "among", "association", "board", "care", "centers", "certification", "community", "comprehensive", "conditions", "control", "department", "disabilities", "education", "emergency", "emerging".... | EXACT TITLE in sports_recreation: "Athletic trainer".
0.500
accessagenciesbeyondcitiescommunitycustomersdestinationdevelopeddevelopingdisabilitieseconomicextendsformformalgovernmentincomelocalmetropolitanmobilityoperate
SHARED TOKENS (40): "access", "agencies", "beyond", "cities", "community", "customers", "destination", "developed", "developing", "disabilities", "economic", "extends", "form", "formal", "government", "income", "local", "metropolitan", "mobility", "operate".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
caredistinctfieldfitnesshealthmedicalphysicalpractitionersprimaryscopestandardstrainingtreatmentwork
SHARED TOKENS (14): "care", "distinct", "field", "fitness", "health", "medical", "physical", "practitioners", "primary", "scope", "standards", "training", "treatment", "work". | EXACT TITLE in sports_recreation: "Sports medicine".
0.480
Volleyball ↗ Q1734 EXACT TITLE
americanbodycommunitieseducationestablishedgoverninghistoryinclusionintendedofficialphysicalpointsprogramrules
SHARED TOKENS (14): "american", "body", "communities", "education", "established", "governing", "history", "inclusion", "intended", "official", "physical", "points", "program", "rules". | EXACT TITLE in sports_recreation: "Volleyball".
0.480
bridgescontrolsdesigndifferentmajorpracticeprimarilyreflectsroadroadsseparatetrafficusesvehicles
SHARED TOKENS (14): "bridges", "controls", "design", "different", "major", "practice", "primarily", "reflects", "road", "roads", "separate", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.480
collectivelycommercialequipmentevenfoodformfrequentlylargelineoccupationalpracticesrecreationaluseswater
SHARED TOKENS (14): "collectively", "commercial", "equipment", "even", "food", "form", "frequently", "large", "line", "occupational", "practices", "recreational", "uses", "water". | EXACT TITLE in sports_recreation: "Recreational fishing".
0.480
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericanbuildingslandmobilitymotorpedestrianprimarilyprivateroadsidesidewalksstreetvehicle
SHARED TOKENS (14): "adjacent", "american", "buildings", "land", "mobility", "motor", "pedestrian", "primarily", "private", "road", "side", "sidewalks", "street", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk". | EXACT TITLE in sports_recreation: "Sidewalk".
0.480
ECHL ↗ Q182010 EXACT TITLE
agreementagreementsamericanassociationdevelopmentfranchiseitselfmeaningnationaloctoberprofessionalreportservessystem
SHARED TOKENS (14): "agreement", "agreements", "american", "association", "development", "franchise", "itself", "meaning", "national", "october", "professional", "report", "serves", "system". | EXACT TITLE in sports_recreation: "ECHL".
0.460
Boxing ↗ Q32112 EXACT TITLE
completeequipmentevidencegovernedhistorylocalplacerulesstandardsubsequentlysystemstechnicalwestern
SHARED TOKENS (13): "complete", "equipment", "evidence", "governed", "history", "local", "place", "rules", "standard", "subsequently", "systems", "technical", "western". | EXACT TITLE in sports_recreation: "Boxing".
0.460
Cheerleading ↗ Q61391 EXACT TITLE
activityamericanassociationeventformlevelmajormeansmillionphysicalpracticeshowstudy
SHARED TOKENS (13): "activity", "american", "association", "event", "form", "level", "major", "means", "million", "physical", "practice", "show", "study". | EXACT TITLE in sports_recreation: "Cheerleading".
0.460
Gymnastics ↗ Q43450 EXACT TITLE
bodycompetitivecoordinationdevelopmentdifferenteventsformgovernedgoverninggroupphysicalrequiringwomen
SHARED TOKENS (13): "body", "competitive", "coordination", "development", "different", "events", "form", "governed", "governing", "group", "physical", "requiring", "women". | EXACT TITLE in sports_recreation: "Gymnastics".
0.460
americanfieldpermitroadroadsroutesstandardstreetssurfacesystemthoughtrafficuses
SHARED TOKENS (13): "american", "field", "permit", "road", "roads", "routes", "standard", "streets", "surface", "system", "though", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in sports_recreation: "Interchange (road)".
0.460
Futsal ↗ Q171401 EXACT TITLE
associationbeyondcontrolfeetlawslinelinesmeansprimarilyprofessionalrecreationalrulessurface
SHARED TOKENS (13): "association", "beyond", "control", "feet", "laws", "line", "lines", "means", "primarily", "professional", "recreational", "rules", "surface". | EXACT TITLE in sports_recreation: "Futsal".
0.460
Warehouse ↗ Q181623 EXACT TITLE
buildingbuildingsbusinessescitiesdirectlyefficientlyfacilityfunctionlargematerialsparksproductionstandard
SHARED TOKENS (13): "building", "buildings", "businesses", "cities", "directly", "efficiently", "facility", "function", "large", "materials", "parks", "production", "standard". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.460
Lifeguard ↗ Q259327 EXACT TITLE
communitiesemergencyequipmentfunctionparkpoolprimaryproviderrequirementsriversafetysystemwater
SHARED TOKENS (13): "communities", "emergency", "equipment", "function", "park", "pool", "primary", "provider", "requirements", "river", "safety", "system", "water". | EXACT TITLE in sports_recreation: "Lifeguard".
0.460
administrationagencydepartmentdivisionfederalmajorprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (13): "administration", "agency", "department", "division", "federal", "major", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.450
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | URL->B (1): https://nnusports.com/. | EXACT TITLE in sports_recreation: "Northwest Nazarene University".
0.440
Triathlon ↗ Q10980 EXACT TITLE
competecontinuouscreatedcyclingdevelopedgeneralhistoryindividualsnamerequirestraintraining
SHARED TOKENS (12): "compete", "continuous", "created", "cycling", "developed", "general", "history", "individuals", "name", "requires", "train", "training". | EXACT TITLE in sports_recreation: "Triathlon".
0.440
Snowplow ↗ Q14976 EXACT TITLE
frequentlyintendedlargeoutdoorreceiveservingsnowstreetstransportationvehiclevehicleswinter
SHARED TOKENS (12): "frequently", "intended", "large", "outdoor", "receive", "serving", "snow", "streets", "transportation", "vehicle", "vehicles", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.420
agencydepartmentgovernmentidahomanagesparksprogramsrecreationregistrationstate-levelvehicles
SHARED TOKENS (11): "agency", "department", "government", "idaho", "manages", "parks", "programs", "recreation", "registration", "state-level", "vehicles". | EXACT TITLE in sports_recreation: "Idaho Department of Parks and Recreation".
0.420
Disc golf ↗ Q876737 EXACT TITLE
accessibleaccordingassociationcompletedifferentdirectoryfreeintendedprofessionalrulestoward
SHARED TOKENS (11): "accessible", "according", "association", "complete", "different", "directory", "free", "intended", "professional", "rules", "toward". | EXACT TITLE in sports_recreation: "Disc golf".
0.400
Utility ↗ Q466707 EXACT TITLE
amongbehaviordevelopeddistincteconomicsfunctionfunctionsrelationshipsourceutility
SHARED TOKENS (10): "among", "behavior", "developed", "distinct", "economics", "function", "functions", "relationship", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in sports_recreation: "Utility".
0.400
Martial arts ↗ Q11417 EXACT TITLE
applieddevelopmentenforcementlawphysicalpracticesregionstreetsubsequentlysystems
SHARED TOKENS (10): "applied", "development", "enforcement", "law", "physical", "practices", "region", "street", "subsequently", "systems". | EXACT TITLE in sports_recreation: "Martial arts".
0.390
academicassociationdivisionidaholevelnampanationalnorthwestprimarilyschooluniversitywest
SHARED TOKENS (12): "academic", "association", "division", "idaho", "level", "nampa", "national", "northwest", "primarily", "school", "university", "west". | URL->B (1): https://nnusports.com/.
0.380
actactivitycommercialeventgroupindividualorganizationsupportsupporting
SHARED TOKENS (9): "act", "activity", "commercial", "event", "group", "individual", "organization", "support", "supporting". | EXACT TITLE in sports_recreation: "Sponsor (commercial)".
0.380
distinctlinksolderownedprivatepublicsharedshortstandard
SHARED TOKENS (9): "distinct", "links", "older", "owned", "private", "public", "shared", "short", "standard". | EXACT TITLE in sports_recreation: "Golf course".
0.380
activeamericandivisiongroupoperatedoperatesprofessionalscheduledwomen
SHARED TOKENS (9): "active", "american", "division", "group", "operated", "operates", "professional", "scheduled", "women". | EXACT TITLE in sports_recreation: "USL League One".
0.380
boiseexpansionformeridahooperatingrouteservethoughtrain
SHARED TOKENS (9): "boise", "expansion", "former", "idaho", "operating", "route", "serve", "though", "train". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.380
bicycledistinctfeatureslargermaterialsmountainperformancetrailwider
SHARED TOKENS (9): "bicycle", "distinct", "features", "larger", "materials", "mountain", "performance", "trail", "wider". | EXACT TITLE in sports_recreation: "Mountain biking".
0.360
Hiking ↗ Q12014035 EXACT TITLE
activitydescribesdevelopedlongorganizationsparkurbanwalking
SHARED TOKENS (8): "activity", "describes", "developed", "long", "organizations", "park", "urban", "walking". | EXACT TITLE in sports_recreation: "Hiking".
0.360
centralgovernmentlandlocalnationalownedpublicsystem
SHARED TOKENS (8): "central", "government", "land", "local", "national", "owned", "public", "system". | EXACT TITLE in sports_recreation: "Public land".
0.360
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseforestidahomilesriverurbanwestern
SHARED TOKENS (8): "approximately", "boise", "forest", "idaho", "miles", "river", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River". | EXACT TITLE in sports_recreation: "Boise River".
0.340
civilengineeringfieldinvolvingnetworktraffictransportation
SHARED TOKENS (7): "civil", "engineering", "field", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.320
complexfacilitiesfieldgroupparkstrack
SHARED TOKENS (6): "complex", "facilities", "field", "group", "parks", "track". | EXACT TITLE in sports_recreation: "Sports complex".
0.320
Skiing ↗ Q130949 EXACT TITLE
activitycompetitiveeventsrecreationalsnowwinter
SHARED TOKENS (6): "activity", "competitive", "events", "recreational", "snow", "winter". | EXACT TITLE in sports_recreation: "Skiing".
0.300
bodycapableclearancecomprehensiveconditioncoordinationcreatecreateseducationfitnessfullfunctiongeneralguidelineshealthindividualindividualsinformationinstructionmedical
SHARED TOKENS (39): "body", "capable", "clearance", "comprehensive", "condition", "coordination", "create", "creates", "education", "fitness", "full", "function", "general", "guidelines", "health", "individual", "individuals", "information", "instruction", "medical"....
0.300
accesschaincostsdestinationdirecteconomicsgeneralgroupintendeditselflongmaterialoperatingpracticepracticesregionspecializedtraintransportation
SHARED TOKENS (19): "access", "chain", "costs", "destination", "direct", "economics", "general", "group", "intended", "itself", "long", "material", "operating", "practice", "practices", "region", "specialized", "train", "transportation".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencybuildingcitiescommercialcostsdensedescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthinfrastructurelandlargepeopleplanningpopulation
SHARED TOKENS (33): "agency", "building", "cities", "commercial", "costs", "dense", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "infrastructure", "land", "large", "people", "planning", "population"....
0.300
administeredamongcarecategoryclinicalcommunitiescommunitydefinesdepartmentdifferentdisabilitydistincteconomiceducationenvironmentenvironmentaleventsfieldformalgroup
SHARED TOKENS (54): "administered", "among", "care", "category", "clinical", "communities", "community", "defines", "department", "different", "disability", "distinct", "economic", "education", "environment", "environmental", "events", "field", "formal", "group"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalbrandconditionscustomersdeterminedigitalindependentinspectionmaintenanceneedsrepairroleshowingsignsvehiclework
SHARED TOKENS (16): "approval", "brand", "conditions", "customers", "determine", "digital", "independent", "inspection", "maintenance", "needs", "repair", "role", "showing", "signs", "vehicle", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
centraldesignengineersenvironmentfullincreaseintegrationlinesmakespedestrianrequireresearchresultingroadrulessafetyshownsignificantsignsthem
SHARED TOKENS (24): "central", "design", "engineers", "environment", "full", "increase", "integration", "lines", "makes", "pedestrian", "require", "research", "resulting", "road", "rules", "safety", "shown", "significant", "signs", "them"....
0.300
accordingcreatingdemanddisabilityformfunctionsmedicalneedsnetworkolderpeopleprivateprogramsprovidepublicratherrelevantrouteroutesshared
SHARED TOKENS (24): "according", "creating", "demand", "disability", "form", "functions", "medical", "needs", "network", "older", "people", "private", "programs", "provide", "public", "rather", "relevant", "route", "routes", "shared"....
0.300
announcedassociationboisecollegecompetedivisionidaholevelmajormountainnationalnationallyprogramprogramsrecordschooluniversitywestwomen
SHARED TOKENS (19): "announced", "association", "boise", "college", "compete", "division", "idaho", "level", "major", "mountain", "national", "nationally", "program", "programs", "record", "school", "university", "west", "women".
0.300
americanclasscompetecurrentdetermineestablishedexpansionhistoryidahoindependentmajormarketnationaloperatespartnerprofessionalregionsimplysplitsystem
SHARED TOKENS (23): "american", "class", "compete", "current", "determine", "established", "expansion", "history", "idaho", "independent", "major", "market", "national", "operates", "partner", "professional", "region", "simply", "split", "system"....
0.300
Boating ↗ Q2141830 EXACT TITLE
activityinvolvingitselfrecreationaltravel
SHARED TOKENS (5): "activity", "involving", "itself", "recreational", "travel". | EXACT TITLE in sports_recreation: "Boating".
0.300
americanbuiltbusinessescenterscentralchangescitiesdemographicdevelopmenteconomicenvironmentalexpansionformationgrowinggrowthmodelperipheralplannedpopulationpopulations
SHARED TOKENS (24): "american", "built", "businesses", "centers", "central", "changes", "cities", "demographic", "development", "economic", "environmental", "expansion", "formation", "growing", "growth", "model", "peripheral", "planned", "population", "populations"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcitiescommunitiesconnectingdifferentdistrictsfeaturesinsidelinelinesmetropolitanmultipleoperateoperatespricingprimarilyregionalsystemstransit
SHARED TOKENS (21): "business", "central", "cities", "communities", "connecting", "different", "districts", "features", "inside", "line", "lines", "metropolitan", "multiple", "operate", "operates", "pricing", "primarily", "regional", "systems", "transit"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedbehaviorclassescontrolenforcementeventguidelineshealthidentifiedlevelmeasuresmotoroccupationalpedestrianpracticesproducepublicremainrequiringroad
SHARED TOKENS (33): "applied", "behavior", "classes", "control", "enforcement", "event", "guidelines", "health", "identified", "level", "measures", "motor", "occupational", "pedestrian", "practices", "produce", "public", "remain", "requiring", "road"....
0.300
accessactiveadaboardboisecenterdistrictdowntownfeetfoothillshistoricalidahoinvolvingitselfjunelandlegallevellocalmanages
SHARED TOKENS (35): "access", "active", "ada", "board", "boise", "center", "district", "downtown", "feet", "foothills", "historical", "idaho", "involving", "itself", "june", "land", "legal", "level", "local", "manages"....
0.300
administeredcompeteconditionsindividualindividualslevellongnationalopenplaceprofessionalroadrulessnowtrackwinterwomen
SHARED TOKENS (17): "administered", "compete", "conditions", "individual", "individuals", "level", "long", "national", "open", "place", "professional", "road", "rules", "snow", "track", "winter", "women".
0.300
Leisure ↗ Q180910 KW CROSS HIGH
academicactivityanalysisanotherbusinessconditionsconsumptiondeterminedifferentdistinctioneducationfreeindividualslong-termmajorpeopleplacequalityrecreationrelationships
SHARED TOKENS (25): "academic", "activity", "analysis", "another", "business", "conditions", "consumption", "determine", "different", "distinction", "education", "free", "individuals", "long-term", "major", "people", "place", "quality", "recreation", "relationships"....
0.300
buildingbusinesscentercentraldedicateddensedevelopmentformgrowthincreaselandnetworkplanningprivatepublicrelationshipresidentialscaleservingspace
SHARED TOKENS (24): "building", "business", "center", "central", "dedicated", "dense", "development", "form", "growth", "increase", "land", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "space"....
0.300
broadercategorycommunitycompletecomplexdisabilityemergencyemploymenteventsfeaturesmajormeasuresoccupationalolderphysicalpressurerecoveryrecreationrehabilitationrules
SHARED TOKENS (28): "broader", "category", "community", "complete", "complex", "disability", "emergency", "employment", "events", "features", "major", "measures", "occupational", "older", "physical", "pressure", "recovery", "recreation", "rehabilitation", "rules"....
0.300
acresadministersagencybusinesscoveringdepartmentdevelopmentfederalforestlandmajormanagementmanagesmillionnationaloperationsparkprivateresearchsystem
SHARED TOKENS (20): "acres", "administers", "agency", "business", "covering", "department", "development", "federal", "forest", "land", "major", "management", "manages", "million", "national", "operations", "park", "private", "research", "system".
0.300
changesdesignengineeringengineersgrowingmeasuresmotorizedphysicalplannersresponsibleroadroadsrulesafetysignssurfacetrafficurbanuses
SHARED TOKENS (19): "changes", "design", "engineering", "engineers", "growing", "measures", "motorized", "physical", "planners", "responsible", "road", "roads", "rule", "safety", "signs", "surface", "traffic", "urban", "uses".
0.300
accessibleadministrationageagencyamericananotherbuildingcenterscommercialconstructiondepartmentdistributiondivisioneconomyeducationenginesenvironmentalfederalgoverninggoverns
SHARED TOKENS (51): "accessible", "administration", "age", "agency", "american", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "economy", "education", "engines", "environmental", "federal", "governing", "governs"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritybicyclecapablecreateddifferentestatefacilityfullgovernmentlandlegallineslocaloperateownershippathspeoplephysicalprivatereal
SHARED TOKENS (33): "authority", "bicycle", "capable", "created", "different", "estate", "facility", "full", "government", "land", "legal", "lines", "local", "operate", "ownership", "paths", "people", "physical", "private", "real"....
0.300
Workplace wellness ↗ KW CROSS HIGH
behaviorcorporatecostseducationemployeeestablishexistingfacilitiesfitnessfoodhealthinsuranceinvestmentlongmanagemanagementmedicalorganizationalparticipationpolicies
SHARED TOKENS (27): "behavior", "corporate", "costs", "education", "employee", "establish", "existing", "facilities", "fitness", "food", "health", "insurance", "investment", "long", "manage", "management", "medical", "organizational", "participation", "policies"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturecitiescommunitiescompetitiveconditioncreatecreatescurrentdescribesdevelopeddevelopingdevelopmenteconomiceconomicseducationefficientlyenvironmentalequivalentgenerate
SHARED TOKENS (56): "approximately", "architecture", "cities", "communities", "competitive", "condition", "create", "creates", "current", "describes", "developed", "developing", "development", "economic", "economics", "education", "efficiently", "environmental", "equivalent", "generate"....
0.300
anothercapacityconditiondemanddepartmentshighplanningpublicresultingroadroadsroutetraffictransportationurbanvehicles
SHARED TOKENS (16): "another", "capacity", "condition", "demand", "departments", "high", "planning", "public", "resulting", "road", "roads", "route", "traffic", "transportation", "urban", "vehicles".
0.300
americancapacitycapitalcitiesconnectingconventionalcorridorscostdedicateddesignfeaturesmillionnetworkpublicqualitysinglesystemsystemstraffictransit
SHARED TOKENS (21): "american", "capacity", "capital", "cities", "connecting", "conventional", "corridors", "cost", "dedicated", "design", "features", "million", "network", "public", "quality", "single", "system", "systems", "traffic", "transit"....
0.300
advancedapplicationappliedcapacitychangescollectionconditionsdifferentemergencyfieldincreaseinformationinfrastructurelawsmanagementmobilityprovideroadroadssafety
SHARED TOKENS (28): "advanced", "application", "applied", "capacity", "changes", "collection", "conditions", "different", "emergency", "field", "increase", "information", "infrastructure", "laws", "management", "mobility", "provide", "road", "roads", "safety"....
0.300
American football ↗ KW CROSS HIGH
americanamongchangescollegecontrolcreatedentersestablishedeventsfieldgrowinghighlinemaintainsmajormillionnationaloriginatingpointsprimarily
SHARED TOKENS (28): "american", "among", "changes", "college", "control", "created", "enters", "established", "events", "field", "growing", "high", "line", "maintains", "major", "million", "national", "originating", "points", "primarily"....
0.300
activeannualassociationbeyondboardbodycontroleventfeetgovernedlawslevellinemillionnationalresponsiblerules
SHARED TOKENS (17): "active", "annual", "association", "beyond", "board", "body", "control", "event", "feet", "governed", "laws", "level", "line", "million", "national", "responsible", "rules".
0.300
anticipatedcreatingdepartmentdifferentevenpathspathwaypermitprimaryprovideroutesharedsidewalkssurfacetravelurbanuserusers
SHARED TOKENS (18): "anticipated", "creating", "department", "different", "even", "paths", "pathway", "permit", "primary", "provide", "route", "shared", "sidewalks", "surface", "travel", "urban", "user", "users".
0.300
Ice hockey ↗ Q41466 KW CROSS HIGH
beganbodycontactcontroldevelopedfieldformalfullinfluencelinesnationalprofessionalrulessimplywiderwinterwomen
SHARED TOKENS (17): "began", "body", "contact", "control", "developed", "field", "formal", "full", "influence", "lines", "national", "professional", "rules", "simply", "wider", "winter", "women".
0.300
americanappearscombinedcreatedevenfacilitiesfeaturesgovernlargelawspedestrianplacepointsroadroadsrulessafetyschoolseparatesignage
SHARED TOKENS (26): "american", "appears", "combined", "created", "even", "facilities", "features", "govern", "large", "laws", "pedestrian", "place", "points", "road", "roads", "rules", "safety", "school", "separate", "signage"....
0.300
administersamericanbodyfacilityfullgoverninggovernsmajornationalnonprofitofficialopenoperatesorganizationorganizationsprofessionaltrainingwomen
SHARED TOKENS (18): "administers", "american", "body", "facility", "full", "governing", "governs", "major", "national", "nonprofit", "official", "open", "operates", "organization", "organizations", "professional", "training", "women".
0.300
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemarketingmetropolitanparkparkingpeoplepoolpublicroadsignssystemtransfertransitvehiclevehicles
SHARED TOKENS (17): "cities", "connections", "large", "marketing", "metropolitan", "park", "parking", "people", "pool", "public", "road", "signs", "system", "transfer", "transit", "vehicle", "vehicles".
0.300
appliedappliesapprovalassociationdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingindividualsmajormakingmanagementmoveparticipationplanplanspolicies
SHARED TOKENS (34): "applied", "applies", "approval", "association", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "individuals", "major", "making", "management", "move", "participation", "plan", "plans", "policies"....
0.300
accessadvancedamericanbuiltcapacitycentralchangescitiesclasscompletedconnectconnectedconnectingconstructedcontainingegressevenfreeimplieslimits
SHARED TOKENS (45): "access", "advanced", "american", "built", "capacity", "central", "changes", "cities", "class", "completed", "connect", "connected", "connecting", "constructed", "containing", "egress", "even", "free", "implies", "limits"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralidahomajormilesnationalnorthwestofficialparkplannedriverroadroadsrouteruleswestwestern
SHARED TOKENS (17): "caldwell", "general", "idaho", "major", "miles", "national", "northwest", "official", "park", "planned", "river", "road", "roads", "route", "rules", "west", "western".
0.300
Arena ↗ Q641226 EXACT TITLE
eventeventslargeopenspace
SHARED TOKENS (5): "event", "events", "large", "open", "space". | EXACT TITLE in sports_recreation: "Arena".
0.300
agencybegandepartmenteducationemployeeenforcementengineersenvironmentalequivalentestablishingfederalgovernmentindependentinformationlawslegallevellocalmattersmeasures
SHARED TOKENS (27): "agency", "began", "department", "education", "employee", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "government", "independent", "information", "laws", "legal", "level", "local", "matters", "measures"....
0.300
administrationarrangementassetsbuildingcapitalcollectioncontractingcostcostsdevelopmentevidencefundinggovernmenthighinfrastructureinstitutionsinvestmentlong-termmultipleoperating
SHARED TOKENS (39): "administration", "arrangement", "assets", "building", "capital", "collection", "contracting", "cost", "costs", "development", "evidence", "funding", "government", "high", "infrastructure", "institutions", "investment", "long-term", "multiple", "operating"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
ageagenciesamericancanyoncentralcommercialconstructedconstructioncontrolcreateddevelopedfeatureshabitathighhistoryidahoirrigationlargelongmajor
SHARED TOKENS (42): "age", "agencies", "american", "canyon", "central", "commercial", "constructed", "construction", "control", "created", "developed", "features", "habitat", "high", "history", "idaho", "irrigation", "large", "long", "major"....
0.300
americanbeganestablishedformgrowthmajornameopenorganizesoutdoorownershipplannedpremierprofessionalsplitsystemthoughwomen
SHARED TOKENS (18): "american", "began", "established", "form", "growth", "major", "name", "open", "organizes", "outdoor", "ownership", "planned", "premier", "professional", "split", "system", "though", "women".
0.300
americandepartmentdepartmentsdirectlyeconomyfederalgovernmentmissionpeopleplanreportssafeservingstrategicsystemtransportation
SHARED TOKENS (16): "american", "department", "departments", "directly", "economy", "federal", "government", "mission", "people", "plan", "reports", "safe", "serving", "strategic", "system", "transportation".
0.300
Linear park ↗ KW CROSS HIGH
connectcorridorscreatedensedifferentelectricalexistinglandlineslongopenparkparksplacesplannedprivatepublicrecreationrecreationalspace
SHARED TOKENS (24): "connect", "corridors", "create", "dense", "different", "electrical", "existing", "land", "lines", "long", "open", "park", "parks", "places", "planned", "private", "public", "recreation", "recreational", "space"....
0.300
adabeganboisebuiltcompletedconstructioncontroldirectlyelectricityengineersfederalfeetfullgenerationidahoirrigationlevelmilesmountainmultiple
SHARED TOKENS (30): "ada", "began", "boise", "built", "completed", "construction", "control", "directly", "electricity", "engineers", "federal", "feet", "full", "generation", "idaho", "irrigation", "level", "miles", "mountain", "multiple"....
0.300
Mountaineering ↗ Q36908 KW CROSS HIGH
activityappliedchangescommunitiesdependseconomicenvironmentenvironmentalformalgovernancegradinggroupindividualinvolvinglandlandscapelargelevellocalmeans
SHARED TOKENS (31): "activity", "applied", "changes", "communities", "depends", "economic", "environment", "environmental", "formal", "governance", "grading", "group", "individual", "involving", "land", "landscape", "large", "level", "local", "means"....
0.300
combinedconnectsconsumerscurrentcustomersdeliverydirectdirectlydistinctdistributionelectricalelectricityevenformfrequencyhistoricallyincreaselevellinelines
SHARED TOKENS (32): "combined", "connects", "consumers", "current", "customers", "delivery", "direct", "directly", "distinct", "distribution", "electrical", "electricity", "even", "form", "frequency", "historically", "increase", "level", "line", "lines"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedbicyclecapacitycontrolelectricityinformationlawslevellocalnationalpedestrianroadsystemsystemstechnologytrafficusers
SHARED TOKENS (17): "advanced", "bicycle", "capacity", "control", "electricity", "information", "laws", "level", "local", "national", "pedestrian", "road", "system", "systems", "technology", "traffic", "users".
0.300
buildingconditionscontainingcreatesenvironmentevenhealthidentificationmaterialspeoplepersonnelphysicalpropertypublicregulationsriskssafetysignagesubjectsystem
SHARED TOKENS (22): "building", "conditions", "containing", "creates", "environment", "even", "health", "identification", "materials", "people", "personnel", "physical", "property", "public", "regulations", "risks", "safety", "signage", "subject", "system"....
0.300
announcedcenterclasscreatefoundeditselfmilesnetworkoperatesoperatingplansprincipalprojectreportingroadrouteroutessystemtransportationwest
SHARED TOKENS (21): "announced", "center", "class", "create", "founded", "itself", "miles", "network", "operates", "operating", "plans", "principal", "project", "reporting", "road", "route", "routes", "system", "transportation", "west"....
0.300
accessactadditionaladministrationannuallyapproximatelybeganbuiltcollectioncompleteconstructioncontinuedcontrolledcostcreatingdensedesigndevelopedequivalentestablished
SHARED TOKENS (54): "access", "act", "additional", "administration", "annually", "approximately", "began", "built", "collection", "complete", "construction", "continued", "controlled", "cost", "creating", "dense", "design", "developed", "equivalent", "established"....
0.300
accordingactivityanalysisbecomesdesigndocumentationengineeringengineersenvironmentestablishedgeneralgovernmentlegallicenselicensedlicensurelocalmaintenanceplanspractice
SHARED TOKENS (42): "according", "activity", "analysis", "becomes", "design", "documentation", "engineering", "engineers", "environment", "established", "general", "government", "legal", "license", "licensed", "licensure", "local", "maintenance", "plans", "practice"....
0.300
academiccollegecommunitydifferenteducationenrollmentformhighinstitutionsopenpolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (17): "academic", "college", "community", "different", "education", "enrollment", "form", "high", "institutions", "open", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.300
Referee ↗ Q202648 EXACT TITLE
decisionsofficialresponsiblerulestechnical
SHARED TOKENS (5): "decisions", "official", "responsible", "rules", "technical". | EXACT TITLE in sports_recreation: "Referee".
0.300
Swimming pool ↗ Q1501 KW CROSS HIGH
buildingbuiltcentersclassescommunitiescompetitivecomplexconstructedconstructioneducationfacilitiesfitnesshealthhighinstitutionallargerlocalmaterialsphysicalpool
SHARED TOKENS (33): "building", "built", "centers", "classes", "communities", "competitive", "complex", "constructed", "construction", "education", "facilities", "fitness", "health", "high", "institutional", "larger", "local", "materials", "physical", "pool"....
0.300
acresactagencycoveringcreateddepartmentdistrictfederalhistoricalmakingmanagementmanagesmillionnationalparkparkspeopleplacespublicrecreational
SHARED TOKENS (22): "acres", "act", "agency", "covering", "created", "department", "district", "federal", "historical", "making", "management", "manages", "million", "national", "park", "parks", "people", "places", "public", "recreational"....
0.300
actactiveadministeredagenciesapproximatelyauthorityauthorizedbridgesbudgetbuildingbusinesscapacitycivilclearancecombinedconstituteconstructioncontroldepartmentdesign
SHARED TOKENS (70): "act", "active", "administered", "agencies", "approximately", "authority", "authorized", "bridges", "budget", "building", "business", "capacity", "civil", "clearance", "combined", "constitute", "construction", "control", "department", "design"....
0.300
academicamericanamongannuallyassociationcollegecompetecurrentdivisioninstitutionslargerlawmembershipmillionnationalnonprofitorganizationorganizesprogramsreceive
SHARED TOKENS (32): "academic", "american", "among", "annually", "association", "college", "compete", "current", "division", "institutions", "larger", "law", "membership", "million", "national", "nonprofit", "organization", "organizes", "programs", "receive"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementanotherarrangementbrandbusinesscapitalchaincompeteconditionscontrollingcorporatedirecteconomicentityexpansionexplicitlyfeesfranchisegrowthindividual
SHARED TOKENS (47): "agreement", "another", "arrangement", "brand", "business", "capital", "chain", "compete", "conditions", "controlling", "corporate", "direct", "economic", "entity", "expansion", "explicitly", "fees", "franchise", "growth", "individual"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedbuildingsconnectdevelopmenteasementsevenfeefullfunctionsgovernmentlandlegalmunicipalitiesownersownershippaymentpower
SHARED TOKENS (32): "acquisition", "another", "application", "authorized", "buildings", "connect", "development", "easements", "even", "fee", "full", "functions", "government", "land", "legal", "municipalities", "owners", "ownership", "payment", "power"....
0.300
bridgescivilconstructiondesignengineeringengineersmaintenancematerialsplanningprofessionalroadsstandardsstreetsstructuraltraffictransportation
SHARED TOKENS (16): "bridges", "civil", "construction", "design", "engineering", "engineers", "maintenance", "materials", "planning", "professional", "roads", "standards", "streets", "structural", "traffic", "transportation".
0.300
beyondbrandbusinessesdestinationseconomiceconomyenvironmenteventeventsgenerategrowthinfrastructuremajorparticipatingsignificanttourismtravel
SHARED TOKENS (17): "beyond", "brand", "businesses", "destinations", "economic", "economy", "environment", "event", "events", "generate", "growth", "infrastructure", "major", "participating", "significant", "tourism", "travel".
0.300
activeactivitybicycleconsumptioncyclingfitnesshealthincreaseincreasesindividuallargelevelmeansmobilitypeoplephysicalpoliciesprogramspublicseparately
SHARED TOKENS (25): "active", "activity", "bicycle", "consumption", "cycling", "fitness", "health", "increase", "increases", "individual", "large", "level", "means", "mobility", "people", "physical", "policies", "programs", "public", "separately"....
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdefinesdepartmentdesigndevelopeddocumentfederallawlocalnationalopenownedparking
SHARED TOKENS (33): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "defines", "department", "design", "developed", "document", "federal", "law", "local", "national", "open", "owned", "parking"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotcombinedconnectdesigndestinationdrainageeveninfrastructureinsidelargemanagemunicipalparkingparkspropertypublicreceiverequire
SHARED TOKENS (29): "bodies", "buildings", "cannot", "combined", "connect", "design", "destination", "drainage", "even", "infrastructure", "inside", "large", "manage", "municipal", "parking", "parks", "property", "public", "receive", "require"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdifferentequivalentformindividuallinelongmeaningmultipleoperateoperatesoperatingoperationsprimarilysectionstreetssystemsystems
SHARED TOKENS (26): "broader", "capacity", "conditions", "different", "equivalent", "form", "individual", "line", "long", "meaning", "multiple", "operate", "operates", "operating", "operations", "primarily", "section", "streets", "system", "systems"....
0.300
accesscommunitycompletecyclingdesigneconomicengineersenvironmentalhealthoperatedplannedplannerspolicypractitionerspublicrequiressafesafetystreetstraffic
SHARED TOKENS (25): "access", "community", "complete", "cycling", "design", "economic", "engineers", "environmental", "health", "operated", "planned", "planners", "policy", "practitioners", "public", "requires", "safe", "safety", "streets", "traffic"....
0.300
actapprovalapprovalsbuildingcommercialconstructioncontractorscostscreatesdesigndeterminedevelopersdevelopmentdifferenteconomicengineersenvironmentalestateexistingexpands
SHARED TOKENS (49): "act", "approval", "approvals", "building", "commercial", "construction", "contractors", "costs", "creates", "design", "determine", "developers", "development", "different", "economic", "engineers", "environmental", "estate", "existing", "expands"....
0.300
Title IX ↗ Q3133007 KW CROSS HIGH
actamericancivileducationemploymentfederalfullfundinggovernmentjunelawprogramprohibitspublicrightsschoolstudentstitlewomen
SHARED TOKENS (19): "act", "american", "civil", "education", "employment", "federal", "full", "funding", "government", "june", "law", "program", "prohibits", "public", "rights", "school", "students", "title", "women".
0.300
boisecitiesdowntownidaholinemajormetropolitanmilesmountainnorthwestprimarilyriverrouteroutesserves
SHARED TOKENS (15): "boise", "cities", "downtown", "idaho", "line", "major", "metropolitan", "miles", "mountain", "northwest", "primarily", "river", "route", "routes", "serves".
🫐 BERRY40 edges
0.280
advanceddistinctequipmentfreegrowthneededplacesrouteroutessafetyshorttechnicaltemporaryuses
SHARED TOKENS (14): "advanced", "distinct", "equipment", "free", "growth", "needed", "places", "route", "routes", "safety", "short", "technical", "temporary", "uses".
0.280
agencydepartmentidahoresponsible
SHARED TOKENS (4): "agency", "department", "idaho", "responsible". | EXACT TITLE in sports_recreation: "Idaho Department of Fish and Game".
0.280
Green belt ↗ Q1552255 KW CROSS HIGH
developmentestablishedgeneralgreenbeltlandland-uselineparkplanningpolicyreturnspacesurroundingurban
SHARED TOKENS (14): "development", "established", "general", "greenbelt", "land", "land-use", "line", "park", "planning", "policy", "return", "space", "surrounding", "urban".
0.280
accessconnectingformerlocalmajormoveprovideresidentialroadroadsservesstreetstrafficwider
SHARED TOKENS (14): "access", "connecting", "former", "local", "major", "move", "provide", "residential", "road", "roads", "serves", "streets", "traffic", "wider".
0.280
amongboisecollegecurrentdivisionestablishedidaholevelmountainnationalprogramsubdivisionuniversitywest
SHARED TOKENS (14): "among", "boise", "college", "current", "division", "established", "idaho", "level", "mountain", "national", "program", "subdivision", "university", "west".
0.280
academicapplicationdesignengineeringfacilitiesfieldmanagementoccupationalpeopleplanningprovidesafetechnologytransportation
SHARED TOKENS (14): "academic", "application", "design", "engineering", "facilities", "field", "management", "occupational", "people", "planning", "provide", "safe", "technology", "transportation".
0.280
bodygoverningnationalorganizations
SHARED TOKENS (4): "body", "governing", "national", "organizations". | EXACT TITLE in sports_recreation: "USA Climbing".
0.260
eagleidahopark
SHARED TOKENS (3): "eagle", "idaho", "park". | EXACT TITLE in sports_recreation: "Eagle Island State Park".
0.260
Recreation ↗ Q184872 EXACT TITLE
activityrecreationrecreational
SHARED TOKENS (3): "activity", "recreation", "recreational". | EXACT TITLE in transportation_infrastructure: "Recreation". | EXACT TITLE in sports_recreation: "Recreation".
0.260
activitybodycapacitychangesconditionseducationhealthmanagephysicalprogressionstudysystemstraining
SHARED TOKENS (13): "activity", "body", "capacity", "changes", "conditions", "education", "health", "manage", "physical", "progression", "study", "systems", "training".
0.260
createenginesuses
SHARED TOKENS (3): "create", "engines", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
Nordic skiing ↗ Q216613 KW CROSS HIGH
combinedcompetitiveeventeventsjurisdictionrecreationalrequirementsrequiresrulesseparatestudysubjecttraining
SHARED TOKENS (13): "combined", "competitive", "event", "events", "jurisdiction", "recreational", "requirements", "requires", "rules", "separate", "study", "subject", "training".
0.260
americanannuallyassociationbegancollegeestablishedinstitutionsmedianationalnetworkparticipatingserveswhose
SHARED TOKENS (13): "american", "annually", "association", "began", "college", "established", "institutions", "media", "national", "network", "participating", "serves", "whose".
0.260
dedicatedequipmenttraining
SHARED TOKENS (3): "dedicated", "equipment", "training". | EXACT TITLE in sports_recreation: "Climbing gym".
0.240
activeagenciesenvironmentenvironmentalfederalindividualslandnonprofitorganizationsparticipationpracticesresponsible
SHARED TOKENS (12): "active", "agencies", "environment", "environmental", "federal", "individuals", "land", "nonprofit", "organizations", "participation", "practices", "responsible".
0.240
Water right ↗ Q7973730 KW CROSS HIGH
differentirrigationlawlegalphysicalriversourcesurfacesystemsuseruserswater
SHARED TOKENS (12): "different", "irrigation", "law", "legal", "physical", "river", "source", "surface", "systems", "user", "users", "water".
0.220
Parasports ↗ Q814517 KW CROSS HIGH
appliedcompetitivecreateddisabilitiesdisabilityequivalentexistinglevelpeoplephysicaltemporary
SHARED TOKENS (11): "applied", "competitive", "created", "disabilities", "disability", "equivalent", "existing", "level", "people", "physical", "temporary".
0.220
instructiontraining
SHARED TOKENS (2): "instruction", "training". | EXACT TITLE in sports_recreation: "Coach (sport)".
0.220
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomiclinemotorresearchrestrictedroadsafetyshowstrafficvehicles
SHARED TOKENS (11): "businesses", "economic", "line", "motor", "research", "restricted", "road", "safety", "shows", "traffic", "vehicles".
0.220
Negligence ↗ Q160070 KW CROSS HIGH
actanothercareeconomicindividualslawlinkedpeoplephysicalpropertyscope
SHARED TOKENS (11): "act", "another", "care", "economic", "individuals", "law", "linked", "people", "physical", "property", "scope".
0.220
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeconstructionequipmentinfrastructurelargelegallimitsroadstandardtransportationwater
SHARED TOKENS (11): "bridge", "construction", "equipment", "infrastructure", "large", "legal", "limits", "road", "standard", "transportation", "water".
0.200
Health club ↗ Q1065656 KW CROSS HIGH
activityamongcentercentersequipmentfitnesshealthphysicalplacepopulation
SHARED TOKENS (10): "activity", "among", "center", "centers", "equipment", "fitness", "health", "physical", "place", "population".
0.180
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedidaholongmilesroutesystemtrailwestwestern
SHARED TOKENS (9): "continued", "idaho", "long", "miles", "route", "system", "trail", "west", "western".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "western".
0.180
canyonconnectingeagleidaholongmeridiannamparivervalley
SHARED TOKENS (9): "canyon", "connecting", "eagle", "idaho", "long", "meridian", "nampa", "river", "valley".
0.160
citiesidaholandmajormilesnorthwestprimarilyriver
SHARED TOKENS (8): "cities", "idaho", "land", "major", "miles", "northwest", "primarily", "river".
0.160
costsfasteritselfmultipleroadsecuritytransportationvehicle
SHARED TOKENS (8): "costs", "faster", "itself", "multiple", "road", "security", "transportation", "vehicle".
0.140
boisecanyonidahometropolitanmiddletonnampapopulation
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
0.140
commerciallargelicensematerialsoperatevehiclevehicles
SHARED TOKENS (7): "commercial", "large", "license", "materials", "operate", "vehicle", "vehicles".
0.140
associationbodygoverningmembershipnationalorganizationwest
SHARED TOKENS (7): "association", "body", "governing", "membership", "national", "organization", "west".
0.120
boisecollegeidahoschooluniversitywomen
SHARED TOKENS (6): "boise", "college", "idaho", "school", "university", "women".
0.120
adaconnectingcountiesidahoroutestar
SHARED TOKENS (6): "ada", "connecting", "counties", "idaho", "route", "star".
0.120
Equestrianism ↗ Q179226 KW CROSS HIGH
americancompetitivedescriptionrecreationaltransportationwork
SHARED TOKENS (6): "american", "competitive", "description", "recreational", "transportation", "work".
0.120
americancommercialenvironmentlandphysicalprocess
SHARED TOKENS (6): "american", "commercial", "environment", "land", "physical", "process".
0.120
Skatepark ↗ Q909906 KW CROSS HIGH
fullintendedparkrecreationalspacespine
SHARED TOKENS (6): "full", "intended", "park", "recreational", "space", "spine".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
gardenidahoroutetreasurevalley
SHARED TOKENS (5): "garden", "idaho", "route", "treasure", "valley".
0.100
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Sports Recreation — Treasure Valley
HAIKU · HIGH GATE
How do road networks in Ada County connect Boise State University athletic facilities to regional sports venues?
Ada County's arterial roads directly link Boise State University's campus facilities in Boise to regional sports complexes across Meridian, Nampa, and Caldwell, enabling both athlete transport and spectator access. Urban planning decisions in these municipalities have prioritized road corridors that service recreation centers alongside residential and commercial districts.
What role do Americans with Disabilities Act compliance standards play in Treasure Valley sports facility access?
Transportation infrastructure serving sports recreation venues in Boise, Garden City, and Meridian must meet Americans with Disabilities Act of 1990 requirements for parking, pathways, and vehicle circulation. Municipal corporations across the Treasure Valley enforce these standards during land-use planning reviews for new or expanded athletic facilities.
How have emergency medical services routes in the Treasure Valley been integrated with public sports facility locations?
Emergency medical services in Ada County coordinate response corridors through Boise, Star, Garden City, and Caldwell to reach major public sports venues and recreational parks. Urban planning departments in these cities ensure that land-use designations for sports facilities prioritize proximity to established emergency access routes.
What transportation planning considerations affect sports recreation in areas near Treasure Valley floodplains?
Floodplain restrictions in the Treasure Valley limit where municipalities like Nampa and Boise can develop athletic facilities, requiring transportation infrastructure to route access roads around flood-prone areas. Land-use planning in Ada County integrates floodplain data when determining which sports recreation sites receive direct public transit or vehicle access.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Sports Recreation 18 QID bridges 253 edges 6,915 ext links 2026-07-17 23:43:26 UTC 752e45433f953fb7
Transportation Infrastructure corridor ↗ Sports Recreation corridor ↗ Sports Recreation × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals