—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Mortgage Lending

18 Wikipedia bridge articles confirmed in both vertical ledgers. 255 deterministic cross-vertical edges. 6,315 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
255 Cross Edges
6,315 External Sources
278 Wikipedia Articles
21 🌲 Evergreen
181 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Mortgage Lending
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
255
External Sources Harvested
6,315
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (18)
Boise State UniversityConstructionIdahoZoningSuburbanizationTreasure ValleyCollege of Western IdahoEagle, IdahoUrban sprawlNampa, IdahoLand-use planningDangerous goodsBoise, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoKuna, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitandevelopmentadaeastlandcollegewestbuildingplanningcapitalnorthwestwesternurbancanyonpublicassociatedindustrial
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:42:16 UTC
Content Hash
2d76697bcca4dabf
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (18): "activity", "among", "boise", "business", "college", "division", "economics", "education", "idaho", "independent", "mountain", "program", "programs", "public", "research", "school", "university", "west". | URL->B (1): https://boisestate.edu/. | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in mortgage_lending: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationidahoindependentmountainprogramprogramspublicresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Construction
Q3875186 EXACT TITLE 1.000
QID OVERLAP: Q3875186 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (16): "associated", "building", "construction", "development", "equivalent", "facilities", "financing", "improve", "industrial", "industry", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in mortgage_lending: "Construction".
associatedbuildingconstructiondevelopmentequivalentfacilitiesfinancingimproveindustrialindustryinfrastructurepercentplanningprocessproductswork
Construction is the process involved in delivering buildings, infrastructure, industrial facilities, and associated activities through to the end of their life. It typically starts with planning, financing, and design that continues until the asset is built and ready for use. Construction also covers repairs and maintenance work, any work to expand, extend, and improve the asset, and its eventual demolition, dismantling, or decommissioning. The construction industry contributes significantly to many countries' gross domestic products (GDP). Global expenditure on construction activities was about $4 trillion in 2012. In 2022, expenditure on the construction industry exceeded $11 trillion a year, equivalent to about 13 percent of global GDP. This spending was forecasted to rise to around $14.8 trillion in 2030. The construction industry promotes economic development and brings many non-monetary benefits to many countries, but it is one of the most hazardous industries.
. Etymology "Construction" stems from the Latin word constructio (which comes from com- "together" and struere "to pile up") as well as Old French construction. "To construct" is a verb: the act of building. The noun is "construction": how something is built or the nature of its structure. History The first huts and shelters were constructed by hand or with simple tools. As cities grew during the Bronze Age, a class of professional craftsmen, like bricklayers and carpenters, appeared. Occasionally, slaves were used for construction work. In the Middle Ages, the artisan craftsmen were organized into craft guilds. In the 19th century, steam-powered machinery appeared, and later, diesel- and electric-powered vehicles such as cranes, excavators and bulldozers. Fast-track construction has been increasingly popular in the 21st century.
The first huts and shelters were constructed by hand or with simple tools. As cities grew during the Bronze Age, a class of professional craftsmen, like bricklayers and carpenters, appeared. Occasionally, slaves were used for construction work. In the Middle Ages, the artisan craftsmen were organized into craft guilds. In the 19th century, steam-powered machinery appeared, and later, diesel- and electric-powered vehicles such as cranes, excavators and bulldozers. Fast-track construction has been increasingly popular in the 21st century. Some estimates suggest that 40% of construction projects are now fast-track construction. Construction industry sectors Broadly, there are three sectors of construction: buildings, infrastructure and industrial: Building construction is usually further divided into residential and non-residential. Infrastructure, also called 'heavy civil' or 'heavy engineering', includes large public works, dams, bridges, highways, railways, water or wastewater and utility distribution. Industrial construction includes offshore construction (mainly of energy installations), mining and quarrying, refineries, chemical processing, mills and manufacturing plants. The industry can also be classified into sectors or markets. For example, Engineering News-Record (ENR), a US-based construction trade magazine, has compiled and reported data about the size of design and construction contractors. In 2014, it split the data into nine market segments: transportation, petroleum, buildings, power, industrial, water, manufacturing, sewage/waste, telecom, hazardous waste, and a tenth category for other projects. ENR used data on transportation, sewage, hazardous waste and water to rank firms as heavy contractors. The Standard Industrial Classification and the newer North American Industry Classification System classify companies that perform or engage in construction into three subsectors: building construction, heavy and civil engineering construction, and specialty trade contractors.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (31): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "east", "idaho", "land", "mountain", "national", "northwest", "official", "pacific", "population", "prior".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
agriculturalagricultureapproximatelyassociatedbestboisecapitalcontainsdistinctdividedeastidaholandmountainnationalnorthwestofficialpacificpopulationpriorproductssectorseparatesmallsouthsuppliestechnologyterritoryuseswest+1
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (32): "building", "certain", "density", "determine", "developed", "development", "different", "differs", "form", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "permission", "places", "planning", "policy".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in mortgage_lending: "Zoning".
buildingcertaindensitydeterminedevelopeddevelopmentdifferentdiffersformgovernmentgrowthguidelinesindustriallandland-uselocalpermissionplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesystemsurban+2
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
(e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
pment may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Suburbanization
Q1091971 EXACT TITLE 1.000
QID OVERLAP: Q1091971 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (19): "american", "central", "changes", "consequence", "development", "drive", "east", "environmental", "expansion", "formation", "growing", "growth", "model", "patterns", "population", "process", "rural", "south", "urban". | EXACT TITLE in mortgage_lending: "Suburbanization".
americancentralchangesconsequencedevelopmentdriveeastenvironmentalexpansionformationgrowinggrowthmodelpatternspopulationprocessruralsouthurban
Suburbanization (American English), also spelled suburbanisation (British English), is a population shift from historic core cities or rural areas into suburbs. Most suburbs are built in a formation of (sub)urban sprawl. As a consequence of the movement of households and businesses away from city centers, low-density, peripheral urban areas grow. Proponents of curbing suburbanization argue that sprawl leads to urban decay and a concentration of lower-income residents in the inner city, in addition to environmental harm. Suburbanization can be a progressive process in which growing populations, technological innovations, and economic changes drive settlement outward, following the concentric zone model. Suburban growth takes many forms globally including planned satellite towns in Europe, rail-oriented suburbs in East Asia, Canadian high-rises, and the expansion of informal peri-urban areas in the Global South.
Drug abuse Pre-existing disparities in the demographic composition of suburbs pose problems in drug consumption and abuse. This is due to the disconnection created between drug addiction and the biased outward perception of suburban health and safety. In the United States, the combination of demographic and economic features created as a result of suburbanization has increased the risk of drug abuse in suburban communities. Heroin in suburban communities has increased in incidence as new heroin users in the United States are predominantly white suburban men and women in their early twenties. Adolescents and young adults are at an increased risk of drug abuse in suburban spaces due to the enclosed social and economic enclaves that surburbanization propagates. The New England Study of Suburban Youth found that the upper middle class suburban cohorts displayed an increased drug use when compared to the natural average. The shift in demographics and economic statuses related to suburbanization has increased the risk of drug abuse in affluent American communities and changed the approach to drug abuse public health initiatives. When addressing public health concerns of drug abuse with patients directly, suburban health care providers and medical practitioners have the advantage of treating a demographic of drug abuse patients that are better educated and equipped with resources to recover from addiction and overdose. The disparity of treatment and initiatives between suburban and urban environments in regard to drug abuse and overdose is a public health concern. Although suburban healthcare providers may have more resources to address drug addiction, abuse, and overdose, preconceived ideas about suburban lifestyles may prevent them from providing proper treatment to patients. Considering the increasing incidence of drug abuse in suburban environments, the contextual factors that affect certain demographics must also be considered to better understand the prevalence of drug abuse in suburbs.
The economic impacts of suburbanization have become very evident since the trend began in the 1950s. Changes in infrastructure, industry, real estate development costs, fiscal policies, and diversity of cities have been easily apparent, as "making it to the suburbs", mainly in order to own a home and escape the chaos of urban centers, have become the goals of many American citizens. These impacts have many benefits as well as side effects and are becoming increasingly important in the planning and revitalization of modern cities. Impact on urban industry The days of industry dominating the urban cores of cities are diminishing as population decentralization of urban centers increases. Companies increasingly look to build industrial parks in less populated areas, largely for more modern buildings and ample parking, as well as to appease the popular desire to work in less congested areas. Government economic policies that provide incentives for companies to build new structures and lack of incentives to build on Brownfield land, also contribute to the flight of industrial development from major cities to surrounding suburban areas. As suburban industrial development becomes increasingly more profitable, it becomes less financially attractive to build in high-density areas. Another impact of industry leaving the city is the reduction of buffer zones separating metropolitan areas, industrial parks and surrounding suburban residential areas.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (17): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "name", "primarily", "region", "resources", "rural", "treasure", "urbanized", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitannameprimarilyregionresourcesruraltreasureurbanizedvalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (24): "academic", "ada", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "southwest", "students".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
academicadaboisecanyoncollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicsouthweststudentstreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Eagle, Idaho
Q1516870 EXACT TITLE 0.820
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (36): "agency", "associated", "become", "building", "commercial", "costs", "density", "described", "development", "environmental", "existing", "expansion", "form", "growth", "housing", "industrial", "infrastructure", "lack", "land", "large"....
agencyassociatedbecomebuildingcommercialcostsdensitydescribeddevelopmentenvironmentalexistingexpansionformgrowthhousingindustrialinfrastructurelacklandlargemaintainingplanningpopulationprivatepropertyratesrequireresidentialroadssales+6
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (17): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeaningmeridianmetropolitannamenampanorthwestpopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (45): "act", "alternatives", "american", "applicable", "applied", "association", "authority", "behavior", "best", "central", "changes", "communities", "community", "conditions", "costs", "creating", "depend", "depends", "development", "districts"....
actalternativesamericanapplicableappliedassociationauthoritybehaviorbestcentralchangescommunitiescommunityconditionscostscreatingdependdependsdevelopmentdistrictsenvironmentalexposurefacilitiesfunctionfuturelandland-usemanageneighborhoodspatterns+15
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Dangerous goods
Q757138 QID OVERLAP 0.800
QID OVERLAP: Q757138 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (19): "air", "building", "certain", "conditions", "containing", "creates", "even", "hazard", "materials", "personnel", "physical", "property", "public", "regulations", "risks", "specific", "subject", "system", "them".
airbuildingcertainconditionscontainingcreatesevenhazardmaterialspersonnelphysicalpropertypublicregulationsrisksspecificsubjectsystemthem
r, and explosive is indicated with orange, because mixing red (flammable) with yellow (oxidizing agent) creates orange. A nonflammable and nontoxic gas is indicated with green, because all compressed air vessels were this color in France after World War II, and France was where the diamond system of hazmat identification originated. Global regulations The most widely applied regulatory scheme is that for the transportation of dangerous goods. The United Nations Economic and Social Council issues the UN Recommendations on the Transport of Dangerous Goods, which form the basis for most regional, national, and international regulatory schemes. For instance, the International Civil Aviation Organization has developed dangerous goods regulations for air transport of hazardous materials that are based upon the UN model but modified to accommodate unique aspects of air transport. Individual airline and governmental requirements are incorporated with this by the International Air Transport Association to produce the widely used IATA Dangerous Goods Regulations (DGR). Similarly, the International Maritime Organization (IMO) has developed the International Maritime Dangerous Goods Code ("IMDG Code", part of the International Convention for the Safety of Life at Sea) for transportation of dangerous goods by sea. IMO member countries have also developed the HNS Convention to provide compensation in case of dangerous goods spills in the sea. The Intergovernmental Organisation for International Carriage by Rail has developed the regulations concerning the International Carriage of Dangerous Goods by Rail ("RID", part of the Convention concerning International Carriage by Rail). Many individual nations have also structured their dangerous goods transportation regulations to harmonize with the UN model in organization as well as in specific requirements. The Globally Harmonized System of Classification and Labelling of Chemicals (GHS) is an internationally agreed upon system set to replace the various classification and labeling standards used in different countries.
The most widely applied regulatory scheme is that for the transportation of dangerous goods. The United Nations Economic and Social Council issues the UN Recommendations on the Transport of Dangerous Goods, which form the basis for most regional, national, and international regulatory schemes. For instance, the International Civil Aviation Organization has developed dangerous goods regulations for air transport of hazardous materials that are based upon the UN model but modified to accommodate unique aspects of air transport. Individual airline and governmental requirements are incorporated with this by the International Air Transport Association to produce the widely used IATA Dangerous Goods Regulations (DGR). Similarly, the International Maritime Organization (IMO) has developed the International Maritime Dangerous Goods Code ("IMDG Code", part of the International Convention for the Safety of Life at Sea) for transportation of dangerous goods by sea. IMO member countries have also developed the HNS Convention to provide compensation in case of dangerous goods spills in the sea. The Intergovernmental Organisation for International Carriage by Rail has developed the regulations concerning the International Carriage of Dangerous Goods by Rail ("RID", part of the Convention concerning International Carriage by Rail). Many individual nations have also structured their dangerous goods transportation regulations to harmonize with the UN model in organization as well as in specific requirements. The Globally Harmonized System of Classification and Labelling of Chemicals (GHS) is an internationally agreed upon system set to replace the various classification and labeling standards used in different countries.
Transport documents One of the transport regulations is that, as an assistance during emergency situations, written instructions how to deal in such need to be carried and easily accessible in the driver's cabin. Dangerous goods shipments also require a dangerous goods transport document prepared by the shipper. The information that is generally required includes the shipper's name and address; the consignee's name and address; descriptions of each of the dangerous goods, along with their quantity, classification, and packaging; and emergency contact information.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "east", "employers", "estimated", "home", "idaho", "locally", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastemployersestimatedhomeidaholocallymetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private", "roads".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
237 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP237 edges
🌲 EVERGREEN3 edges
0.650
acquisitionagencyconstructionfederalgovernmentindependentindustryjurisdictionlinesmatterspowerspreviouslyrateregulationregulatoryrelevantservessubjectwater
SHARED TOKENS (19): "acquisition", "agency", "construction", "federal", "government", "independent", "industry", "jurisdiction", "lines", "matters", "powers", "previously", "rate", "regulation", "regulatory", "relevant", "serves", "subject", "water". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationamericancommercialcostsfederalfundfundingfundsgeneralimprovelandmanagedpercentplanningprogrampublictaxtaxestrust
SHARED TOKENS (20): "acquisition", "administration", "american", "commercial", "costs", "federal", "fund", "funding", "funds", "general", "improve", "land", "managed", "percent", "planning", "program", "public", "tax", "taxes", "trust". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesairamonganotherauthoritybasebestboisecanyoncapacitycapitalcenterconventionalcostscrossdemanddistricteagle
SHARED TOKENS (68): "ada", "additional", "agencies", "air", "among", "another", "authority", "base", "best", "boise", "canyon", "capacity", "capital", "center", "conventional", "costs", "cross", "demand", "district", "eagle".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH181 edges
0.590
agencycreatingdepartmentenforceenforcementidaholawmunicipalorganizationpresentpublicstatewide
SHARED TOKENS (12): "agency", "creating", "department", "enforce", "enforcement", "idaho", "law", "municipal", "organization", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
applicationsbanksbecomebrokerscomplianceconsumerdebtdependsdevelopeddirectestatefeesfinanceindividualinstitutionsjurisdictionlawsmarketsproductsreal
SHARED TOKENS (25): "applications", "banks", "become", "brokers", "compliance", "consumer", "debt", "depends", "developed", "direct", "estate", "fees", "finance", "individual", "institutions", "jurisdiction", "laws", "markets", "products", "real".... | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
Well ↗ Q43483 EXACT TITLE
accessanothercompletedconstructedconstructioncontainscreatedatedriveenvironmentalhistoricallymaterialplacingpotentialprovidereachrequireresourcesruralselected
SHARED TOKENS (27): "access", "another", "completed", "constructed", "construction", "contains", "create", "date", "drive", "environmental", "historically", "material", "placing", "potential", "provide", "reach", "require", "resources", "rural", "selected".... | EXACT TITLE in transportation_infrastructure: "Well". | EXACT TITLE in mortgage_lending: "Well".
0.500
airannouncedbaseboiseconstructedhomeidahomissionmountainnearoctoberoperationspersonnelplacepopulationprimaryprovidesouthwestsupporttraining
SHARED TOKENS (21): "air", "announced", "base", "boise", "constructed", "home", "idaho", "mission", "mountain", "near", "october", "operations", "personnel", "place", "population", "primary", "provide", "southwest", "support", "training".... | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.500
additionalagenciesassetsbanksbasebeyondbillioncommercialcommunitiescommunitydecisionsdefinitionsfederalfocusgovernmentinstitutionsinsurancelocallocallynational
SHARED TOKENS (25): "additional", "agencies", "assets", "banks", "base", "beyond", "billion", "commercial", "communities", "community", "decisions", "definitions", "federal", "focus", "government", "institutions", "insurance", "local", "locally", "national".... | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Culvert ↗ Q4168092 EXACT TITLE
crossitselfmaterialperformanceplacingpracticeprocessrequirementsroadroadsselectionshapeshapesstructurewater
SHARED TOKENS (15): "cross", "itself", "material", "performance", "placing", "practice", "process", "requirements", "road", "roads", "selection", "shape", "shapes", "structure", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
actactivityadditionalagainstamonganalyzeannualauthoritycollectioncommunitycomplianceconsumerdatadepartmentdirectenforcementestablishexemptionsexpandedfederal
SHARED TOKENS (51): "act", "activity", "additional", "against", "among", "analyze", "annual", "authority", "collection", "community", "compliance", "consumer", "data", "department", "direct", "enforcement", "establish", "exemptions", "expanded", "federal".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
abilitycertaindetermineemployersfeesfinancialimpactindustryinfluenceobligationsorganizationpractitionerpractitionersprocessprofessionalpublicqualityregisteredrequiresrole
SHARED TOKENS (26): "ability", "certain", "determine", "employers", "fees", "financial", "impact", "industry", "influence", "obligations", "organization", "practitioner", "practitioners", "process", "professional", "public", "quality", "registered", "requires", "role".... | EXACT TITLE in mortgage_lending: "Accountant".
0.500
aircanyonconstructionemergencygeneralhomeidahoindustrialintegratedmilitarymissionmountainmunicipalnampanationalprivatepublicsystemstraining
SHARED TOKENS (19): "air", "canyon", "construction", "emergency", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "mountain", "municipal", "nampa", "national", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
actagainstapplicantsappliesassistanceauthoritybanksbusinesscapacitycodifiedcommunityconsumerdefinesdevelopmentdifferentfederalfinancefinancialgovernmenthousing
SHARED TOKENS (37): "act", "against", "applicants", "applies", "assistance", "authority", "banks", "business", "capacity", "codified", "community", "consumer", "defines", "development", "different", "federal", "finance", "financial", "government", "housing".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
airapplicablebuildingcentercommercialconsumerscoordinatededicateddeliverydemanddestinationsdirectlydistributionequipmentfunctioninventorylaborlargemarketname
SHARED TOKENS (37): "air", "applicable", "building", "center", "commercial", "consumers", "coordinate", "dedicated", "delivery", "demand", "destinations", "directly", "distribution", "equipment", "function", "inventory", "labor", "large", "market", "name".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
acquisitionanalysisassetsclassificationcompletionlawperiodprincipalprocesspropertyrecoverysystemtaxvaluezoning
SHARED TOKENS (15): "acquisition", "analysis", "assets", "classification", "completion", "law", "period", "principal", "process", "property", "recovery", "system", "tax", "value", "zoning". | EXACT TITLE in mortgage_lending: "Amortization".
0.500
accessactcommitteescontinuingexistingfederalfederallyformationfundingfundsfuturegovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningplans
SHARED TOKENS (28): "access", "act", "committees", "continuing", "existing", "federal", "federally", "formation", "funding", "funds", "future", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
broadercertaincoveringdevelopmentenvironmentalfocusgrowthindividualindustrialinfrastructurelandland-uselargerlawsmanagemanagementmilitarynationalnetworkplanning
SHARED TOKENS (35): "broader", "certain", "covering", "development", "environmental", "focus", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "laws", "manage", "management", "military", "national", "network", "planning".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescommunityconditionsdevelopmentdifferentdistinctemergencyenforcementenvironmentalfacilitiesfocusfunctionfunctioninggeneralindustrialindustryinfrastructureinstitutionslaw
SHARED TOKENS (42): "access", "agencies", "community", "conditions", "development", "different", "distinct", "emergency", "enforcement", "environmental", "facilities", "focus", "function", "functioning", "general", "industrial", "industry", "infrastructure", "institutions", "law".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in mortgage_lending: "Infrastructure".
0.500
agriculturalalongsidebillionconcentrateddevelopeddevelopmentdirectenvironmentalestimatesgroupgrowinggrowthimpactimproveincreaseindividuallivingmedicalpolicypopulation
SHARED TOKENS (29): "agricultural", "alongside", "billion", "concentrated", "developed", "development", "direct", "environmental", "estimates", "group", "growing", "growth", "impact", "improve", "increase", "individual", "living", "medical", "policy", "population".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in mortgage_lending: "Population growth".
0.500
affectdeterminedeterminingdiffersdocumentingestablishedestateframeworkinterestlandlawlegalotherwiseprincipalpublicrealrecordregisterregistrationsystem
SHARED TOKENS (22): "affect", "determine", "determining", "differs", "documenting", "established", "estate", "framework", "interest", "land", "law", "legal", "otherwise", "principal", "public", "real", "record", "register", "registration", "system".... | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
americanassetsbanksbillioncommercialconsumercorporateequivalentfailfinancialinstitutionsnonprofitoperationsperiodpublicretailservesmallsystemstrust
SHARED TOKENS (20): "american", "assets", "banks", "billion", "commercial", "consumer", "corporate", "equivalent", "fail", "financial", "institutions", "nonprofit", "operations", "period", "public", "retail", "serve", "small", "systems", "trust". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
anotherconditionsconsolidatedcontextcorporatedebtdifferentexistingfeesfinancefinancialhomeinterestmakesmanagementobligationspaymentperiodprimaryrate
SHARED TOKENS (26): "another", "conditions", "consolidated", "context", "corporate", "debt", "different", "existing", "fees", "finance", "financial", "home", "interest", "makes", "management", "obligations", "payment", "period", "primary", "rate".... | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
appliedassociationcannotcollateralcompletecostsdebtequityexistingfeefeesfutureinterestlawlegallienmakingoperationparcelpayment
SHARED TOKENS (33): "applied", "association", "cannot", "collateral", "complete", "costs", "debt", "equity", "existing", "fee", "fees", "future", "interest", "law", "legal", "lien", "making", "operation", "parcel", "payment".... | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
approximatelyarchitecturebecomebillioncommunitiesconditioncreatecreatescurrentdecadesdescribesdevelopeddevelopmenteconomicseducationenvironmentalequivalentgeographygrowthimpact
SHARED TOKENS (53): "approximately", "architecture", "become", "billion", "communities", "condition", "create", "creates", "current", "decades", "describes", "developed", "development", "economics", "education", "environmental", "equivalent", "geography", "growth", "impact".... | EXACT TITLE in mortgage_lending: "Urbanization".
0.500
boundariescompleteemployerfieldlaborlicenseperiodpotentialpracticepractitionersprofessionalreachregulatedstudysystemtraining
SHARED TOKENS (16): "boundaries", "complete", "employer", "field", "labor", "license", "period", "potential", "practice", "practitioners", "professional", "reach", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmenteconomicsgrowthhistoricallyimproveindividualinfrastructurelocalmarketpolicyprocessqualityregiontermswest
SHARED TOKENS (18): "according", "community", "describes", "development", "economics", "growth", "historically", "improve", "individual", "infrastructure", "local", "market", "policy", "process", "quality", "region", "terms", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
actchaptercodecodifiedcostsestatefeeslawobjectivepracticepracticesproceduresprocessproviderealreferralrequiresthemtitle
SHARED TOKENS (19): "act", "chapter", "code", "codified", "costs", "estate", "fees", "law", "objective", "practice", "practices", "procedures", "process", "provide", "real", "referral", "requires", "them", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
chaindocumentdocumentationdocumentshistoricallawofficeownershippresentpropertyrecordregistryservestitletransfers
SHARED TOKENS (15): "chain", "document", "documentation", "documents", "historical", "law", "office", "ownership", "present", "property", "record", "registry", "serves", "title", "transfers". | EXACT TITLE in mortgage_lending: "Chain of title".
0.500
articlechainconsumerconsumersconvertcreatingdirectdirectlydistributionfacilitiesindependentmanagementmaterialsnetworkproductproductsstructuresupplysystemsystems
SHARED TOKENS (22): "article", "chain", "consumer", "consumers", "convert", "creating", "direct", "directly", "distribution", "facilities", "independent", "management", "materials", "network", "product", "products", "structure", "supply", "system", "systems".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyairassetsauthoritycommercialcontroldepartmentfederalgovernmentorganizationpersonnelpowersregulatesstandardssurrounding
SHARED TOKENS (16): "administration", "agency", "air", "assets", "authority", "commercial", "control", "department", "federal", "government", "organization", "personnel", "powers", "regulates", "standards", "surrounding". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
acquiredacquisitionsadditionalairbranddestinationsextendsformformationhistoryindependentlaterlinesnetworkoperatesoperatingprincipalregionalstar
SHARED TOKENS (19): "acquired", "acquisitions", "additional", "air", "brand", "destinations", "extends", "form", "formation", "history", "independent", "later", "lines", "network", "operates", "operating", "principal", "regional", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
analyzebankscapacitycollateralcreatedetermineevenfinalguidelineslargermanagementmodelsprocessprovidequalityriskstermsuses
SHARED TOKENS (18): "analyze", "banks", "capacity", "collateral", "create", "determine", "even", "final", "guidelines", "larger", "management", "models", "process", "provide", "quality", "risks", "terms", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotherbesteasementsenteritselflandlawprivatelypropertypublicrealrightsroadstated
SHARED TOKENS (16): "access", "among", "another", "best", "easements", "enter", "itself", "land", "law", "privately", "property", "public", "real", "rights", "road", "stated". | EXACT TITLE in transportation_infrastructure: "Easement". | EXACT TITLE in mortgage_lending: "Easement".
0.500
authorityestategoverninggovernmentimprovementsincomejurisdictionlandnationalpropertyraterealregionrequiressystemtaxtransactionvaluewhose
SHARED TOKENS (19): "authority", "estate", "governing", "government", "improvements", "income", "jurisdiction", "land", "national", "property", "rate", "real", "region", "requires", "system", "tax", "transaction", "value", "whose". | EXACT TITLE in transportation_infrastructure: "Property tax". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
againstbusinesscollateralcommercialcostscoveragecoveredestateevidencefeefinancialformgeneralindependentinstitutionalinsuranceinsurersinterestlandlarge
SHARED TOKENS (39): "against", "business", "collateral", "commercial", "costs", "coverage", "covered", "estate", "evidence", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "insurers", "interest", "land", "large".... | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
administrationagencyairapproximatelyauthoritybillioncertaincombinedconnectingdatadepartmentdevelopsenforcementfacilitiesfederalgovernmentimprovelawlocalmission
SHARED TOKENS (34): "administration", "agency", "air", "approximately", "authority", "billion", "certain", "combined", "connecting", "data", "department", "develops", "enforcement", "facilities", "federal", "government", "improve", "law", "local", "mission".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincollectioncostsdedicatedequipmentfieldinformationlinesmaintainingmanagedmanagementmaterialmaterialsmilitarymodelmovingoperationalphysical
SHARED TOKENS (32): "according", "another", "chain", "collection", "costs", "dedicated", "equipment", "field", "information", "lines", "maintaining", "managed", "management", "material", "materials", "military", "model", "moving", "operational", "physical".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictexistingfederalfinancialfunctionsgovernmentimprovelocalofficeoperateoperatorsprimarilyprogramsproviderspublic
SHARED TOKENS (25): "administration", "agencies", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "government", "improve", "local", "office", "operate", "operators", "primarily", "programs", "providers", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmentexpansionfeefeesfundgovernmentgrowthimpactimprovementslocalneededpopulationprojectpublicreduce
SHARED TOKENS (18): "capital", "construction", "costs", "development", "expansion", "fee", "fees", "fund", "government", "growth", "impact", "improvements", "local", "needed", "population", "project", "public", "reduce". | EXACT TITLE in transportation_infrastructure: "Impact fee". | EXACT TITLE in mortgage_lending: "Impact fee".
0.500
assetsbroadercapitalcommunityconstructedconstructiondirectlyemploymentenvironmentalfacilitiesgovernmentinfrastructurelong-termmunicipaloperatorparksphysicalprivatepublicroads
SHARED TOKENS (26): "assets", "broader", "capital", "community", "constructed", "construction", "directly", "employment", "environmental", "facilities", "government", "infrastructure", "long-term", "municipal", "operator", "parks", "physical", "private", "public", "roads".... | EXACT TITLE in transportation_infrastructure: "Public works". | EXACT TITLE in mortgage_lending: "Public works".
0.500
alongsidebasecapitalcentralcollateraldebtdetermineeventfederalfinancingfundsfutureinterestinvestmentperiodpolicyprincipalraterates
SHARED TOKENS (19): "alongside", "base", "capital", "central", "collateral", "debt", "determine", "event", "federal", "financing", "funds", "future", "interest", "investment", "period", "policy", "principal", "rate", "rates". | EXACT TITLE in mortgage_lending: "Interest rate".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestatefarmgeneralgovernmentgrowinghousingintendedinterestlandlawlegalnonprofitownershipprivateproperty
SHARED TOKENS (26): "acquisition", "business", "commercial", "different", "entity", "estate", "farm", "general", "government", "growing", "housing", "intended", "interest", "land", "law", "legal", "nonprofit", "ownership", "private", "property".... | EXACT TITLE in transportation_infrastructure: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
0.500
abilityactactivityagencyauthorizedbanksbillionbrokerschargesconsumerconsumersdatadebtenforcementestablishedexistencefederalfeesfinancialfunding
SHARED TOKENS (44): "ability", "act", "activity", "agency", "authorized", "banks", "billion", "brokers", "charges", "consumer", "consumers", "data", "debt", "enforcement", "established", "existence", "federal", "fees", "financial", "funding".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
businesscreatedocumentdocumentseventsfinancialfunctionsgeneralincomeindividualinformationoperationsorganizationpaymentsprocessrealrecordrecordsreportreports
SHARED TOKENS (25): "business", "create", "document", "documents", "events", "financial", "functions", "general", "income", "individual", "information", "operations", "organization", "payments", "process", "real", "record", "records", "report", "reports".... | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
additionalassetscertaincollateraldatediscoveryfeefinancefinancialfundfutureinterestlatermanagersmarketmarketsmechanismotherwisepaymentphysical
SHARED TOKENS (35): "additional", "assets", "certain", "collateral", "date", "discovery", "fee", "finance", "financial", "fund", "future", "interest", "later", "managers", "market", "markets", "mechanism", "otherwise", "payment", "physical".... | EXACT TITLE in transportation_infrastructure: "Short (finance)". | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
accessairalternativesassociationcostsdevelopmentestatefeederfinancialfundinggeneralgovernmenthistoricalindustryinfrastructureintegratedintendedinvestmentlocalmodel
SHARED TOKENS (46): "access", "air", "alternatives", "association", "costs", "development", "estate", "feeder", "financial", "funding", "general", "government", "historical", "industry", "infrastructure", "integrated", "intended", "investment", "local", "model".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
appliedconstructioncontextcontroldescribedequipmentfunctionsindustrialinformationinvolvinglaborlargemobileoperationsotherwiseprimarysourcestructuresystemsuses
SHARED TOKENS (20): "applied", "construction", "context", "control", "described", "equipment", "functions", "industrial", "information", "involving", "labor", "large", "mobile", "operations", "otherwise", "primary", "source", "structure", "systems", "uses". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
agencyamericanannouncedassetsassociationbilliondebtdecadesdepartmentdescribedfederalfinancefinancialgovernmenthomehousinginvestmentjunemakingmanagement
SHARED TOKENS (34): "agency", "american", "announced", "assets", "association", "billion", "debt", "decades", "department", "described", "federal", "finance", "financial", "government", "home", "housing", "investment", "june", "making", "management".... | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
approveddepartmentfacilitiesfederalfocusfundsidentifiedindividuallocalmetropolitanmilitarynationalnetworkpipelineplanningroadsservingsystem
SHARED TOKENS (18): "approved", "department", "facilities", "federal", "focus", "funds", "identified", "individual", "local", "metropolitan", "military", "national", "network", "pipeline", "planning", "roads", "serving", "system". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingamericanauthorityboundariescertainconcentratedconsolidatedcountiesdifferentdistrictdistrictsdividedentitiesequivalentexistingformformergovernmentindependentlaw
SHARED TOKENS (33): "according", "american", "authority", "boundaries", "certain", "concentrated", "consolidated", "counties", "different", "district", "districts", "divided", "entities", "equivalent", "existing", "form", "former", "government", "independent", "law".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in mortgage_lending: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescommunicationsconstructiondeterminingdevelopmentequipmentestablishfeaturesgovernmenthistorylandlawlegalownershipplanningprofessionalpropertyresearchsales
SHARED TOKENS (22): "analysis", "boundaries", "communications", "construction", "determining", "development", "equipment", "establish", "features", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "research", "sales".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinesscapitalcollateralcommercialdemanddescribeddevelopeddirectlyestateeventexistingfeaturesfinancialformfundshomeinterestinvestmentlaw
SHARED TOKENS (39): "building", "business", "capital", "collateral", "commercial", "demand", "described", "developed", "directly", "estate", "event", "existing", "features", "financial", "form", "funds", "home", "interest", "investment", "law".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
adaairbaseboisecentercombinedcommercialdepartmentfieldfunctionsgeneralidahoincreasemilitarynationaloperatedoperatespermissionrequiringrights
SHARED TOKENS (24): "ada", "air", "base", "boise", "center", "combined", "commercial", "department", "field", "functions", "general", "idaho", "increase", "military", "national", "operated", "operates", "permission", "requiring", "rights".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
additionalagenciesanotherbanksbrokersbusinesscapitalcertaincommercialconsumerconsumersdirectlydiscoveryenterentityequityfederalfederallyfeefees
SHARED TOKENS (46): "additional", "agencies", "another", "banks", "brokers", "business", "capital", "certain", "commercial", "consumer", "consumers", "directly", "discovery", "enter", "entity", "equity", "federal", "federally", "fee", "fees".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
actadministrationagenciesagencyassistancedepartmentdevelopmentenforcefederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublicregulationsrehabilitation
SHARED TOKENS (23): "act", "administration", "agencies", "agency", "assistance", "department", "development", "enforce", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "rehabilitation".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actcertaincodifiedcompareconnectedconnectionconsumerconsumersfederalfeeslawlimitsmakingplanspracticesprincipalproceduresprohibitsratesregulates
SHARED TOKENS (25): "act", "certain", "codified", "compare", "connected", "connection", "consumer", "consumers", "federal", "fees", "law", "limits", "making", "plans", "practices", "principal", "procedures", "prohibits", "rates", "regulates".... | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
actaddressingagencyassistancechangescodifiedcontroldirectlyengineersenvironmentalfederalformfundinggoverninginvolvinglawlawsmaintainingnameobjective
SHARED TOKENS (33): "act", "addressing", "agency", "assistance", "changes", "codified", "control", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "involving", "law", "laws", "maintaining", "name", "objective".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
advancesbridgecommunityconnectingconnectionconstructedconstructioncreatecrossdeterminedengineersindustrialintendedlimitlocalnetworkpermittedphysicalprimarilyproduct
SHARED TOKENS (26): "advances", "bridge", "community", "connecting", "connection", "constructed", "construction", "create", "cross", "determined", "engineers", "industrial", "intended", "limit", "local", "network", "permitted", "physical", "primarily", "product".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in mortgage_lending: "Bridge".
0.500
associateddemandemergencygovernmenthomehousingincomeindexlocalmarketsmediannationalownershipresponsesupply
SHARED TOKENS (15): "associated", "demand", "emergency", "government", "home", "housing", "income", "index", "local", "markets", "median", "national", "ownership", "response", "supply". | EXACT TITLE in mortgage_lending: "Affordable housing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangescollectionconditionsconsolidationcontroldevelopeddirectlydistributionenvironmentalfieldformgrowthimprovementsirrigationland
SHARED TOKENS (40): "agricultural", "agriculture", "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "developed", "directly", "distribution", "environmental", "field", "form", "growth", "improvements", "irrigation", "land".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in mortgage_lending: "Irrigation".
0.500
accesscommunicationsdatadecadesdevelopmentdividedformindependentindividualinformationmediaphysicalreducedsingletechnology
SHARED TOKENS (15): "access", "communications", "data", "decades", "development", "divided", "form", "independent", "individual", "information", "media", "physical", "reduced", "single", "technology". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
activebusinesscapitalchangescontroldescribeddevelopmentequityexpansionfinancefinancialfinancingfundfundsgeneralinvestmentlong-termmanagementoperationalotherwise
SHARED TOKENS (31): "active", "business", "capital", "changes", "control", "described", "development", "equity", "expansion", "finance", "financial", "financing", "fund", "funds", "general", "investment", "long-term", "management", "operational", "otherwise".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
agenciesconstructiondepartmentsdistinguishgovernmentinfrastructurelocallymilitarymunicipalnationalphysicalplaceprivateprofessionalpublicroadssectorsystemsworks
SHARED TOKENS (19): "agencies", "construction", "departments", "distinguish", "government", "infrastructure", "locally", "military", "municipal", "national", "physical", "place", "private", "professional", "public", "roads", "sector", "systems", "works". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelybillionbusinessdirectlyfederallinesmanagedmetropolitannationalnetworkoperateoperatesoperatororganizationreportingservesouthsupport
SHARED TOKENS (21): "additional", "american", "approximately", "billion", "business", "directly", "federal", "lines", "managed", "metropolitan", "national", "network", "operate", "operates", "operator", "organization", "reporting", "serve", "south", "support".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
Credit risk ↗ Q162714 EXACT TITLE
againstanotherassetsassociatedbusinesscollectioncompleteconsumercostsdebtfailfinancialflowsfundsgeneralgovernmentinsuranceinterestmarketobligations
SHARED TOKENS (27): "against", "another", "assets", "associated", "business", "collection", "complete", "consumer", "costs", "debt", "fail", "financial", "flows", "funds", "general", "government", "insurance", "interest", "market", "obligations".... | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
accessadditionaladvertisingapprovedconsumerconsumersdateequityestatefinancialhomeincomeindependentinsuranceinterestlegalmarketmovepatternspayment
SHARED TOKENS (28): "access", "additional", "advertising", "approved", "consumer", "consumers", "date", "equity", "estate", "financial", "home", "income", "independent", "insurance", "interest", "legal", "market", "move", "patterns", "payment".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
agenciesalternativesapplydestinationsfacilitiesfuturegovernmentinfluencelinesmoveplanningprivateprocesspublicstakeholderssystem
SHARED TOKENS (16): "agencies", "alternatives", "apply", "destinations", "facilities", "future", "government", "influence", "lines", "move", "planning", "private", "process", "public", "stakeholders", "system". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Fannie Mae ↗ Q621096 EXACT TITLE
additionalassetsassociationestablishedfederalfinancialhomelocalmakingmarketnationalorganizationprocesssecondaryterms
SHARED TOKENS (15): "additional", "assets", "association", "established", "federal", "financial", "home", "local", "making", "market", "national", "organization", "process", "secondary", "terms". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.500
Reddit ↗ Q1136 EXACT TITLE
abilityaccordingacquiredamericanamongappearbillioncommunitiescontentcreatecurrentdatafeaturesindependentjunelinksmarketmedianewsoctober
SHARED TOKENS (30): "ability", "according", "acquired", "american", "among", "appear", "billion", "communities", "content", "create", "current", "data", "features", "independent", "june", "links", "market", "media", "news", "october".... | EXACT TITLE in mortgage_lending: "Reddit".
0.500
accessagenciesbeyondcommunitydevelopedextendsformgovernmentincomelocalmetropolitanmobilityoperateoperatedoperatesoperatorsprivateprovidepublicregulation
SHARED TOKENS (26): "access", "agencies", "beyond", "community", "developed", "extends", "form", "government", "income", "local", "metropolitan", "mobility", "operate", "operated", "operates", "operators", "private", "provide", "public", "regulation".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
Road ↗ Q34442 EXACT TITLE
accessanotherfeatureslandlocalplaceprimarilyprimaryprivatepublicroadroadsurbanwhose
SHARED TOKENS (14): "access", "another", "features", "land", "local", "place", "primarily", "primary", "private", "public", "road", "roads", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in mortgage_lending: "Road".
0.480
Escrow ↗ Q338451 EXACT TITLE
completedconditionsestablishedfundsinsurancemeaningnameobligationsprimaryprincipalpropertytaxestransactiontrust
SHARED TOKENS (14): "completed", "conditions", "established", "funds", "insurance", "meaning", "name", "obligations", "primary", "principal", "property", "taxes", "transaction", "trust". | EXACT TITLE in mortgage_lending: "Escrow".
0.480
associationenvironmentalindustriallandlandscapemobilityparkparksrightsruralserveservesurbanutility
SHARED TOKENS (14): "association", "environmental", "industrial", "land", "landscape", "mobility", "park", "parks", "rights", "rural", "serve", "serves", "urban", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.480
Utility ↗ Q466707 EXACT TITLE
amongbehaviorcertaincontextdevelopeddistincteconomicsfunctionfunctionsmaintainingobjectiverelationshipsourceutility
SHARED TOKENS (14): "among", "behavior", "certain", "context", "developed", "distinct", "economics", "function", "functions", "maintaining", "objective", "relationship", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in mortgage_lending: "Utility".
0.460
administrationagencydepartmentdivisionfederalofficepreviouslyprogramprogramspublicroadroadsrole
SHARED TOKENS (13): "administration", "agency", "department", "division", "federal", "office", "previously", "program", "programs", "public", "road", "roads", "role". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.440
Lien ↗ Q4469383 EXACT TITLE
applicationcertaindebtforminterestlienmeaningpaymentperformancepropertysecurityspecific
SHARED TOKENS (12): "application", "certain", "debt", "form", "interest", "lien", "meaning", "payment", "performance", "property", "security", "specific". | EXACT TITLE in transportation_infrastructure: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.440
articlecontrolscrossdifferentotherwisepracticeprimarilyroadroadsseparatespecifieduses
SHARED TOKENS (12): "article", "controls", "cross", "different", "otherwise", "practice", "primarily", "road", "roads", "separate", "specified", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.440
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcreatinghistoricallymobilitynetworkprofessionalrecordroadsruralshorturban
SHARED TOKENS (12): "american", "associated", "creating", "historically", "mobility", "network", "professional", "record", "roads", "rural", "short", "urban". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.440
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbanksbasecontroldevelopedfloodincreasinglandnearurbanvalleywater
SHARED TOKENS (12): "agricultural", "banks", "base", "control", "developed", "flood", "increasing", "land", "near", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.440
analysisanalyzeclassificationcorporatefinanciallabormanagementorganizationpositionpotentialrolewage
SHARED TOKENS (12): "analysis", "analyze", "classification", "corporate", "financial", "labor", "management", "organization", "position", "potential", "role", "wage". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.440
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingdirectlyfunctionindustriallargematerialsmovingparksproductionstandard
SHARED TOKENS (12): "agriculture", "associated", "building", "directly", "function", "industrial", "large", "materials", "moving", "parks", "production", "standard". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.420
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentimplementationintegratednetworkproviderequirementstechnologyuses
SHARED TOKENS (11): "access", "context", "data", "different", "implementation", "integrated", "network", "provide", "requirements", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.400
americancrossdiffersfieldpermitroadroadsstandardsystemuses
SHARED TOKENS (10): "american", "cross", "differs", "field", "permit", "road", "roads", "standard", "system", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.400
againsteventsfloodhomeinsurancepolicypropertyrequirerisksspecialized
SHARED TOKENS (10): "against", "events", "flood", "home", "insurance", "policy", "property", "require", "risks", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.380
codefederalhomehousinglawmanufacturedmobileregulatedregulations
SHARED TOKENS (9): "code", "federal", "home", "housing", "law", "manufactured", "mobile", "regulated", "regulations". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.380
Zillow ↗ Q8071921 EXACT TITLE
americancomcurrentestateformergrouprealreal-estatetechnology
SHARED TOKENS (9): "american", "com", "current", "estate", "former", "group", "real", "real-estate", "technology". | EXACT TITLE in mortgage_lending: "Zillow".
0.380
anotherconditionsdocumentfinanciallegalpaymentspecifiedsubjectterms
SHARED TOKENS (9): "another", "conditions", "document", "financial", "legal", "payment", "specified", "subject", "terms". | EXACT TITLE in mortgage_lending: "Promissory note".
0.380
divisionfinancialmitigationprocessreducerisksshorttermsworks
SHARED TOKENS (9): "division", "financial", "mitigation", "process", "reduce", "risks", "short", "terms", "works". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.360
applicationsapprovalbankscommercialevaluatefinancialinstitutionslicensed
SHARED TOKENS (8): "applications", "approval", "banks", "commercial", "evaluate", "financial", "institutions", "licensed". | EXACT TITLE in mortgage_lending: "Loan officer".
0.360
differentirrigationlawlegalphysicalsourcesystemswater
SHARED TOKENS (8): "different", "irrigation", "law", "legal", "physical", "source", "systems", "water". | EXACT TITLE in mortgage_lending: "Water right".
0.360
Sidewalk ↗ Q177749 EXACT TITLE
americanlandmobilityprimarilyprivateroadsidesouth
SHARED TOKENS (8): "american", "land", "mobility", "primarily", "private", "road", "side", "south". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.340
Trust deed ↗ Q7848150 EXACT TITLE
estategenerallawlegalrealsystemstrust
SHARED TOKENS (7): "estate", "general", "law", "legal", "real", "systems", "trust". | EXACT TITLE in mortgage_lending: "Trust deed".
0.340
costsestatefeespropertyrealtitletransaction
SHARED TOKENS (7): "costs", "estate", "fees", "property", "real", "title", "transaction". | EXACT TITLE in mortgage_lending: "Closing costs".
0.320
boiseexpansionformeridahooperatingserve
SHARED TOKENS (6): "boise", "expansion", "former", "idaho", "operating", "serve". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahourbanwestern
SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.300
administrationaffectaffectingaloneamongassociationbanksbilliondebtestateevenfederalfundfundsgovernmenthistoryhomehousingimpactincreasing
SHARED TOKENS (40): "administration", "affect", "affecting", "alone", "among", "association", "banks", "billion", "debt", "estate", "even", "federal", "fund", "funds", "government", "history", "home", "housing", "impact", "increasing"....
0.300
accesschaincostsdirecteconomicsgeneralgroupintendeditselfmaterialmovingoperatingpracticepracticesregionspecialized
SHARED TOKENS (16): "access", "chain", "costs", "direct", "economics", "general", "group", "intended", "itself", "material", "moving", "operating", "practice", "practices", "region", "specialized".
0.300
accordingagainstcertaincommunitydirectdistrictestatefinancialidentifiedprojectpublicratherrealspecifictax
SHARED TOKENS (15): "according", "against", "certain", "community", "direct", "district", "estate", "financial", "identified", "project", "public", "rather", "real", "specific", "tax".
0.300
americanassetscommercialentityestateinterestinvestmentlawperiodpropertyprovisionsrateratherrealresidentialsecuritystructuresubjecttaxtrust
SHARED TOKENS (20): "american", "assets", "commercial", "entity", "estate", "interest", "investment", "law", "period", "property", "provisions", "rate", "rather", "real", "residential", "security", "structure", "subject", "tax", "trust".
0.300
Parcel ↗ Q7136418 EXACT TITLE
deliverygeographyindividuallandparcel
SHARED TOKENS (5): "delivery", "geography", "individual", "land", "parcel". | EXACT TITLE in transportation_infrastructure: "Parcel". | EXACT TITLE in mortgage_lending: "Parcel".
0.300
accordingagreementsamongassociatedbanksbecomechartercommercialdebtdifferentestatefinancialfundinggeneralgeographicallyindividualinterestinvestmentlargemaking
SHARED TOKENS (39): "according", "agreements", "among", "associated", "banks", "become", "charter", "commercial", "debt", "different", "estate", "financial", "funding", "general", "geographically", "individual", "interest", "investment", "large", "making"....
0.300
accordingamongbasechangeschargesdirectdistinctfederalfundingfundsgovernmentimpliesindexinterestlegallymarketmarketspaymentpaymentsplaces
SHARED TOKENS (29): "according", "among", "base", "changes", "charges", "direct", "distinct", "federal", "funding", "funds", "government", "implies", "index", "interest", "legally", "market", "markets", "payment", "payments", "places"....
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentralengineersincreaselinesmakespermittedreducereducedrequireresearchroadrulesthemwork
SHARED TOKENS (16): "associated", "become", "central", "engineers", "increase", "lines", "makes", "permitted", "reduce", "reduced", "require", "research", "road", "rules", "them", "work".
0.300
accessactadministrationagainstagencycarecommunitiesconstructiondepartmentdevelopmentdifferentfacilitiesfederalfinancegovernmenthousinginsurancemarketnationaloffice
SHARED TOKENS (27): "access", "act", "administration", "against", "agency", "care", "communities", "construction", "department", "development", "different", "facilities", "federal", "finance", "government", "housing", "insurance", "market", "national", "office"....
0.300
Groundwater ↗ Q161598 KW CROSS HIGH
agriculturalagriculturebecomebillioncapacitycentralcontainsdistributionenvironmentalfieldformformationindustrialinfluencelandmunicipaloperatingpercentpresentprimary
SHARED TOKENS (33): "agricultural", "agriculture", "become", "billion", "capacity", "central", "contains", "distribution", "environmental", "field", "form", "formation", "industrial", "influence", "land", "municipal", "operating", "percent", "present", "primary"....
0.300
accordingcreatingdemanddisabilityformfunctionsmedicalmobilenetworkprivateprogramsprovidepublicratherrelevantruralsharedtechnology
SHARED TOKENS (18): "according", "creating", "demand", "disability", "form", "functions", "medical", "mobile", "network", "private", "programs", "provide", "public", "rather", "relevant", "rural", "shared", "technology".
0.300
accessadditionalapplicationassetsassociatedchargescollateralconventionalcostsequityestateeventfeefundsgeneralguidelineshomeinterestlienlines
SHARED TOKENS (36): "access", "additional", "application", "assets", "associated", "charges", "collateral", "conventional", "costs", "equity", "estate", "event", "fee", "funds", "general", "guidelines", "home", "interest", "lien", "lines"....
0.300
adaboisecanyoncombinedcountieshomeidaholargermeridianmetropolitanmountainnampanorthwestpacificpercentpopulationsectiontreasurevalley
SHARED TOKENS (19): "ada", "boise", "canyon", "combined", "counties", "home", "idaho", "larger", "meridian", "metropolitan", "mountain", "nampa", "northwest", "pacific", "percent", "population", "section", "treasure", "valley".
0.300
actagenciesagencybankscharterdepartmentestablishedfederalfederallyindependentinstitutionslicensednationalofficeregulatoryserves
SHARED TOKENS (16): "act", "agencies", "agency", "banks", "charter", "department", "established", "federal", "federally", "independent", "institutions", "licensed", "national", "office", "regulatory", "serves".
0.300
agenciesbanksconformingconventionalfeesincreasingindividualinterestlargelargerlimitlimitsqualityratesresidentialstandardthemvalue
SHARED TOKENS (18): "agencies", "banks", "conforming", "conventional", "fees", "increasing", "individual", "interest", "large", "larger", "limit", "limits", "quality", "rates", "residential", "standard", "them", "value".
0.300
approvalbuildingcannotcodecodescompletioncomplianceconstructiondevelopmentemploymentexpansionfinancinggovernmentlawlocalmanagednationalneededpermissionpermit
SHARED TOKENS (26): "approval", "building", "cannot", "code", "codes", "completion", "compliance", "construction", "development", "employment", "expansion", "financing", "government", "law", "local", "managed", "national", "needed", "permission", "permit"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralchargescommunitiesconnectingdifferentdistrictseastfeaturesinsidelinesmetropolitanoperateoperatespricingprimarilyregionalsystemsurban
SHARED TOKENS (19): "business", "central", "charges", "communities", "connecting", "different", "districts", "east", "features", "inside", "lines", "metropolitan", "operate", "operates", "pricing", "primarily", "regional", "systems", "urban".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedbehaviorbestcontrolenforcementeventguidelinesidentifiedimpactimproveoccupationalpracticesproducepublicremainrequiringroadroadsruralsafe
SHARED TOKENS (27): "applied", "behavior", "best", "control", "enforcement", "event", "guidelines", "identified", "impact", "improve", "occupational", "practices", "produce", "public", "remain", "requiring", "road", "roads", "rural", "safe"....
0.300
actauthorizedcapitalfundinggovernmenthousingincreasingintendedlargemarketpracticespressureprimarilyrecoveryregulations
SHARED TOKENS (15): "act", "authorized", "capital", "funding", "government", "housing", "increasing", "intended", "large", "market", "practices", "pressure", "primarily", "recovery", "regulations".
0.300
buildingbusinesscentercentraldedicateddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepublicrelationshipresidentialscaleservingurban
SHARED TOKENS (20): "building", "business", "center", "central", "dedicated", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "urban".
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
actactivityadvisoryamongannualapprovedapproximatelybanksbillioncapitalcentralcommercialcontroldecisionsdepartmentemploymententityestablishedeventsexpanded
SHARED TOKENS (52): "act", "activity", "advisory", "among", "annual", "approved", "approximately", "banks", "billion", "capital", "central", "commercial", "control", "decisions", "department", "employment", "entity", "established", "events", "expanded"....
0.300
administrationchargescommercialdepartmententitiesestatefederalfeefeesfundsgovernmenthousingincomeinsuranceinterestpaymentsprincipalprivateprocessrate
SHARED TOKENS (30): "administration", "charges", "commercial", "department", "entities", "estate", "federal", "fee", "fees", "funds", "government", "housing", "income", "insurance", "interest", "payments", "principal", "private", "process", "rate"....
0.300
actamericanassetsbanksbillioncapitalcentralcombinedcommercialconsumercreatedemanddepartmentdevelopmentemergencyestateestimatesexistingfederalfinancial
SHARED TOKENS (62): "act", "american", "assets", "banks", "billion", "capital", "central", "combined", "commercial", "consumer", "create", "demand", "department", "development", "emergency", "estate", "estimates", "existing", "federal", "financial"....
0.300
actadministrationagainstagenciesassetsauthoritybanksbillionbusinesscertainchangescollectioncomplianceconsumerconsumerscostsdataestablishedfailfederal
SHARED TOKENS (42): "act", "administration", "against", "agencies", "assets", "authority", "banks", "billion", "business", "certain", "changes", "collection", "compliance", "consumer", "consumers", "costs", "data", "established", "fail", "federal"....
0.300
accessibleadministrationagencyairamericananotherbranchbuildingcommercialconstructiondepartmentdistributiondivisiondriveeducationenvironmentalfederalgoverninghomeimprove
SHARED TOKENS (45): "accessible", "administration", "agency", "air", "american", "another", "branch", "building", "commercial", "construction", "department", "distribution", "division", "drive", "education", "environmental", "federal", "governing", "home", "improve"....
0.300
abilityavailabilitycentralconformingdebtdescribedestatefuturehousinglocalmarketmarketsnationalnearpolicypricespropertypublicrealregional
SHARED TOKENS (20): "ability", "availability", "central", "conforming", "debt", "described", "estate", "future", "housing", "local", "market", "markets", "national", "near", "policy", "prices", "property", "public", "real", "regional".
0.300
broadercollateralconformingdocumentationfinancialfundingfundsguidelinesinstitutionslacklargelimitprivatepropertyreal-estaterequire
SHARED TOKENS (16): "broader", "collateral", "conforming", "documentation", "financial", "funding", "funds", "guidelines", "institutions", "lack", "large", "limit", "private", "property", "real-estate", "require".
0.300
accessanotherapplicationapprovedassociatedcapitalchangesclassificationdescribeddevelopmentdifferentdirectformhomeimproveindividuallargelegalmovemoving
SHARED TOKENS (25): "access", "another", "application", "approved", "associated", "capital", "changes", "classification", "described", "development", "different", "direct", "form", "home", "improve", "individual", "large", "legal", "move", "moving"....
0.300
againstcertaincollateralconditionconsumerdebtdirectlyeducationequityfinancialhomeimprovementsindustryinterestinvestmentitselfmedicalperiodproductsproperty
SHARED TOKENS (26): "against", "certain", "collateral", "condition", "consumer", "debt", "directly", "education", "equity", "financial", "home", "improvements", "industry", "interest", "investment", "itself", "medical", "period", "products", "property"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecertaincrossdifferentestategovernmentlandlegallineslocaloperateotherwiseownershipphysicalprivaterealrightsroadroads
SHARED TOKENS (23): "authority", "capable", "certain", "cross", "different", "estate", "government", "land", "legal", "lines", "local", "operate", "otherwise", "ownership", "physical", "private", "real", "rights", "road", "roads"....
0.300
anotherarticlebecomecapacityconditiondemanddensitydepartmentsfocusincreasinginteractionmodeledplanningpublicroadroadsurban
SHARED TOKENS (17): "another", "article", "become", "capacity", "condition", "demand", "density", "departments", "focus", "increasing", "interaction", "modeled", "planning", "public", "road", "roads", "urban".
0.300
alongsideamericancapacitycapitalconnectingconventionaldedicatedfeaturesnetworkpublicqualityreducesinglesystemsystems
SHARED TOKENS (15): "alongside", "american", "capacity", "capital", "connecting", "conventional", "dedicated", "features", "network", "public", "quality", "reduce", "single", "system", "systems".
0.300
actagenciescollectionconsumerconsumersdatafederalfilesfinancialinformationintendedprivateregulatesreportingreports
SHARED TOKENS (15): "act", "agencies", "collection", "consumer", "consumers", "data", "federal", "files", "financial", "information", "intended", "private", "regulates", "reporting", "reports".
0.300
applicationappliedcapacitychangescollectionconditionsdifferentemergencyenforcefieldimproveincreaseinformationinfrastructurelawslimitmanagementmobilityprovidereduce
SHARED TOKENS (25): "application", "applied", "capacity", "changes", "collection", "conditions", "different", "emergency", "enforce", "field", "improve", "increase", "information", "infrastructure", "laws", "limit", "management", "mobility", "provide", "reduce"....
0.300
applicationapprovalcertainchaptercodeconsolidationdebtfinancialformgeneralgoverningincomeindividualplansplatformpropertyproviderequirementssectionsource
SHARED TOKENS (24): "application", "approval", "certain", "chapter", "code", "consolidation", "debt", "financial", "form", "general", "governing", "income", "individual", "plans", "platform", "property", "provide", "requirements", "section", "source"....
0.300
americanassistancecombinedcrossevenfacilitiesfeatureslargelawsotherwiseplaceroadroadsrulesschoolseparatetogether
SHARED TOKENS (17): "american", "assistance", "combined", "cross", "even", "facilities", "features", "large", "laws", "otherwise", "place", "road", "roads", "rules", "school", "separate", "together".
0.300
americanapplicationappliesbrokerscertaindifferentfinancialfundshomeindustrymarketmarketsnetworkplanningpolicyprocessresearchspecializedspecific
SHARED TOKENS (19): "american", "application", "applies", "brokers", "certain", "different", "financial", "funds", "home", "industry", "market", "markets", "network", "planning", "policy", "process", "research", "specialized", "specific".
0.300
appliedappliesapprovalassociationcontextdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactmakingmanagementmoveparticipationplanspolicypotential
SHARED TOKENS (31): "applied", "applies", "approval", "association", "context", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "making", "management", "move", "participation", "plans", "policy", "potential"....
0.300
accordingactagainstagencyamericanbanksbillioncapitalcertainchargescommercialconditionsconsumerconsumerscoveragedebtfederalfinancialfinancingfunctions
SHARED TOKENS (41): "according", "act", "against", "agency", "american", "banks", "billion", "capital", "certain", "charges", "commercial", "conditions", "consumer", "consumers", "coverage", "debt", "federal", "financial", "financing", "functions"....
0.300
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcertaincombinedconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomically
SHARED TOKENS (48): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "certain", "combined", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically"....
0.300
accessamericancapacitycentralchangescompletedconnectconnectedconnectingconstructedcontainingdecadesevenimpliesincreasinglimitsmediannetworkopenedplans
SHARED TOKENS (35): "access", "american", "capacity", "central", "changes", "completed", "connect", "connected", "connecting", "constructed", "containing", "decades", "even", "implies", "increasing", "limits", "median", "network", "opened", "plans"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleastgeneralidahonationalnearnorthwestofficialpacificparallelparkroadroadsruleswestwestern
SHARED TOKENS (16): "caldwell", "east", "general", "idaho", "national", "near", "northwest", "official", "pacific", "parallel", "park", "road", "roads", "rules", "west", "western".
0.300
actagainstagencyamongauthoritybankscommercialfederalfinancialformgroupinsuranceinterestinvestmentlargelaterlawmarketpdfregulatory
SHARED TOKENS (21): "act", "against", "agency", "among", "authority", "banks", "commercial", "federal", "financial", "form", "group", "insurance", "interest", "investment", "large", "later", "law", "market", "pdf", "regulatory"....
0.300
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastgrowingidahometropolitannamepopulationschoolschoolssharedstarwest
SHARED TOKENS (15): "ada", "boise", "canyon", "district", "east", "growing", "idaho", "metropolitan", "name", "population", "school", "schools", "shared", "star", "west".
0.300
agencyanotherassetsbanksbillioncollectioncommercialdebtdifferentestategovernmentgroupinterestinvestmentissuemarketobligationsofficeoutstandingpayment
SHARED TOKENS (36): "agency", "another", "assets", "banks", "billion", "collection", "commercial", "debt", "different", "estate", "government", "group", "interest", "investment", "issue", "market", "obligations", "office", "outstanding", "payment"....
0.300
conditionestablishestateformhomelandlivingmarketprocesspropertyrealreportreportsroletaxationvalue
SHARED TOKENS (16): "condition", "establish", "estate", "form", "home", "land", "living", "market", "process", "property", "real", "report", "reports", "role", "taxation", "value".
0.300
agencyapproveddepartmenteducationenforcementengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmentindependentinformationlawslegallocalmaintainingmatters
SHARED TOKENS (30): "agency", "approved", "department", "education", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "independent", "information", "laws", "legal", "local", "maintaining", "matters"....
0.300
againstapplycommercialcurrentdescribingestatefeaturesfinalinterestlargemarketpaymentpaymentsprincipalpropertyprovisionsrateratesrealresidential
SHARED TOKENS (24): "against", "apply", "commercial", "current", "describing", "estate", "features", "final", "interest", "large", "market", "payment", "payments", "principal", "property", "provisions", "rate", "rates", "real", "residential"....
0.300
affectinganalysisapplicationbusinesschangesdemandeconomicsestatefieldfinancehousingindustrymarketspatternsrealresearchresidentialscopesupplyurban
SHARED TOKENS (20): "affecting", "analysis", "application", "business", "changes", "demand", "economics", "estate", "field", "finance", "housing", "industry", "markets", "patterns", "real", "research", "residential", "scope", "supply", "urban".
0.300
administersassistancebusinesscommunitiescommunitydevelopmentdistrictfundinghousingimpactindependentlocalmitigationnationalneighborhoodnetworknonprofitorganizationpreserveprofessional
SHARED TOKENS (30): "administers", "assistance", "business", "communities", "community", "development", "district", "funding", "housing", "impact", "independent", "local", "mitigation", "national", "neighborhood", "network", "nonprofit", "organization", "preserve", "professional"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciesamericancanyoncentralcommercialconstructedconstructioncontrolcovereddecadesdevelopedeastfeaturesfloodflowshistoryidahoirrigationlargemilitary
SHARED TOKENS (40): "agencies", "american", "canyon", "central", "commercial", "constructed", "construction", "control", "covered", "decades", "developed", "east", "features", "flood", "flows", "history", "idaho", "irrigation", "large", "military"....
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
additionalamericanapplicationapprovedconformingconstructiondepartmentdirectlyfeefinancingfundingguidelineshomeimprovementsincomeinsuranceinterestlargerlawslimit
SHARED TOKENS (36): "additional", "american", "application", "approved", "conforming", "construction", "department", "directly", "fee", "financing", "funding", "guidelines", "home", "improvements", "income", "insurance", "interest", "larger", "laws", "limit"....
0.300
analysiscommercialcostsdefinitionsdependsdevelopeddevelopmentdifferentincreaseindustriallandpolicypresentpreviouslyrequirerequiressitespecializedstudy
SHARED TOKENS (19): "analysis", "commercial", "costs", "definitions", "depends", "developed", "development", "different", "increase", "industrial", "land", "policy", "present", "previously", "require", "requires", "site", "specialized", "study".
0.300
acquisitionagainstavailabilitycenterconsumerdependsfeesformerfundsinstitutionsinsurersinterestlargelawlegalliennationalprincipalproceduresproduce
SHARED TOKENS (28): "acquisition", "against", "availability", "center", "consumer", "depends", "fees", "former", "funds", "institutions", "insurers", "interest", "large", "law", "legal", "lien", "national", "principal", "procedures", "produce"....
0.300
administrationagencyamericanassistancebillionbranchcostsdepartmentdisabilityeducationemergencyestablishedestimatedexpandedfacilitiesfederalfuturegovernmenthealthcarehome
SHARED TOKENS (30): "administration", "agency", "american", "assistance", "billion", "branch", "costs", "department", "disability", "education", "emergency", "established", "estimated", "expanded", "facilities", "federal", "future", "government", "healthcare", "home"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthomehousinglawsprogramreportsurban
SHARED TOKENS (15): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "government", "home", "housing", "laws", "program", "reports", "urban".
0.300
abilityadministrationagencyauthoritybanksdepartmentdevelopmententitiesexpandedfederalfinancehomehousingindependentinsurancelegalmissionofficeplacepowers
SHARED TOKENS (27): "ability", "administration", "agency", "authority", "banks", "department", "development", "entities", "expanded", "federal", "finance", "home", "housing", "independent", "insurance", "legal", "mission", "office", "place", "powers"....
0.300
actamericanapplicableappliescodeconcerningdevelopmentdifferentenforcementexpandedfederalfinancingfundinghousinglawmakesnationalprivateprogramsprovisions
SHARED TOKENS (24): "act", "american", "applicable", "applies", "code", "concerning", "development", "different", "enforcement", "expanded", "federal", "financing", "funding", "housing", "law", "makes", "national", "private", "programs", "provisions"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
analysisbanksconsumersdatadebtdepartmentsdetermineevaluatefilesfinancegovernmentindividualinformationinsuranceinterestlimitsmobilepotentialprimarilyrate
SHARED TOKENS (21): "analysis", "banks", "consumers", "data", "debt", "departments", "determine", "evaluate", "files", "finance", "government", "individual", "information", "insurance", "interest", "limits", "mobile", "potential", "primarily", "rate"....
0.300
combinedconnectsconsumerscurrentdeliverydirectdirectlydistinctdistributionevenformhistoricallyincreaseindustrylineslocalmarketnetworkreducedregulation
SHARED TOKENS (23): "combined", "connects", "consumers", "current", "delivery", "direct", "directly", "distinct", "distribution", "even", "form", "historically", "increase", "industry", "lines", "local", "market", "network", "reduced", "regulation"....
0.300
actadaagainstbusinesschangescostscovereddisabilityeffectiveemployersfinallaterlawnationalprohibitsprotectionsprovidepublicrequirementsrequires
SHARED TOKENS (21): "act", "ada", "against", "business", "changes", "costs", "covered", "disability", "effective", "employers", "final", "later", "law", "national", "prohibits", "protections", "provide", "public", "requirements", "requires"....
0.300
announcedapprovedbillioncentercreateitselflaternetworkoperatesoperatingpacificplansprincipalprojectreachreportingroadsystemwestwestern
SHARED TOKENS (20): "announced", "approved", "billion", "center", "create", "itself", "later", "network", "operates", "operating", "pacific", "plans", "principal", "project", "reach", "reporting", "road", "system", "west", "western".
0.300
accessactadditionaladministrationapproximatelybillionbranchcollectioncompleteconstructioncreatingdecadesdevelopedequivalentestablishedextendsfederalfundfundingfuture
SHARED TOKENS (41): "access", "act", "additional", "administration", "approximately", "billion", "branch", "collection", "complete", "construction", "creating", "decades", "developed", "equivalent", "established", "extends", "federal", "fund", "funding", "future"....
0.300
administrationagenciesagencyamericanassetsbankscentralchartercommercialcommunitydevelopmentfederalfederallyfundfundsgovernmentindependentinstitutionsinsurancenational
SHARED TOKENS (24): "administration", "agencies", "agency", "american", "assets", "banks", "central", "charter", "commercial", "community", "development", "federal", "federally", "fund", "funds", "government", "independent", "institutions", "insurance", "national"....
0.300
accessagainstcollateralextendsfinancefinancialinterestmaintainingmarketotherwisepaymentpracticequalityratesscheduletermsuniversity
SHARED TOKENS (17): "access", "against", "collateral", "extends", "finance", "financial", "interest", "maintaining", "market", "otherwise", "payment", "practice", "quality", "rates", "schedule", "terms", "university".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationairanalysisanotherarchitecturebroaderbusinesscapitalcodescommunicationscommunitiescommunitycreatingdevelopmentdifferentdistributionenvironmentalexistingfieldfocus
SHARED TOKENS (55): "administration", "air", "analysis", "another", "architecture", "broader", "business", "capital", "codes", "communications", "communities", "community", "creating", "development", "different", "distribution", "environmental", "existing", "field", "focus"....
0.300
accordingactivityanalysisboundariescalculationsdocumentationengineersestablishedgeneralgovernmentlegallicenselicensedlicensurelocalplanspracticepractitionersprocessproduct
SHARED TOKENS (34): "according", "activity", "analysis", "boundaries", "calculations", "documentation", "engineers", "established", "general", "government", "legal", "license", "licensed", "licensure", "local", "plans", "practice", "practitioners", "process", "product"....
0.300
Financial literacy ↗ KW CROSS HIGH
abilityagenciesauthoritybehaviorcalculationscannotcostsdebtdecisionsdevelopmenteducationestablishedfinancefinancialfocusfuturegovernmentimproveindividualinformation
SHARED TOKENS (35): "ability", "agencies", "authority", "behavior", "calculations", "cannot", "costs", "debt", "decisions", "development", "education", "established", "finance", "financial", "focus", "future", "government", "improve", "individual", "information"....
0.300
academiccollegecommunitydifferenteducationforminstitutionspolicyprogramsschoolsecondaryseniorstudentsuniversityworkforce
SHARED TOKENS (15): "academic", "college", "community", "different", "education", "form", "institutions", "policy", "programs", "school", "secondary", "senior", "students", "university", "workforce".
0.300
Home equity loan ↗ KW CROSS HIGH
againstcannotcollateralcollegecombinedcreatesdeterminededucationequityfinancehistoryhomeincomeinterestlawlienlimitlinesmedicalpayment
SHARED TOKENS (28): "against", "cannot", "collateral", "college", "combined", "creates", "determined", "education", "equity", "finance", "history", "home", "income", "interest", "law", "lien", "limit", "lines", "medical", "payment"....
0.300
Trailer park ↗ Q1426493 KW CROSS HIGH
advancesamericancommunityconstructionhomehousingincomelivingmanufacturedmobilemovingparkparksplacestructurestechnologytemporary
SHARED TOKENS (17): "advances", "american", "community", "construction", "home", "housing", "income", "living", "manufactured", "mobile", "moving", "park", "parks", "place", "structures", "technology", "temporary".
0.300
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbridgebusinessconventionalcostsdocumentationequityfeesfinancefinancingindividualinterestlargerparticipationperiodraterequiresouth
SHARED TOKENS (19): "additional", "applications", "bridge", "business", "conventional", "costs", "documentation", "equity", "fees", "finance", "financing", "individual", "interest", "larger", "participation", "period", "rate", "require", "south".
0.300
annualappliedbankscompareconsumerdefinitionseffectivefeefinanceformintendedinterestlegalrateratherstandardizedterms
SHARED TOKENS (17): "annual", "applied", "banks", "compare", "consumer", "definitions", "effective", "fee", "finance", "form", "intended", "interest", "legal", "rate", "rather", "standardized", "terms".
0.300
Pollution ↗ Q58734 KW CROSS HIGH
agenciesagriculturalagricultureairalongsideapproximatelyboundariescommunitiesconcentratedconstructiondevelopmentenvironmentaleventsformformationhistoricallyimpactimpliesincreasinglater
SHARED TOKENS (37): "agencies", "agricultural", "agriculture", "air", "alongside", "approximately", "boundaries", "communities", "concentrated", "construction", "development", "environmental", "events", "form", "formation", "historically", "impact", "implies", "increasing", "later"....
0.300
actactiveagenciesairapproximatelyauthorityauthorizedbillionbranchbuildingbusinesscapacitycombinedconstructioncontroldepartmentdirectdirectlyeastengineers
SHARED TOKENS (63): "act", "active", "agencies", "air", "approximately", "authority", "authorized", "billion", "branch", "building", "business", "capacity", "combined", "construction", "control", "department", "direct", "directly", "east", "engineers"....
0.300
administrationagenciesagricultureassociationcollateralcostsdepartmentdevelopmenteffectiveevenfederalfederallyfinancialfinancinggovernmenthomehousinginterestnationaloffice
SHARED TOKENS (29): "administration", "agencies", "agriculture", "association", "collateral", "costs", "department", "development", "effective", "even", "federal", "federally", "financial", "financing", "government", "home", "housing", "interest", "national", "office"....
0.300
actagenciesamericanamonganotherapproximatelybillionbroaderchangesconsumersdebtdifferentestimatedevenfinancialfundsgovernmenthousingincomeincrease
SHARED TOKENS (35): "act", "agencies", "american", "among", "another", "approximately", "billion", "broader", "changes", "consumers", "debt", "different", "estimated", "even", "financial", "funds", "government", "housing", "income", "increase"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbrandbrandedbusinesscapitalcertainchainconditionscontrollingcorporatedirectentityexpansionfeesfinancialgrowthindividualinvestmentlargelaws
SHARED TOKENS (38): "another", "brand", "branded", "business", "capital", "certain", "chain", "conditions", "controlling", "corporate", "direct", "entity", "expansion", "fees", "financial", "growth", "individual", "investment", "large", "laws"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedconnectdevelopmenteasementsevenexpandedfeefinalfunctionsgovernmentimpactinterestlandlaterlegalownershippayment
SHARED TOKENS (34): "acquisition", "another", "application", "authorized", "connect", "development", "easements", "even", "expanded", "fee", "final", "functions", "government", "impact", "interest", "land", "later", "legal", "ownership", "payment"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
additionaladministrationagencyagricultureapplicantsapplicationapprovedbeyondcertainclassificationcodifiedconditionsconsumerdefinesdepartmentemployeremployersemploymentequivalentestimated
SHARED TOKENS (44): "additional", "administration", "agency", "agriculture", "applicants", "application", "approved", "beyond", "certain", "classification", "codified", "conditions", "consumer", "defines", "department", "employer", "employers", "employment", "equivalent", "estimated"....
0.300
additionalagenciescarecertaincontactdepartmentdriveemergencyfacilitieshistoricallymedicalmodeloperatepersonnelplacespresentprimaryprovidepublicqualification
SHARED TOKENS (29): "additional", "agencies", "care", "certain", "contact", "department", "drive", "emergency", "facilities", "historically", "medical", "model", "operate", "personnel", "places", "present", "primary", "provide", "public", "qualification"....
0.300
agriculturalagricultureannualapprovalcollectioncontextdefinitionsdevelopmentdividedevenirrigationlandorganizationperiodpermittedpresentproduceproducingproductionrequire
SHARED TOKENS (23): "agricultural", "agriculture", "annual", "approval", "collection", "context", "definitions", "development", "divided", "even", "irrigation", "land", "organization", "period", "permitted", "present", "produce", "producing", "production", "require"....
0.300
administrationagenciesamongchangescommunitiescompliancecontentcontrolcurrentdefinesdepartmentdevelopeddiffersdocumentfederallawlocalnationalprivatelypublic
SHARED TOKENS (26): "administration", "agencies", "among", "changes", "communities", "compliance", "content", "control", "current", "defines", "department", "developed", "differs", "document", "federal", "law", "local", "national", "privately", "public"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
cannotcombinedconnecteveninfrastructureinsidelargemanagemunicipalparkspropertypublicrequireresidentialroadssewersmallsystemswater
SHARED TOKENS (19): "cannot", "combined", "connect", "even", "infrastructure", "inside", "large", "manage", "municipal", "parks", "property", "public", "require", "residential", "roads", "sewer", "small", "systems", "water".
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdefinitionsdifferentequivalentformindividualmeaningoperateoperatesoperatingoperationsprimarilysectionsystemsystemstechnologytogetherurban
SHARED TOKENS (21): "broader", "capacity", "conditions", "definitions", "different", "equivalent", "form", "individual", "meaning", "operate", "operates", "operating", "operations", "primarily", "section", "system", "systems", "technology", "together", "urban"....
0.300
abilityassociatedcommercialdatedebtequityestatefinancialfuturehomeimprovelatermakingmarketpaymentsprocesspropertyrealremainresidential
SHARED TOKENS (23): "ability", "associated", "commercial", "date", "debt", "equity", "estate", "financial", "future", "home", "improve", "later", "making", "market", "payments", "process", "property", "real", "remain", "residential"....
0.300
Bankruptcy ↗ Q152074 EXACT TITLE
cannotentitieslegalmeaningprocess
SHARED TOKENS (5): "cannot", "entities", "legal", "meaning", "process". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.300
amongassetsestatefinancialhousingincreaseinvolvinglargelargermakingmarketperiodpricesrealreal-estate
SHARED TOKENS (15): "among", "assets", "estate", "financial", "housing", "increase", "involving", "large", "larger", "making", "market", "period", "prices", "real", "real-estate".
0.300
actapprovalapprovalsapprovedbuildingcommercialconstructioncontextcostscreatesdeterminedevelopmentdifferentengineersenvironmentalestateexistingexpandsfinancialfinancing
SHARED TOKENS (46): "act", "approval", "approvals", "approved", "building", "commercial", "construction", "context", "costs", "creates", "determine", "development", "different", "engineers", "environmental", "estate", "existing", "expands", "financial", "financing"....
🫐 BERRY53 edges
0.280
authorityboundariesdistrictdistrictsentitygovernmentirrigationlargelocalpublicstatutesubdivisiontaxwater
SHARED TOKENS (14): "authority", "boundaries", "district", "districts", "entity", "government", "irrigation", "large", "local", "public", "statute", "subdivision", "tax", "water".
0.280
Snowplow ↗ Q14976 EXACT TITLE
intendedlargeservingspecific
SHARED TOKENS (4): "intended", "large", "serving", "specific". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.280
branchfieldinvolvingnetwork
SHARED TOKENS (4): "branch", "field", "involving", "network". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.280
accesscommunitycompleteengineersenvironmentalhomelivingoperatedpolicypractitionerspublicrequiressafeurban
SHARED TOKENS (14): "access", "community", "complete", "engineers", "environmental", "home", "living", "operated", "policy", "practitioners", "public", "requires", "safe", "urban".
0.270
branchcurrentgovernmentidahoofficeposition
SHARED TOKENS (6): "branch", "current", "government", "idaho", "office", "position". | URL->B (1): https://sos.idaho.gov/.
0.260
Mobile home ↗ Q1434998 KW CROSS HIGH
basedifferenthomelegalmobilemoveparkplaceprimarilysitestructuretemporarywork
SHARED TOKENS (13): "base", "different", "home", "legal", "mobile", "move", "park", "place", "primarily", "site", "structure", "temporary", "work".
0.260
aircreateuses
SHARED TOKENS (3): "air", "create", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
capitalcommercialconventionalestatefinancingfundsinterestprivatepropertyratesrealresidentialspecific
SHARED TOKENS (13): "capital", "commercial", "conventional", "estate", "financing", "funds", "interest", "private", "property", "rates", "real", "residential", "specific".
0.260
actamericanamongapplychangeschaptercodeconsumerconsumerslawoctoberpdfprovisions
SHARED TOKENS (13): "act", "american", "among", "apply", "changes", "chapter", "code", "consumer", "consumers", "law", "october", "pdf", "provisions".
0.260
Traffic light ↗ Q8004 KW CROSS HIGH
capacitycontrolflowsinformationlawslocalnationalreduceroadsouthsystemsystemstechnology
SHARED TOKENS (13): "capacity", "control", "flows", "information", "laws", "local", "national", "reduce", "road", "south", "system", "systems", "technology".
0.260
constructiondateimproveinterestitselflaborlienmaterialsmeaningpropertyrealsecuritytitle
SHARED TOKENS (13): "construction", "date", "improve", "interest", "itself", "labor", "lien", "materials", "meaning", "property", "real", "security", "title".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
airbridgeconstructionequipmentindustrialinfrastructurelargelegallimitsroadspecifiedstandardwater
SHARED TOKENS (13): "air", "bridge", "construction", "equipment", "industrial", "infrastructure", "large", "legal", "limits", "road", "specified", "standard", "water".
0.240
abilityaccordinginterestpaymentpaymentspresentrateratesrealremainssinglevalue
SHARED TOKENS (12): "ability", "according", "interest", "payment", "payments", "present", "rate", "rates", "real", "remains", "single", "value".
0.240
additionalhomeincomeprincipalpropertyprovideresidentialsecondarysecurityseparatesmallsupport
SHARED TOKENS (12): "additional", "home", "income", "principal", "property", "provide", "residential", "secondary", "security", "separate", "small", "support".
0.240
becomechangesengineersfocusgrowingimprovephysicalroadroadsruleurbanuses
SHARED TOKENS (12): "become", "changes", "engineers", "focus", "growing", "improve", "physical", "road", "roads", "rule", "urban", "uses".
0.240
allocationbusinessdifferenteconomicsestatehousinglandmarketrealreal-estateresidentialsingle
SHARED TOKENS (12): "allocation", "business", "different", "economics", "estate", "housing", "land", "market", "real", "real-estate", "residential", "single".
0.220
agencyairboisedepartmentgovernmentidahomilitarynationalpotentialsecurityserve
SHARED TOKENS (11): "agency", "air", "boise", "department", "government", "idaho", "military", "national", "potential", "security", "serve".
0.220
creatingdepartmentdifferentdividedevenpathwaypermitprimaryprovidesharedurban
SHARED TOKENS (11): "creating", "department", "different", "divided", "even", "pathway", "permit", "primary", "provide", "shared", "urban".
0.220
americandepartmentdepartmentsdirectlyfederalgovernmentmissionreportssafeservingsystem
SHARED TOKENS (11): "american", "department", "departments", "directly", "federal", "government", "mission", "reports", "safe", "serving", "system".
0.220
academicapplicationfacilitiesfieldmanagementoccupationaloperationplanningprovidesafetechnology
SHARED TOKENS (11): "academic", "application", "facilities", "field", "management", "occupational", "operation", "planning", "provide", "safe", "technology".
0.220
banksbuildingcovereddeterminedequityestatefinancialpropertyrealtransactionvalue
SHARED TOKENS (11): "banks", "building", "covered", "determined", "equity", "estate", "financial", "property", "real", "transaction", "value".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in transportation_infrastructure: "Subdivision". | EXACT TITLE in mortgage_lending: "Subdivision".
0.200
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalapprovedbrandconditionsdetermineindependentrolespecifictechnicianwork
SHARED TOKENS (10): "approval", "approved", "brand", "conditions", "determine", "independent", "role", "specific", "technician", "work".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
accessconnectingformerlocalmoveprovideresidentialroadroadsserves
SHARED TOKENS (10): "access", "connecting", "former", "local", "move", "provide", "residential", "road", "roads", "serves".
0.200
boundariesconveyancedescribeddescriptionlandlawlegalpropertyrealspecific
SHARED TOKENS (10): "boundaries", "conveyance", "described", "description", "land", "law", "legal", "property", "real", "specific".
0.200
constructionengineersflowsfuturematerialsoperationplanningprofessionalroadsstandards
SHARED TOKENS (10): "construction", "engineers", "flows", "future", "materials", "operation", "planning", "professional", "roads", "standards".
0.200
boisecrosshomeidahometropolitanmountainnearnorthwestprimarilyserves
SHARED TOKENS (10): "boise", "cross", "home", "idaho", "metropolitan", "mountain", "near", "northwest", "primarily", "serves".
0.180
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahometropolitanmunicipalnamepopulationseparate
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "name", "population", "separate".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationruralwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.180
chaptercodefederalformlawsprocesssectionstatutetitle
SHARED TOKENS (9): "chapter", "code", "federal", "form", "laws", "process", "section", "statute", "title".
0.180
bankscanyonconnectingeagleeastidahomeridiannampavalley
SHARED TOKENS (9): "banks", "canyon", "connecting", "eagle", "east", "idaho", "meridian", "nampa", "valley".
0.160
USDA home loan ↗ KW CROSS HIGH
agriculturedepartmentdevelopmenthomehousingprogrampropertyrural
SHARED TOKENS (8): "agriculture", "department", "development", "home", "housing", "program", "property", "rural".
0.160
airamericancommerciallandmilitaryphysicalprocessproducts
SHARED TOKENS (8): "air", "american", "commercial", "land", "military", "physical", "process", "products".
0.160
againstcoveragedeterminefloodinsuranceinsurerspropertyspecific
SHARED TOKENS (8): "against", "coverage", "determine", "flood", "insurance", "insurers", "property", "specific".
0.140
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
eastidahopriorsouthsystemwestwestern
SHARED TOKENS (7): "east", "idaho", "prior", "south", "system", "west", "western".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
affectingdebtgenerallegalprocesstermstrust
SHARED TOKENS (7): "affecting", "debt", "general", "legal", "process", "terms", "trust".
0.140
Park and ride ↗ Q738031 KW CROSS HIGH
largemarketingmetropolitanparkpublicroadsystem
SHARED TOKENS (7): "large", "marketing", "metropolitan", "park", "public", "road", "system".
0.140
estateformfunctionshomehousinginvestmentreal
SHARED TOKENS (7): "estate", "form", "functions", "home", "housing", "investment", "real".
0.140
Negative equity ↗ KW CROSS HIGH
assetsequityestateoutstandingrealvaluewhose
SHARED TOKENS (7): "assets", "equity", "estate", "outstanding", "real", "value", "whose".
0.140
anotherconvertinterestpaymentperiodpreviouslyprincipal
SHARED TOKENS (7): "another", "convert", "interest", "payment", "period", "previously", "principal".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
agriculturaleastidaholandnorthwestprimarily
SHARED TOKENS (6): "agricultural", "east", "idaho", "land", "northwest", "primarily".
0.120
chartercountiesgoverninglegallocalmunicipal
SHARED TOKENS (6): "charter", "counties", "governing", "legal", "local", "municipal".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
Bike lane ↗ Q1378400 KW CROSS HIGH
advisoryimprovepermittedresearchroadshows
SHARED TOKENS (6): "advisory", "improve", "permitted", "research", "road", "shows".
0.100
adaconnectingcountiesidahostar
SHARED TOKENS (5): "ada", "connecting", "counties", "idaho", "star".
0.100
airamericanboiseidaholines
SHARED TOKENS (5): "air", "american", "boise", "idaho", "lines".
0.100
commerciallargelicensematerialsoperate
SHARED TOKENS (5): "commercial", "large", "license", "materials", "operate".
0.100
costsitselfreducedroadsecurity
SHARED TOKENS (5): "costs", "itself", "reduced", "road", "security".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
How do new highway projects in Ada County affect mortgage lending rates for properties near construction zones?
Lenders in the Treasure Valley adjust risk assessments for mortgages on properties adjacent to Ada County's expanding transportation corridors, as development activity typically increases property values within 2-3 years of highway completion. Construction timeline certainty from Boise and Nampa city planning departments directly influences how mortgage originators price loans for these areas, since infrastructure certainty reduces long-term financing risk.
Why do mortgage lenders favor properties in Eagle, Idaho with direct freeway access over comparable homes without transportation infrastructure?
Eagle, Idaho properties with established road connections to Boise command higher appraisals because commute times to employment centers in Ada County are predictable and documented, reducing default risk in mortgage portfolios. Lenders at Treasure Valley institutions prioritize these locations because transportation infrastructure directly correlates with sustained property value appreciation and borrower employment stability.
What role does Caldwell's land-use planning decisions play in mortgage availability for suburban development projects?
Caldwell's zoning approvals and designated transportation corridors determine which suburban parcels qualify for construction financing and permanent mortgages from regional lenders. When Caldwell's planning department designates new development zones with integrated road access, mortgage lending volume for residential and commercial projects in those areas increases because infrastructure certainty exists before construction begins.
How do College of Western Idaho and Boise State University's locations influence mortgage lending patterns across the Treasure Valley?
Mortgage lenders offer favorable terms on properties within defined transportation corridors connecting Nampa, Boise, and Ada County to these institutions, as student housing demand and staff commuting patterns are documented and predictable. Both institutions' campus expansion plans, coordinated through regional land-use planning, directly signal to lenders where property appreciation will occur along specific transportation routes.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Mortgage Lending 18 QID bridges 255 edges 6,315 ext links 2026-07-17 23:42:16 UTC c5193ab225ac0acc
Transportation Infrastructure corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals