—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Automotive

13 Wikipedia bridge articles confirmed in both vertical ledgers. 238 deterministic cross-vertical edges. 7,043 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
238 Cross Edges
7,043 External Sources
291 Wikipedia Articles
17 🌲 Evergreen
118 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Automotive
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
238
External Sources Harvested
7,043
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.0100  ·  type: exact_title_cross  ·  8 shared tokens
QID Bridge Titles (13)
Idaho State PoliceTreasure ValleyCaldwell, IdahoMeridian, IdahoEagle, IdahoTrucking industry in the United StatesBoise, IdahoInterstate 84 in IdahoDiesel engineNampa, IdahoAuto mechanicAda County, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisemileshomeoregonadanorthwestpubliclocalrivercanyoncapitalseconddepartmentnameprimarilyregiontreasurevalleywestern
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:38:57 UTC
Content Hash
693aab4157d306d0
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.010
QID OVERLAP: Q5987459 in transportation_infrastructure (tier:evergreen) and automotive (tier:evergreen). | SHARED TOKENS (8): "department", "idaho", "isp", "law", "legislature", "police", "present", "public". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police". | EXACT TITLE in automotive: "Idaho State Police".
departmentidahoisplawlegislaturepolicepresentpublic
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
ate constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major. Each district has two divisions; patrol and investigations. Patrol The patrol division consists of uniformed state troopers who enforce the laws of Idaho.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and automotive (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "eastern", "idaho", "local", "name", "oregon", "primarily", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in automotive: "Treasure Valley".
associationboiseeasternidaholocalnameoregonprimarilyregionresourcesrivertreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Caldwell, Idaho
Q849592 EXACT TITLE 0.860
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and automotive (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "locally", "miles", "oregon", "west". | EXACT TITLE in automotive: "Caldwell, Idaho".
boisecaldwellcanyonidaholocallymilesoregonwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 EXACT TITLE 0.840
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and automotive (tier:evergreen). | SHARED TOKENS (7): "ada", "boise", "capital", "cities", "idaho", "meridian", "second". | EXACT TITLE in automotive: "Meridian, Idaho".
adaboisecapitalcitiesidahomeridiansecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 EXACT TITLE 0.820
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and automotive (tier:evergreen). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "miles", "northwest". | EXACT TITLE in automotive: "Eagle, Idaho".
adaboiseeagleidahomilesnorthwest
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Trucking industry in the United States
Q7847220 QID OVERLAP 0.800
QID OVERLAP: Q7847220 in transportation_infrastructure (tier:branch) and automotive (tier:branch). | SHARED TOKENS (33): "age", "american", "another", "building", "carrier", "centers", "commercial", "department", "distribution", "division", "drive", "federal", "governing", "governs", "home", "knowledge", "license", "long", "motor", "operate"....
ageamericananotherbuildingcarriercenterscommercialdepartmentdistributiondivisiondrivefederalgoverninggovernshomeknowledgelicenselongmotoroperateoperationspublicregulationsrequirementsretailrulessafetyservestransportationtrucking+3
the hours of service, which are regulations governing the driving hours of commercial drivers. Drivers must be at least 21 years old to drive on the interstates, with efforts being made to reduce the age to 18. These and all other rules regarding the safety of interstate commercial driving are issued by the Federal Motor Carrier Safety Administration (FMCSA). The FMCSA is a division of the United States Department of Transportation (USDOT), which governs all transportation-related industries such as trucking, shipping, railroads, and airlines. Some other issues are handled by another branch of the USDOT, the Federal Highway Administration (FHWA). Developments in technology, such as computers, satellite communication, and the Internet, have contributed to many improvements within the industry. These developments have increased the productivity of company operations, saved the time and effort of drivers, and provided new, more accessible forms of entertainment to men and women who often spend long periods of time away from home.
d effort of drivers, and provided new, more accessible forms of entertainment to men and women who often spend long periods of time away from home. In 2006, the United States Environmental Protection Agency implemented revised emission standards for diesel trucks (reducing airborne pollutants emitted by diesel engines) which promises to improve air quality and public health. History The trucking industry has affected the political and economic history of the United States in the 20th century. Before the invention of automobiles, most freight was moved by train or horse-drawn vehicle. There was a substantial in trucks over the period 1900-1920. In 1904, there were 700 trucks in the United States, whereas by 1920, there were approximately 1,1 million trucks. During this time period, trucks were an effective substitute for short-haul railroading. The nascent trucking industry benefitted from hidden subsidies (such as government funding of road construction and maintenance) and from an absence of the kinds of regulations that limited profitability in the railroad sector. Trucks were first used extensively by the military during World War I. With the increase in construction of paved roads, trucking began to achieve a significant foothold in the 1930s. Public safety concerns made it necessary to implement various government regulations (such as the 1965 hours of service rule, later revised with a compliance date of July 1, 2012) of how long drivers were allowed to work and drive each day/week. In 1956, Taxpayers provided funds to build the Interstate Highway System, an extensive network of highways and freeways that linked major cities across the continent. The addition of Interstate Highway System also made it possible for the trucking industry to grow substantially in the late 1950s and early 1960s and trucking has come to dominate the freight industry in the latter portion of the 20th century. Trucking achieved national attention during the 1960s and 70s when songs and movies about truck driving were major hits. Truck drivers participated in widespread strikes against the rising cost of fuel, during the energy crises of 1973 and 1979.
The trucking industry has affected the political and economic history of the United States in the 20th century. Before the invention of automobiles, most freight was moved by train or horse-drawn vehicle. There was a substantial in trucks over the period 1900-1920. In 1904, there were 700 trucks in the United States, whereas by 1920, there were approximately 1,1 million trucks. During this time period, trucks were an effective substitute for short-haul railroading. The nascent trucking industry benefitted from hidden subsidies (such as government funding of road construction and maintenance) and from an absence of the kinds of regulations that limited profitability in the railroad sector. Trucks were first used extensively by the military during World War I. With the increase in construction of paved roads, trucking began to achieve a significant foothold in the 1930s. Public safety concerns made it necessary to implement various government regulations (such as the 1965 hours of service rule, later revised with a compliance date of July 1, 2012) of how long drivers were allowed to work and drive each day/week. In 1956, Taxpayers provided funds to build the Interstate Highway System, an extensive network of highways and freeways that linked major cities across the continent. The addition of Interstate Highway System also made it possible for the trucking industry to grow substantially in the late 1950s and early 1960s and trucking has come to dominate the freight industry in the latter portion of the 20th century. Trucking achieved national attention during the 1960s and 70s when songs and movies about truck driving were major hits. Truck drivers participated in widespread strikes against the rising cost of fuel, during the energy crises of 1973 and 1979. Congress deregulated the trucking industry with the passage of the Motor Carrier Act of 1980. 1990s-present Advances in modern technology have enabled significant improvements within the trucking industry.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and automotive (tier:branch). | SHARED TOKENS (22): "ada", "annual", "boise", "capital", "commercial", "food", "government", "home", "idaho", "local", "locally", "major", "miles", "operations", "oregon", "public", "region", "river", "surrounding", "transportation"....
adaannualboisecapitalcommercialfoodgovernmenthomeidaholocallocallymajormilesoperationsoregonpublicregionriversurroundingtransportationtreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Originally established as a military outpost in 1863 during the gold rush era, Boise rapidly grew due to its location on the Oregon Trail and its proximity to mining operations in the surrounding region. By the late 19th century, it had become a commercial and transportation hub, bolstered by the arrival of the railroad and irrigation projects that supported agriculture in the Treasure Valley. While agriculture and food processing remain important, Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. Government, education, and healthcare also play significant roles in the local economy. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block, showcasing its Basque heritage.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Originally established as a military outpost in 1863 during the gold rush era, Boise rapidly grew due to its location on the Oregon Trail and its proximity to mining operations in the surrounding region. By the late 19th century, it had become a commercial and transportation hub, bolstered by the arrival of the railroad and irrigation projects that supported agriculture in the Treasure Valley. While agriculture and food processing remain important, Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. Government, education, and healthcare also play significant roles in the local economy. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block, showcasing its Basque heritage.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.800
QID OVERLAP: Q843258 in transportation_infrastructure (tier:evergreen) and automotive (tier:branch). | SHARED TOKENS (17): "boise", "cities", "designated", "falls", "home", "i-84", "idaho", "major", "miles", "mountain", "near", "northwest", "oregon", "primarily", "river", "serves", "twin".
boisecitiesdesignatedfallshomei-84idahomajormilesmountainnearnorthwestoregonprimarilyriverservestwin
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Diesel engine
Q174174 EXACT TITLE 0.760
QID OVERLAP: Q174174 in transportation_infrastructure (tier:evergreen) and automotive (tier:berry). | SHARED TOKENS (3): "fuel", "gas", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
fuelgasuses
A diesel engine is an internal combustion engine in which ignition of diesel fuel is caused by the elevated temperature of the air in the cylinder due to mechanical compression; thus, the diesel engine is also called a compression-ignition engine (or CI engine). This contrasts with engines using spark plug-ignition of the air-fuel mixture, such as a petrol engine (gasoline engine) or a gas engine (using a gaseous fuel like natural gas or liquefied petroleum gas).
a compression-ignition engine (or CI engine). This contrasts with engines using spark plug-ignition of the air-fuel mixture, such as a petrol engine (gasoline engine) or a gas engine (using a gaseous fuel like natural gas or liquefied petroleum gas). The diesel engine is named after its inventor, German engineer Rudolf Diesel. Introduction Diesel engines work by compressing only air, or air combined with residual combustion gases from the exhaust (known as exhaust gas recirculation, "EGR"). Air is inducted into the chamber during the intake stroke, and compressed during the compression stroke. This increases air temperature inside the cylinder so that atomised diesel fuel injected into the combustion chamber ignites. The torque a diesel engine produces is controlled by manipulating the air-fuel ratio (λ); instead of throttling the intake air, the diesel engine relies on altering the amount of fuel that is injected, and thus the air-fuel ratio is usually high. The diesel engine has the highest thermal efficiency (see engine efficiency) of any practical internal or external combustion engine due to its very high expansion ratio and inherent lean burn, which enables heat dissipation by excess air. A small efficiency loss is also avoided compared with non-direct-injection gasoline engines, as unburned fuel is not present during valve overlap, and therefore no fuel goes directly from the intake/injection to the exhaust. Low-speed diesel engines (as used in ships and other applications where overall engine weight is relatively unimportant) can reach effective efficiencies of up to 55%. The combined cycle gas turbine (Brayton and Rankine cycle) is a combustion engine that is more efficient than a diesel engine, but due to its mass and dimensions, is unsuitable for many vehicles, including aircraft and some watercraft. The world's largest diesel engines put in service are 14-cylinder, two-stroke marine diesel engines; they produce a peak power of almost 100 MW each. Diesel engines may be designed with either two-stroke or four-stroke combustion cycles. They were originally used as a more efficient replacement for stationary steam engines. Since the 1910s, they have been used in submarines and ships. Use in locomotives, buses, trucks, heavy equipment, agricultural equipment and electricity generation plants followed later. In the 1930s, they slowly began to be used in some automobiles. Since the 1970s energy crisis, demand for higher fuel efficiency has resulted in most major automakers, at some point, offering diesel-powered models, even in very small cars. According to Konrad Reif (2012), the EU average for diesel cars at the time accounted for half of newly registered cars. However, air pollution and overall emissions are more difficult to control in diesel engines compared to gasoline engines, so the use of diesel engines in the US is now largely relegated to larger on-road and off-road vehicles. Though aviation has traditionally avoided using diesel engines, aircraft diesel engines have become increasingly available in the 21st century.
Introduction Diesel engines work by compressing only air, or air combined with residual combustion gases from the exhaust (known as exhaust gas recirculation, "EGR"). Air is inducted into the chamber during the intake stroke, and compressed during the compression stroke. This increases air temperature inside the cylinder so that atomised diesel fuel injected into the combustion chamber ignites. The torque a diesel engine produces is controlled by manipulating the air-fuel ratio (λ); instead of throttling the intake air, the diesel engine relies on altering the amount of fuel that is injected, and thus the air-fuel ratio is usually high. The diesel engine has the highest thermal efficiency (see engine efficiency) of any practical internal or external combustion engine due to its very high expansion ratio and inherent lean burn, which enables heat dissipation by excess air. A small efficiency loss is also avoided compared with non-direct-injection gasoline engines, as unburned fuel is not present during valve overlap, and therefore no fuel goes directly from the intake/injection to the exhaust. Low-speed diesel engines (as used in ships and other applications where overall engine weight is relatively unimportant) can reach effective efficiencies of up to 55%. The combined cycle gas turbine (Brayton and Rankine cycle) is a combustion engine that is more efficient than a diesel engine, but due to its mass and dimensions, is unsuitable for many vehicles, including aircraft and some watercraft. The world's largest diesel engines put in service are 14-cylinder, two-stroke marine diesel engines; they produce a peak power of almost 100 MW each. Diesel engines may be designed with either two-stroke or four-stroke combustion cycles. They were originally used as a more efficient replacement for stationary steam engines. Since the 1910s, they have been used in submarines and ships. Use in locomotives, buses, trucks, heavy equipment, agricultural equipment and electricity generation plants followed later. In the 1930s, they slowly began to be used in some automobiles. Since the 1970s energy crisis, demand for higher fuel efficiency has resulted in most major automakers, at some point, offering diesel-powered models, even in very small cars. According to Konrad Reif (2012), the EU average for diesel cars at the time accounted for half of newly registered cars. However, air pollution and overall emissions are more difficult to control in diesel engines compared to gasoline engines, so the use of diesel engines in the US is now largely relegated to larger on-road and off-road vehicles. Though aviation has traditionally avoided using diesel engines, aircraft diesel engines have become increasingly available in the 21st century.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and automotive (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "home", "idaho", "meridian", "miles", "name", "nampa", "northwest", "second", "west", "western".
boisecanyonhomeidahomeridianmilesnamenampanorthwestsecondwestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Auto mechanic
Q706835 QID OVERLAP 0.720
QID OVERLAP: Q706835 in transportation_infrastructure (tier:branch) and automotive (tier:branch). | SHARED TOKENS (11): "already", "approved", "auto", "automobile", "brand", "digital", "independent", "inspection", "parts", "repair", "vehicle".
alreadyapprovedautoautomobilebranddigitalindependentinspectionpartsrepairvehicle
of one or more parts as assemblies. Basic vehicle maintenance is a fundamental part of a mechanic's work in modern industrialized countries, while in others they are only consulted when a vehicle is already showing signs of malfunction. Education Automotive repair knowledge can be derived from on-the-job training, an apprenticeship program, vocational school or college. Apprenticeship Apprentice mechanics work under master mechanics for a specified number of years before they work on their own. Some areas have formal apprenticeship programs, however many automotive repair shops utilize an informal apprenticeship system within their facilities.
concern, the inspection results and preventative maintenance needs, the mechanic/technician returns the findings to the service advisor who then gets approval for any or all of the proposed work. The approved work will be assigned to the mechanic on a work order. Their work may involve the repair of a specific part or the replacement of one or more parts as assemblies.
EPA The United States Environmental Protection Agency (EPA) requires any person who repairs or services a motor vehicle air conditioning system for payment or bartering to be properly trained and certified under section 609 of the Clear Air Act. To be certified, professionals must be trained by an EPA-approved program and pass a test demonstrating their knowledge in these areas. This certification does not expire. Types and specialties Auto body An auto body technician repairs the exterior of a vehicle, primarily bodywork and paintwork. This includes repairing minor damages such as scratches, scuffs and dents, as well as major damage caused by vehicle collisions.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and automotive (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "home", "idaho", "local", "northwest", "pacific", "second".
adaboisecapitalhomeidaholocalnorthwestpacificsecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and automotive (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
225 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP225 edges
🌲 EVERGREEN4 edges
0.650
americanassociationautomotivecapitalcenterchaincomplexdealershipsgrouplakenationalownedparksaltwestern
SHARED TOKENS (15): "american", "association", "automotive", "capital", "center", "chain", "complex", "dealerships", "group", "lake", "national", "owned", "park", "salt", "western". | URL->B (1): http://www.lhmauto.com/. | EXACT TITLE in automotive: "Larry H. Miller".
0.650
associationboiseeaglehotidahonationalnearopenedplacesregisterstartimestrackwestwestern
SHARED TOKENS (15): "association", "boise", "eagle", "hot", "idaho", "national", "near", "opened", "places", "register", "star", "times", "track", "west", "western". | URL->B (1): https://firebirdonline.com/. | EXACT TITLE in automotive: "Firebird Raceway".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaanotherautomobilebestboisecanyoncapitalcentercitiescosteaglefederalfuelgardengovernmenthighhomeidahokunalocal
SHARED TOKENS (42): "ada", "another", "automobile", "best", "boise", "canyon", "capital", "center", "cities", "cost", "eagle", "federal", "fuel", "garden", "government", "high", "home", "idaho", "kuna", "local".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.610
airportamericancommercialfederalfuelfundgrantlightingprogrampublicsafetystationstax
SHARED TOKENS (13): "airport", "american", "commercial", "federal", "fuel", "fund", "grant", "lighting", "program", "public", "safety", "stations", "tax". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
🌿 BRANCH118 edges
0.570
asphaltautoeventeventsidahomeridianpartssecondsmalltrackwest
SHARED TOKENS (11): "asphalt", "auto", "event", "events", "idaho", "meridian", "parts", "second", "small", "track", "west". | URL->B (1): https://www.meridianspeedway.com/. | EXACT TITLE in automotive: "Meridian Speedway (Idaho)".
0.530
departmentfederalgrantidahoinfrastructureitdoperationsprogramstransportation
SHARED TOKENS (9): "department", "federal", "grant", "idaho", "infrastructure", "itd", "operations", "programs", "transportation". | URL->A (1): https://itd.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho Transportation Department". | EXACT TITLE in automotive: "Idaho Transportation Department".
0.510
carrierfederalgovernmentindependentpreviouslyregulatoryservestransportation
SHARED TOKENS (8): "carrier", "federal", "government", "independent", "previously", "regulatory", "serves", "transportation". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.510
americanchainconveniencefoodgasidahooregonstations
SHARED TOKENS (8): "american", "chain", "convenience", "food", "gas", "idaho", "oregon", "stations". | URL->B (1): https://www.jacksons.com/. | EXACT TITLE in automotive: "Jacksons Food Stores".
0.500
Idaho ↗ Q1221 EXACT TITLE
bestboisecapitaleasternforestidahomilesmillionmountainnationalnorthwestoregonpacificriverseparatesmallsuppliesuseswestwestern
SHARED TOKENS (20): "best", "boise", "capital", "eastern", "forest", "idaho", "miles", "million", "mountain", "national", "northwest", "oregon", "pacific", "river", "separate", "small", "supplies", "uses", "west", "western". | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in automotive: "Idaho".
0.500
Jeep ↗ EXACT TITLE
americanautomobilebestbodybranddealershipsdrivefranchiselightmillionmodelsnameopenownedpreviouslyproductseparateservingsmalltruck
SHARED TOKENS (22): "american", "automobile", "best", "body", "brand", "dealerships", "drive", "franchise", "light", "million", "models", "name", "open", "owned", "previously", "product", "separate", "serving", "small", "truck".... | EXACT TITLE in automotive: "Jeep".
0.500
buildingcentercenterscommercialdirectlydistributionequipmentfacilityinventorylogisticsnamenetworkoperateoperatesoperationproductresourcesretailservingsupply
SHARED TOKENS (20): "building", "center", "centers", "commercial", "directly", "distribution", "equipment", "facility", "inventory", "logistics", "name", "network", "operate", "operates", "operation", "product", "resources", "retail", "serving", "supply". | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
NASCAR ↗ Q233929 EXACT TITLE
americanassociationautoautomobilebestfoundednationalownedpartsplacespreviouslyprimarilyprivatelysecondshowstreettruck
SHARED TOKENS (17): "american", "association", "auto", "automobile", "best", "founded", "national", "owned", "parts", "places", "previously", "primarily", "privately", "second", "show", "street", "truck". | EXACT TITLE in automotive: "NASCAR".
0.500
communityelectricalfocusgoalindustrialinfrastructureinternationallawlightprogramspublicservingsupplysurroundingsystems
SHARED TOKENS (15): "community", "electrical", "focus", "goal", "industrial", "infrastructure", "international", "law", "light", "programs", "public", "serving", "supply", "surrounding", "systems". | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in automotive: "Infrastructure".
0.500
Cadillac ↗ Q27436 EXACT TITLE
advancesalreadyamericanautomobileautomotivebrandcompetingdivisionelectricelectricalfoundedfulllightingmajormodelsmotorpartsplatformspremiersystems
SHARED TOKENS (23): "advances", "already", "american", "automobile", "automotive", "brand", "competing", "division", "electric", "electrical", "founded", "full", "lighting", "major", "models", "motor", "parts", "platforms", "premier", "systems".... | EXACT TITLE in automotive: "Cadillac".
0.500
departmentdotfederalgovernmentlightlocalofficeoperateprimarilyprogramspublicregionalrequirementssystemstechnicaltransportation
SHARED TOKENS (16): "department", "dot", "federal", "government", "light", "local", "office", "operate", "primarily", "programs", "public", "regional", "requirements", "systems", "technical", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
Toyota ↗ Q53268 EXACT TITLE
automobileautomotivedepartmentelectricfoundedfuelgroupgrowinginternationalmillionmodelsmotorproductsalesvaluevehiclevehicles
SHARED TOKENS (17): "automobile", "automotive", "department", "electric", "founded", "fuel", "group", "growing", "international", "million", "models", "motor", "product", "sales", "value", "vehicle", "vehicles". | EXACT TITLE in automotive: "Toyota".
0.500
associationcompetingcorridorsdesignatedgovernmenthistoricalinfrastructureinternationallightlocalnetworkoperateoperationspricingprimarilypublicregionregionalservesstations
SHARED TOKENS (23): "association", "competing", "corridors", "designated", "government", "historical", "infrastructure", "international", "light", "local", "network", "operate", "operations", "pricing", "primarily", "public", "region", "regional", "serves", "stations".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
Dodge ↗ Q27564 EXACT TITLE
americanautomobileautomotivebrandbuildingbusinesscapitaldivisionfoundedgasgroupmultiplepartsperformanceplatformproductsalessecondtrucksvehicles
SHARED TOKENS (20): "american", "automobile", "automotive", "brand", "building", "business", "capital", "division", "founded", "gas", "group", "multiple", "parts", "performance", "platform", "product", "sales", "second", "trucks", "vehicles". | EXACT TITLE in automotive: "Dodge".
0.500
Chevrolet ↗ Q29570 EXACT TITLE
absenceamericanautomobileautomotivebrandcommercialdistributiondivisioninternationalmotornameownedplatformsprimarilyregionsalessecondtimestrucktrucks
SHARED TOKENS (23): "absence", "american", "automobile", "automotive", "brand", "commercial", "distribution", "division", "international", "motor", "name", "owned", "platforms", "primarily", "region", "sales", "second", "times", "truck", "trucks".... | EXACT TITLE in automotive: "Chevrolet".
0.500
adaairportboisecentercommercialdepartmentfacilityfallsforestidahointernationalmilesmillionnationaloperatestimesuseswestern
SHARED TOKENS (18): "ada", "airport", "boise", "center", "commercial", "department", "facility", "falls", "forest", "idaho", "international", "miles", "million", "national", "operates", "times", "uses", "western". | EXACT TITLE in transportation_infrastructure: "Boise Airport". | EXACT TITLE in automotive: "Boise Airport".
0.500
Bridge ↗ Q12280 EXACT TITLE
advancescommunitycomplexheavyindustriallocalmajormilesnetworkprimarilyproductrequirementsrivertimestransportationvehicleswider
SHARED TOKENS (17): "advances", "community", "complex", "heavy", "industrial", "local", "major", "miles", "network", "primarily", "product", "requirements", "river", "times", "transportation", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Honda ↗ Q9584 EXACT TITLE
automobileautomotivebrandbusinessesequipmentfoundedgardenhistorymajormillionmodelsmotornetpowervehicle
SHARED TOKENS (15): "automobile", "automotive", "brand", "businesses", "equipment", "founded", "garden", "history", "major", "million", "models", "motor", "net", "power", "vehicle". | EXACT TITLE in automotive: "Honda".
0.500
Amtrak ↗ Q23239 EXACT TITLE
americanbusinesscorridordailydirectlyfederalfoundedlimitedmilesmillionnationalnearlynetworkoperateoperatesownedpartsstationstracktransportation
SHARED TOKENS (21): "american", "business", "corridor", "daily", "directly", "federal", "founded", "limited", "miles", "million", "national", "nearly", "network", "operate", "operates", "owned", "parts", "stations", "track", "transportation".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
adaboisecanyonclassescommunityeasternidahonampaprogramspublicsouthwesttechnicaltreasurevalleywestern
SHARED TOKENS (15): "ada", "boise", "canyon", "classes", "community", "eastern", "idaho", "nampa", "programs", "public", "southwest", "technical", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
Chrysler ↗ Q181114 EXACT TITLE
americanautoautomobileautomotivebrandbusinesscapitalcostdivisioneaglefoundedfundgovernmentgroupgrowingjunemillionmotorpartsperformance
SHARED TOKENS (24): "american", "auto", "automobile", "automotive", "brand", "business", "capital", "cost", "division", "eagle", "founded", "fund", "government", "group", "growing", "june", "million", "motor", "parts", "performance".... | EXACT TITLE in automotive: "Chrysler".
0.500
Charging station ↗ EXACT TITLE
batterychargingcostdirectlyelectricelectricalequipmentinstallationpowerstationssuppliessupplytrucksvehiclevehicles
SHARED TOKENS (15): "battery", "charging", "cost", "directly", "electric", "electrical", "equipment", "installation", "power", "stations", "supplies", "supply", "trucks", "vehicle", "vehicles". | EXACT TITLE in automotive: "Charging station".
0.480
Lexus ↗ Q35919 EXACT TITLE
brandcentersdealershipsdivisionhomemodelsmotornameownedperformancesalesvaluevehiclevehicles
SHARED TOKENS (14): "brand", "centers", "dealerships", "division", "home", "models", "motor", "name", "owned", "performance", "sales", "value", "vehicle", "vehicles". | EXACT TITLE in automotive: "Lexus".
0.480
articlechainchainscomplexdirectlydistributionindependentlogisticsnetworkproductsupplysystemsystemsvalue
SHARED TOKENS (14): "article", "chain", "chains", "complex", "directly", "distribution", "independent", "logistics", "network", "product", "supply", "system", "systems", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.480
airportbudgetdepartmentfederalforeigngovernmentlawlocalregulationsregulatorysystemsystemstechnicianstransportation
SHARED TOKENS (14): "airport", "budget", "department", "federal", "foreign", "government", "law", "local", "regulations", "regulatory", "system", "systems", "technicians", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.480
approveddepartmentfederalfocuslocalmajornationalnetworksafetyservingstationssystemtransportationtruck
SHARED TOKENS (14): "approved", "department", "federal", "focus", "local", "major", "national", "network", "safety", "serving", "stations", "system", "transportation", "truck". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.480
americanbrandcommunityeventsfallsfoundedhistoricalhomemajormodelsmotorcyclesplatformsproductstreet
SHARED TOKENS (14): "american", "brand", "community", "events", "falls", "founded", "historical", "home", "major", "models", "motorcycles", "platforms", "product", "street". | EXACT TITLE in automotive: "Harley-Davidson".
0.480
boisebusinessdivisionfoundedhighidahoindependentmastermillionmountainprogramprogramspublicwest
SHARED TOKENS (14): "boise", "business", "division", "founded", "high", "idaho", "independent", "master", "million", "mountain", "program", "programs", "public", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University".
0.480
Irrigation ↗ Q11453 EXACT TITLE
directlydistributionfullhighinstallationnetworkoperationoperationspartsriversmallsystemtimesuses
SHARED TOKENS (14): "directly", "distribution", "full", "high", "installation", "network", "operation", "operations", "parts", "river", "small", "system", "times", "uses". | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.480
ageamericananotherautomobileconditionhistoricallistsregistrationregulationsrequirementrequirementsrulesvehiclevehicles
SHARED TOKENS (14): "age", "american", "another", "automobile", "condition", "historical", "lists", "registration", "regulations", "requirement", "requirements", "rules", "vehicle", "vehicles". | EXACT TITLE in automotive: "Classic car".
0.460
BMW ↗ Q26678 EXACT TITLE
automobileautomotivebrandgrouphistorymajormotormotorcyclesnameownedperformancepublicvehicles
SHARED TOKENS (13): "automobile", "automotive", "brand", "group", "history", "major", "motor", "motorcycles", "name", "owned", "performance", "public", "vehicles". | EXACT TITLE in automotive: "BMW".
0.460
bodycapitalcategorycommunitydirectlyelectricalgovernmentinfrastructurepublicrestorationsafetysupplyuses
SHARED TOKENS (13): "body", "capital", "category", "community", "directly", "electrical", "government", "infrastructure", "public", "restoration", "safety", "supply", "uses". | EXACT TITLE in transportation_infrastructure: "Public works".
0.460
americancitiesentitiesgovernmentindependentlawlocallocallymultipleplacespowerregionaluses
SHARED TOKENS (13): "american", "cities", "entities", "government", "independent", "law", "local", "locally", "multiple", "places", "power", "regional", "uses". | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in automotive: "County (United States)".
0.460
citiescommunitydailygovernmentlocaloperateoperatespublicservingsmallsystemstransportationvehicles
SHARED TOKENS (13): "cities", "community", "daily", "government", "local", "operate", "operates", "public", "serving", "small", "systems", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.440
citiesfocusindustrialinfrastructurelawsnationalnetworkplansregionregionaltransportationuses
SHARED TOKENS (12): "cities", "focus", "industrial", "infrastructure", "laws", "national", "network", "plans", "region", "regional", "transportation", "uses". | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.440
conveniencecostfoodgasinventorylongnamenearopenretailsmallvehicles
SHARED TOKENS (12): "convenience", "cost", "food", "gas", "inventory", "long", "name", "near", "open", "retail", "small", "vehicles". | EXACT TITLE in automotive: "Convenience store".
0.440
SUV ↗ Q192152 EXACT TITLE
automobilecenterdrivefeaturesfuellightmodelsprofileresourcestruckvehiclevehicles
SHARED TOKENS (12): "automobile", "center", "drive", "features", "fuel", "light", "models", "profile", "resources", "truck", "vehicle", "vehicles". | EXACT TITLE in automotive: "SUV".
0.440
Logistics ↗ Q177777 EXACT TITLE
anotherchainequipmentfacilityfoodlogisticspartsprofessionalpublicresourcessupplytransportation
SHARED TOKENS (12): "another", "chain", "equipment", "facility", "food", "logistics", "parts", "professional", "public", "resources", "supply", "transportation". | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in automotive: "Logistics".
0.440
Surveying ↗ Q816425 EXACT TITLE
designateddigitalequipmentfeaturesgovernmenthistorylawlegalprofessionalsalesstationstransportation
SHARED TOKENS (12): "designated", "digital", "equipment", "features", "government", "history", "law", "legal", "professional", "sales", "stations", "transportation". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.440
alreadybodycollisionlongmotoropenedpowerpreviouslyrepairsmallusesvehicle
SHARED TOKENS (12): "already", "body", "collision", "long", "motor", "opened", "power", "previously", "repair", "small", "uses", "vehicle". | EXACT TITLE in automotive: "Paintless dent repair".
0.440
corridordepartmentdotfederalgovernmentnationaloperatesprogramspublicregulationssafetytransportation
SHARED TOKENS (12): "corridor", "department", "dot", "federal", "government", "national", "operates", "programs", "public", "regulations", "safety", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.440
cleandirectlyfederalgoverninglawlawsmajornameownedpartsprimarilyregulations
SHARED TOKENS (12): "clean", "directly", "federal", "governing", "law", "laws", "major", "name", "owned", "parts", "primarily", "regulations". | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.420
Snowmobile ↗ Q17240 EXACT TITLE
americanasphaltdriveindustrialmotormotorizedsecondtracktransportationvehiclevehicles
SHARED TOKENS (11): "american", "asphalt", "drive", "industrial", "motor", "motorized", "second", "track", "transportation", "vehicle", "vehicles". | EXACT TITLE in automotive: "Snowmobile".
0.420
airportcanyonhomeidahoindustrialmountainnampanationalpublicriversystems
SHARED TOKENS (11): "airport", "canyon", "home", "idaho", "industrial", "mountain", "nampa", "national", "public", "river", "systems". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.420
Zoning ↗ Q702232 EXACT TITLE
buildinggovernmentindustriallocalplacesregulationsregulatoryresidentialrulessystemsuses
SHARED TOKENS (11): "building", "government", "industrial", "local", "places", "regulations", "regulatory", "residential", "rules", "systems", "uses". | EXACT TITLE in transportation_infrastructure: "Zoning".
0.420
annuallyestimatesfreegroupgrowinghighinternationallimitedmillionpotentialresources
SHARED TOKENS (11): "annually", "estimates", "free", "group", "growing", "high", "international", "limited", "million", "potential", "resources". | EXACT TITLE in transportation_infrastructure: "Population growth".
0.420
americananotherautomobileautomotivebranddealershipsdivisionplatformstrucksvehiclevehicles
SHARED TOKENS (11): "american", "another", "automobile", "automotive", "brand", "dealerships", "division", "platforms", "trucks", "vehicle", "vehicles". | EXACT TITLE in automotive: "GMC (automobile)".
0.420
Mazda ↗ Q35996 EXACT TITLE
automotivefoundedhistorylongmajormillionmotornameplatformpresentvehicles
SHARED TOKENS (11): "automotive", "founded", "history", "long", "major", "million", "motor", "name", "platform", "present", "vehicles". | EXACT TITLE in automotive: "Mazda".
0.420
contextequipmentheavyindustrialmobileoperationspowersourcesystemsusesvehicles
SHARED TOKENS (11): "context", "equipment", "heavy", "industrial", "mobile", "operations", "power", "source", "systems", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.420
Porsche ↗ Q40993 EXACT TITLE
autoautomobileautomotivebuildingfoundedgovernmentgrouplawoperationsownedvehicle
SHARED TOKENS (11): "auto", "automobile", "automotive", "building", "founded", "government", "group", "law", "operations", "owned", "vehicle". | EXACT TITLE in automotive: "Porsche".
0.400
americanautoautomotivebusinessequipmentfoundedoperatespartsprofessionalsupplies
SHARED TOKENS (10): "american", "auto", "automotive", "business", "equipment", "founded", "operates", "parts", "professional", "supplies". | EXACT TITLE in automotive: "O'Reilly Auto Parts".
0.400
Used car ↗ Q1137287 EXACT TITLE
anotherdealershipsfranchiseindependentownedplanspreviouslyretailsalesvehicle
SHARED TOKENS (10): "another", "dealerships", "franchise", "independent", "owned", "plans", "previously", "retail", "sales", "vehicle". | EXACT TITLE in automotive: "Used car".
0.400
Idaho Power ↗ EXACT TITLE
businessdistributioneasternelectricalgasidahooperatesoregonpowerriver
SHARED TOKENS (10): "business", "distribution", "eastern", "electrical", "gas", "idaho", "operates", "oregon", "power", "river". | EXACT TITLE in automotive: "Idaho Power".
0.400
Buick ↗ Q27415 EXACT TITLE
americananotherautomobileautomotivebranddealershipsdivisionmajorplatformsvehicles
SHARED TOKENS (10): "american", "another", "automobile", "automotive", "brand", "dealerships", "division", "major", "platforms", "vehicles". | EXACT TITLE in automotive: "Buick".
0.400
Subaru ↗ Q172741 EXACT TITLE
automobiledivisiondriveequipmentheavysmallstartransportationvehicleswestern
SHARED TOKENS (10): "automobile", "division", "drive", "equipment", "heavy", "small", "star", "transportation", "vehicles", "western". | EXACT TITLE in automotive: "Subaru".
0.400
departmentdivisionfederalmajorofficepreviouslyprogramprogramspublictransportation
SHARED TOKENS (10): "department", "division", "federal", "major", "office", "previously", "program", "programs", "public", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.380
federalgovernmentlawlocalplansprogramspublicregionaltransportation
SHARED TOKENS (9): "federal", "government", "law", "local", "plans", "programs", "public", "regional", "transportation". | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.380
americanchargingelectricenergynetworkoperatespacificstationsvehicle
SHARED TOKENS (9): "american", "charging", "electric", "energy", "network", "operates", "pacific", "stations", "vehicle". | EXACT TITLE in automotive: "Tesla Supercharger".
0.380
brandhistoryindependentinternationalmajornetworkoperatesregionalstar
SHARED TOKENS (9): "brand", "history", "independent", "international", "major", "network", "operates", "regional", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.380
Pedestrian ↗ Q221488 EXACT TITLE
americancitiesdesignatedmotornetworkprofessionalsafetyvehicleswider
SHARED TOKENS (9): "american", "cities", "designated", "motor", "network", "professional", "safety", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.380
Nissan ↗ Q20165 EXACT TITLE
announcedautomobilebrandfocusgroupmodelsmotorperformancevehicles
SHARED TOKENS (9): "announced", "automobile", "brand", "focus", "group", "models", "motor", "performance", "vehicles". | EXACT TITLE in automotive: "Nissan".
0.360
americancenterschaindealershipsfoundedoregonretailwestern
SHARED TOKENS (8): "american", "centers", "chain", "dealerships", "founded", "oregon", "retail", "western". | EXACT TITLE in automotive: "Les Schwab Tire Centers".
0.360
automobilebusinessdepartmentlegalmotortitlevehiclevehicles
SHARED TOKENS (8): "automobile", "business", "department", "legal", "motor", "title", "vehicle", "vehicles". | EXACT TITLE in transportation_infrastructure: "Vehicle title".
0.360
commercialdepartmentfederalgovernmentinternationalsurroundingtransportationvehicles
SHARED TOKENS (8): "commercial", "department", "federal", "government", "international", "surrounding", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.360
carrierdepartmentfederalmotorsafetytransportationtruckingtrucks
SHARED TOKENS (8): "carrier", "department", "federal", "motor", "safety", "transportation", "trucking", "trucks". | EXACT TITLE in transportation_infrastructure: "Federal Motor Carrier Safety Administration".
0.360
Warehouse ↗ Q181623 EXACT TITLE
buildingbusinessescitiesdirectlyfacilityindustrialpartstrucks
SHARED TOKENS (8): "building", "businesses", "cities", "directly", "facility", "industrial", "parts", "trucks". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.360
departmentsgovernmentinfrastructurelocallynationalprofessionalpublicsystems
SHARED TOKENS (8): "departments", "government", "infrastructure", "locally", "national", "professional", "public", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.340
americanassociationautoautomotivedivisionnationalparts
SHARED TOKENS (7): "american", "association", "auto", "automotive", "division", "national", "parts". | EXACT TITLE in automotive: "NAPA Auto Parts".
0.340
Hot rod ↗ Q1630727 EXACT TITLE
americancommunityhotmultipleprimarilystreetvehicles
SHARED TOKENS (7): "american", "community", "hot", "multiple", "primarily", "street", "vehicles". | EXACT TITLE in automotive: "Hot rod".
0.340
automotivebatteryelectricelectricalpowersystemwindows
SHARED TOKENS (7): "automotive", "battery", "electric", "electrical", "power", "system", "windows". | EXACT TITLE in automotive: "Alternator (automotive)".
0.340
Motorcycle ↗ Q34493 EXACT TITLE
departmentmillionmotormotorcyclestimestransportationvehicle
SHARED TOKENS (7): "department", "million", "motor", "motorcycles", "times", "transportation", "vehicle". | EXACT TITLE in transportation_infrastructure: "Motorcycle". | EXACT TITLE in automotive: "Motorcycle".
0.340
chainsfoundedmultiplepowersecondusesvehicles
SHARED TOKENS (7): "chains", "founded", "multiple", "power", "second", "uses", "vehicles". | EXACT TITLE in automotive: "Transmission (mechanical device)".
0.340
boiseeasternidaholakeoregonrestorationsalt
SHARED TOKENS (7): "boise", "eastern", "idaho", "lake", "oregon", "restoration", "salt". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.340
decadesdigitalelectricelectricalforestindependentpower
SHARED TOKENS (7): "decades", "digital", "electric", "electrical", "forest", "independent", "power". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.340
Sidewalk ↗ Q177749 EXACT TITLE
americanasphaltmotorprimarilysidestreetvehicle
SHARED TOKENS (7): "american", "asphalt", "motor", "primarily", "side", "street", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.320
Road ↗ Q34442 EXACT TITLE
anotherfeatureslocalprimarilypublicstreet
SHARED TOKENS (6): "another", "features", "local", "primarily", "public", "street". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in automotive: "Road".
0.320
associationcorridorsindustrialmultipleparkserves
SHARED TOKENS (6): "association", "corridors", "industrial", "multiple", "park", "serves". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.320
Kia ↗ Q35349 EXACT TITLE
automobilemillionmotorownedsalesvehicles
SHARED TOKENS (6): "automobile", "million", "motor", "owned", "sales", "vehicles". | EXACT TITLE in automotive: "Kia".
0.320
Broadband ↗ Q194163 EXACT TITLE
contextdigitalhighnetworkrequirementsuses
SHARED TOKENS (6): "context", "digital", "high", "network", "requirements", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.320
apprenticeshipslicensemasterpotentialprofessionalsystem
SHARED TOKENS (6): "apprenticeships", "license", "master", "potential", "professional", "system". | EXACT TITLE in transportation_infrastructure: "Apprenticeship". | EXACT TITLE in automotive: "Apprenticeship".
0.320
americanautoautomotivepartsprofessionalserves
SHARED TOKENS (6): "american", "auto", "automotive", "parts", "professional", "serves". | EXACT TITLE in automotive: "Advance Auto Parts".
0.320
articlemajorprimarilyseparateusesvehicles
SHARED TOKENS (6): "article", "major", "primarily", "separate", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.300
americanannuallyautoautomobileautomotiveelectricequipmentfederalforeigngovernmentgrouphighhistoryjunemajormillionownedprimarilysalessecond
SHARED TOKENS (23): "american", "annually", "auto", "automobile", "automotive", "electric", "equipment", "federal", "foreign", "government", "group", "high", "history", "june", "major", "million", "owned", "primarily", "sales", "second"....
0.300
americanautomobileautomotivebrandclasscommercialfederalfoundedgovernmentgroupindustrialjunelistmajormillionmotoroperatesownedpowerpublic
SHARED TOKENS (22): "american", "automobile", "automotive", "brand", "class", "commercial", "federal", "founded", "government", "group", "industrial", "june", "list", "major", "million", "motor", "operates", "owned", "power", "public"....
0.300
Culvert ↗ Q4168092 EXACT TITLE
embeddedneedperformancerequirementsvehicle
SHARED TOKENS (5): "embedded", "need", "performance", "requirements", "vehicle". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.300
advancesassociationautobusinessescareclassescomplexdepartmentequipmentfederalgovernmentinternationalmotornearlypartsprogramsuppliesvehiclevehicles
SHARED TOKENS (19): "advances", "association", "auto", "businesses", "care", "classes", "complex", "department", "equipment", "federal", "government", "international", "motor", "nearly", "parts", "program", "supplies", "vehicle", "vehicles".
0.300
Car dealership ↗ Q786803 KW CROSS HIGH
authorizedbusinessbusinessesdealershipsdirectlyfinancingfranchiseindependentlawslocalmultiplenationaloperatepartsregulationsrepairretailsalessourcevehicle
SHARED TOKENS (21): "authorized", "business", "businesses", "dealerships", "directly", "financing", "franchise", "independent", "laws", "local", "multiple", "national", "operate", "parts", "regulations", "repair", "retail", "sales", "source", "vehicle"....
0.300
automotivebatterycostdirectlydriveelectricelectricalenergyfueljunelightmillionmotorperformancesalessecondsystemtrucksvehiclevehicles
SHARED TOKENS (20): "automotive", "battery", "cost", "directly", "drive", "electric", "electrical", "energy", "fuel", "june", "light", "million", "motor", "performance", "sales", "second", "system", "trucks", "vehicle", "vehicles".
0.300
governinggovernmentinspectionlawlicensemotornationalpoliceprogramsregistrationregulationssafetytestingtimestitlevehiclevehicles
SHARED TOKENS (17): "governing", "government", "inspection", "law", "license", "motor", "national", "police", "programs", "registration", "regulations", "safety", "testing", "times", "title", "vehicle", "vehicles".
0.300
autobusinesschaincompetingdealershipsdirectlyfinancingfranchiselawsmultipleoptionsprimarilyregulationsrepairretailsales
SHARED TOKENS (16): "auto", "business", "chain", "competing", "dealerships", "directly", "financing", "franchise", "laws", "multiple", "options", "primarily", "regulations", "repair", "retail", "sales".
0.300
automobilebusinessesclasselectricalequipmentfoundedmotormotorcyclesmotorizedoperatespowerproductsalesvehiclevehicles
SHARED TOKENS (15): "automobile", "businesses", "class", "electrical", "equipment", "founded", "motor", "motorcycles", "motorized", "operates", "power", "product", "sales", "vehicle", "vehicles".
0.300
associationautoautomobileautomotivecoalitiondealershipsfederalindependentlawlawslegislaturemotornamepublicrepairrequirementsvehicle
SHARED TOKENS (17): "association", "auto", "automobile", "automotive", "coalition", "dealerships", "federal", "independent", "law", "laws", "legislature", "motor", "name", "public", "repair", "requirements", "vehicle".
0.300
americanassociationbestcitiescommunityfoundedgoaloptionspotentialpresentregionalregulationsresourcessecondview
SHARED TOKENS (15): "american", "association", "best", "cities", "community", "founded", "goal", "options", "potential", "present", "regional", "regulations", "resources", "second", "view".
0.300
communityinfrastructurelocalregionwest
SHARED TOKENS (5): "community", "infrastructure", "local", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.300
americancapitalcitiescorridorscostdailyelectricfeatureslightmillionnetworkpublicsystemsystemstransportation
SHARED TOKENS (15): "american", "capital", "cities", "corridors", "cost", "daily", "electric", "features", "light", "million", "network", "public", "system", "systems", "transportation".
0.300
americanautomobilecitiesclassconnectdecadesfreelongmotornetworkopenedplanssafetysystemtaxtestingvehicleswestern
SHARED TOKENS (18): "american", "automobile", "cities", "class", "connect", "decades", "free", "long", "motor", "network", "opened", "plans", "safety", "system", "tax", "testing", "vehicles", "western".
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasternidahomajormilesnationalnearnorthwestoregonpacificparkriverruleswestwestern
SHARED TOKENS (15): "caldwell", "eastern", "idaho", "major", "miles", "national", "near", "northwest", "oregon", "pacific", "park", "river", "rules", "west", "western".
0.300
advancesautomotivebatterydominantelectricenergyfuelsgovernmentlimitedmotornearlyoperationoptionspowerpublictrucksvehiclevehicles
SHARED TOKENS (18): "advances", "automotive", "battery", "dominant", "electric", "energy", "fuels", "government", "limited", "motor", "nearly", "operation", "options", "power", "public", "trucks", "vehicle", "vehicles".
0.300
Tesla, Inc. ↗ Q478214 KW CROSS HIGH
americanapprovedautomotivebatterycleandepartmentelectricelectricalenergygovernmenthomemultiplenameproductpublicsafetystoragetruckvehiclevehicles
SHARED TOKENS (20): "american", "approved", "automotive", "battery", "clean", "department", "electric", "electrical", "energy", "government", "home", "multiple", "name", "product", "public", "safety", "storage", "truck", "vehicle", "vehicles".
0.300
designatedequipmenthomemobilemodelsmotorparkpartsplacespowerregionalsmalltrailerstruckvehiclevehicles
SHARED TOKENS (16): "designated", "equipment", "home", "mobile", "models", "motor", "park", "parts", "places", "power", "regional", "small", "trailers", "truck", "vehicle", "vehicles".
0.300
Electric car ↗ Q193692 KW CROSS HIGH
automobilebatterybestcenterschargingcommercialcostelectricelectricalenergyfuelfuelsgovernmentjunemillionmotorneedpowerpublicsales
SHARED TOKENS (29): "automobile", "battery", "best", "centers", "charging", "commercial", "cost", "electric", "electrical", "energy", "fuel", "fuels", "government", "june", "million", "motor", "need", "power", "public", "sales"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
ageamericancanyoncommercialdecadeseasternfallsfeatureshighhistoryidaholakelimitedlongmajormilesnationalnearnorthwestoregon
SHARED TOKENS (32): "age", "american", "canyon", "commercial", "decades", "eastern", "falls", "features", "high", "history", "idaho", "lake", "limited", "long", "major", "miles", "national", "near", "northwest", "oregon"....
0.300
businesscarechaincommercialdepartmentequipmentfinancingfuelgovernmentlicensinglightmillionmobilemotorpowerregistrationsafetysalesspecialistsupply
SHARED TOKENS (25): "business", "care", "chain", "commercial", "department", "equipment", "financing", "fuel", "government", "licensing", "light", "million", "mobile", "motor", "power", "registration", "safety", "sales", "specialist", "supply"....
0.300
Floodplain ↗ Q193110 EXACT TITLE
bodyhighnearrivervalley
SHARED TOKENS (5): "body", "high", "near", "river", "valley". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.300
connectsdirectlydistributioneasternelectricelectricalenergylocallongmajornetworkownedpowerseparatesitewestern
SHARED TOKENS (16): "connects", "directly", "distribution", "eastern", "electric", "electrical", "energy", "local", "long", "major", "network", "owned", "power", "separate", "site", "western".
0.300
Snowplow ↗ Q14976 EXACT TITLE
servingtransportationtrucksvehiclevehicles
SHARED TOKENS (5): "serving", "transportation", "trucks", "vehicle", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.300
annuallycostdecadesfederalfuelfundgovernmentmilesmillionnationalnearlynetworkownedprogramsignsystemtaxvehicle
SHARED TOKENS (18): "annually", "cost", "decades", "federal", "fuel", "fund", "government", "miles", "million", "national", "nearly", "network", "owned", "program", "sign", "system", "tax", "vehicle".
0.300
Trail riding ↗ Q1411690 KW CROSS HIGH
eventsforestgrouplawlimitedlocallongmotorcyclesmotorizedmountainnationalpartsprofessionalsmallsystemsvehicles
SHARED TOKENS (16): "events", "forest", "group", "law", "limited", "local", "long", "motorcycles", "motorized", "mountain", "national", "parts", "professional", "small", "systems", "vehicles".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
anotherbusinesscapitalcategorycitiescommunitydistributionfocusindependentinfrastructuremasterplansprofessionalpublicresourcesseparatetechnicaltransportation
SHARED TOKENS (18): "another", "business", "capital", "category", "cities", "community", "distribution", "focus", "independent", "infrastructure", "master", "plans", "professional", "public", "resources", "separate", "technical", "transportation".
0.300
governmentlegallicenselocalpartsplansproductprofessionalpublicregulationsrepairsafetysigntechnicaltitle
SHARED TOKENS (15): "government", "legal", "license", "local", "parts", "plans", "product", "professional", "public", "regulations", "repair", "safety", "sign", "technical", "title".
0.300
activeauthorizedbudgetbuildingbusinesscleandepartmentdirectlyenergyfederalgovernmentinfrastructurejunenationalofficeoperationoperationsprogrampublicrestoration
SHARED TOKENS (24): "active", "authorized", "budget", "building", "business", "clean", "department", "directly", "energy", "federal", "government", "infrastructure", "june", "national", "office", "operation", "operations", "program", "public", "restoration"....
0.300
chargingelectricenergygovernmentinfrastructurelimitednetworkoperatepublicregionstationssupplysystemsystemsvehiclevehicles
SHARED TOKENS (16): "charging", "electric", "energy", "government", "infrastructure", "limited", "network", "operate", "public", "region", "stations", "supply", "system", "systems", "vehicle", "vehicles".
0.300
automobileautomotivecollisiondistributionequipmentfacilityinstallationmodelsnearlypartsperformanceprofessionalrepairsecondaryvehiclevehicles
SHARED TOKENS (16): "automobile", "automotive", "collision", "distribution", "equipment", "facility", "installation", "models", "nearly", "parts", "performance", "professional", "repair", "secondary", "vehicle", "vehicles".
0.300
americanbestelectricenergyfederalfreegovernmentlocalmillionnationalregionalsalestaxvehiclevehicles
SHARED TOKENS (15): "american", "best", "electric", "energy", "federal", "free", "government", "local", "million", "national", "regional", "sales", "tax", "vehicle", "vehicles".
0.300
businessescarecontactdepartmentdrivemotorcyclesoperatepartsplacespresentpublicresourcessearchsystemstechnicaltechniciansvehicles
SHARED TOKENS (17): "businesses", "care", "contact", "department", "drive", "motorcycles", "operate", "parts", "places", "present", "public", "resources", "search", "systems", "technical", "technicians", "vehicles".
0.300
americanautoclasselectricelectricalfeatureshighhistoryhourmilesnationalpowerprimarilysafetysmallsystemstrackusesvehicles
SHARED TOKENS (19): "american", "auto", "class", "electric", "electrical", "features", "high", "history", "hour", "miles", "national", "power", "primarily", "safety", "small", "systems", "track", "uses", "vehicles".
0.300
businessesgovernmentpublicsystemtransportation
SHARED TOKENS (5): "businesses", "government", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.300
autobatterybestchargingcommercialelectricelectricalenergygasinfrastructuremillionmotorcyclespowerpublicsalessourcetrucksvehiclevehicles
SHARED TOKENS (19): "auto", "battery", "best", "charging", "commercial", "electric", "electrical", "energy", "gas", "infrastructure", "million", "motorcycles", "power", "public", "sales", "source", "trucks", "vehicle", "vehicles".
🫐 BERRY103 edges
0.280
buildingfinancingindustrialinfrastructure
SHARED TOKENS (4): "building", "financing", "industrial", "infrastructure". | EXACT TITLE in transportation_infrastructure: "Construction".
0.280
approveddepartmentenergyfederalgovernmentindependentlawslegallocalnationaloperationprogramspublicregional
SHARED TOKENS (14): "approved", "department", "energy", "federal", "government", "independent", "laws", "legal", "local", "national", "operation", "programs", "public", "regional".
0.280
annualanothercleanfederalgovernmentinspectionmajorpreviouslyprogramprogramssafetytestingvehiclevehicles
SHARED TOKENS (14): "annual", "another", "clean", "federal", "government", "inspection", "major", "previously", "program", "programs", "safety", "testing", "vehicle", "vehicles".
0.280
announcedapprovedcenterclassfoundedmilesnetworkoperatespacificplanssystemtransportationwestwestern
SHARED TOKENS (14): "announced", "approved", "center", "class", "founded", "miles", "network", "operates", "pacific", "plans", "system", "transportation", "west", "western".
0.280
categorysidevehiclevehicles
SHARED TOKENS (4): "category", "side", "vehicle", "vehicles". | EXACT TITLE in automotive: "Side-by-side (vehicle)".
0.280
batteryelectricenergyfocusfuelfuelsgashighmotorpotentialpowersystemsvehiclevehicles
SHARED TOKENS (14): "battery", "electric", "energy", "focus", "fuel", "fuels", "gas", "high", "motor", "potential", "power", "systems", "vehicle", "vehicles".
0.260
americanassociationconditionhistorymotornationalrepairsalvagesystemtitleusesvehiclevehicles
SHARED TOKENS (13): "american", "association", "condition", "history", "motor", "national", "repair", "salvage", "system", "title", "uses", "vehicle", "vehicles".
0.260
Sea-Doo ↗ Q3476640 EXACT TITLE
brandmodelsprimarily
SHARED TOKENS (3): "brand", "models", "primarily". | EXACT TITLE in automotive: "Sea-Doo".
0.260
forestrivertransportation
SHARED TOKENS (3): "forest", "river", "transportation". | EXACT TITLE in automotive: "Forest River".
0.260
americanassociationautobestbodyeventeventsfoundedgoverninghotnationalpremierrules
SHARED TOKENS (13): "american", "association", "auto", "best", "body", "event", "events", "founded", "governing", "hot", "national", "premier", "rules".
0.260
Polaris Inc. ↗ Q1850587 KW CROSS HIGH
americanannouncedautomotivefoundedlakemodelsmotorcyclespowerpreviouslytwinvehiclevehiclesvictory
SHARED TOKENS (13): "american", "announced", "automotive", "founded", "lake", "models", "motorcycles", "power", "previously", "twin", "vehicle", "vehicles", "victory".
0.260
Utility ↗ Q466707 EXACT TITLE
contextgoalsource
SHARED TOKENS (3): "context", "goal", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.260
eventsvehiclevehicles
SHARED TOKENS (3): "events", "vehicle", "vehicles". | EXACT TITLE in automotive: "Off-roading".
0.260
Motorhome ↗ Q13553228 EXACT TITLE
homenamevehicle
SHARED TOKENS (3): "home", "name", "vehicle". | EXACT TITLE in automotive: "Motorhome".
0.260
Urbanization ↗ Q161078 KW CROSS HIGH
citiesconditiondecadesgoalinternationallongmajornationalnearlypotentialpowerpublicresources
SHARED TOKENS (13): "cities", "condition", "decades", "goal", "international", "long", "major", "national", "nearly", "potential", "power", "public", "resources".
0.260
americansystemuses
SHARED TOKENS (3): "american", "system", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.260
Chip Foose ↗ Q916108 EXACT TITLE
americanautomobilestar
SHARED TOKENS (3): "american", "automobile", "star". | EXACT TITLE in automotive: "Chip Foose".
0.240
Urban sprawl ↗ Q192042 KW CROSS HIGH
automobilebuildingcitiescommercialindustrialinfrastructureresidentialsalestaxtimestransportationuses
SHARED TOKENS (12): "automobile", "building", "cities", "commercial", "industrial", "infrastructure", "residential", "sales", "tax", "times", "transportation", "uses".
0.240
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscitieselectricfeatureshourmultipleoperateoperatespricingprimarilyregionalsystems
SHARED TOKENS (12): "business", "cities", "electric", "features", "hour", "multiple", "operate", "operates", "pricing", "primarily", "regional", "systems".
0.240
authorizedcarriercleandepartmentelectricfederalinfrastructurelawmotorprogramssafetytransportation
SHARED TOKENS (12): "authorized", "carrier", "clean", "department", "electric", "federal", "infrastructure", "law", "motor", "programs", "safety", "transportation".
0.240
Fleet vehicle ↗ Q1432007 KW CROSS HIGH
businessbusinessesgovernmentgroupmotorownedprivatelypublicsalessystemvehiclevehicles
SHARED TOKENS (12): "business", "businesses", "government", "group", "motor", "owned", "privately", "public", "sales", "system", "vehicle", "vehicles".
0.240
anothercollisiondailydepartmentsgovernmentmillionmotornationaloperationstreetvehiclevehicles
SHARED TOKENS (12): "another", "collision", "daily", "departments", "government", "million", "motor", "national", "operation", "street", "vehicle", "vehicles".
0.240
americanappearsdesignatedfeatureslawsmarkedrulessafetyseparatestreetvehiclevehicles
SHARED TOKENS (12): "american", "appears", "designated", "features", "laws", "marked", "rules", "safety", "separate", "street", "vehicle", "vehicles".
0.240
automobilecleanfuelgovernmentgroupnationalnearlyregulationsrequirementsresourcessafetyvehicle
SHARED TOKENS (12): "automobile", "clean", "fuel", "government", "group", "national", "nearly", "regulations", "requirements", "resources", "safety", "vehicle".
0.240
Eminent domain ↗ Q166332 KW CROSS HIGH
anotherauthorizedconnectfullgovernmentlegalpowerpublicsurroundingtaxtitleuses
SHARED TOKENS (12): "another", "authorized", "connect", "full", "government", "legal", "power", "public", "surrounding", "tax", "title", "uses".
0.240
annualannuallycostdepartmentestimatesmilesnationalofficesafetytransportationvehiclevehicles
SHARED TOKENS (12): "annual", "annually", "cost", "department", "estimates", "miles", "national", "office", "safety", "transportation", "vehicle", "vehicles".
0.220
Interstate 184 ↗ Q843250 KW CROSS HIGH
approvedboiseconnectsdesignatedi-84idahoopenedriversidewestwestern
SHARED TOKENS (11): "approved", "boise", "connects", "designated", "i-84", "idaho", "opened", "river", "side", "west", "western".
0.220
annualautomobileautomotivedealershipsfacilityfoundedgroupmillionmotoroperatesvehicles
SHARED TOKENS (11): "annual", "automobile", "automotive", "dealerships", "facility", "founded", "group", "million", "motor", "operates", "vehicles".
0.220
Ram Trucks ↗ Q165708 KW CROSS HIGH
americanbrandcommercialdivisiongroupheavylightnamepreviouslytrucksvehicles
SHARED TOKENS (11): "american", "brand", "commercial", "division", "group", "heavy", "light", "name", "previously", "trucks", "vehicles".
0.220
Road safety ↗ Q1147899 KW CROSS HIGH
bestclasseseventmotorpublicsafetysecondsidesystemvehiclevehicles
SHARED TOKENS (11): "best", "classes", "event", "motor", "public", "safety", "second", "side", "system", "vehicle", "vehicles".
0.220
Muscle car ↗ Q1072763 KW CROSS HIGH
automobilecategoryequipmenthighmodelsmotorperformancepreviouslystreettrackvehicle
SHARED TOKENS (11): "automobile", "category", "equipment", "high", "models", "motor", "performance", "previously", "street", "track", "vehicle".
0.220
Fuel injection ↗ Q308881 KW CROSS HIGH
absenceanotherarticleautomotivebodyfuelhighsmallsystemsystemsuses
SHARED TOKENS (11): "absence", "another", "article", "automotive", "body", "fuel", "high", "small", "system", "systems", "uses".
0.220
anotherarticleautomobileconditiondepartmentsfocushighpublictimestransportationvehicles
SHARED TOKENS (11): "another", "article", "automobile", "condition", "departments", "focus", "high", "public", "times", "transportation", "vehicles".
0.220
americanautomobilebodycompetinggoverninginternationalmilesnamepowerpremierprofessional
SHARED TOKENS (11): "american", "automobile", "body", "competing", "governing", "international", "miles", "name", "power", "premier", "professional".
0.220
associationcontextinternationallightmajorplanspotentialprogrampublicreviewrules
SHARED TOKENS (11): "association", "context", "international", "light", "major", "plans", "potential", "program", "public", "review", "rules".
0.220
Pickup truck ↗ Q215601 KW CROSS HIGH
americancostfeatureshighlightmajoropensourcetruckvehiclevehicles
SHARED TOKENS (11): "american", "cost", "features", "high", "light", "major", "open", "source", "truck", "vehicle", "vehicles".
0.220
contactdistributionmotorcyclesoperatessafetysystemsystemstrucksusesvehiclevehicles
SHARED TOKENS (11): "contact", "distribution", "motorcycles", "operates", "safety", "system", "systems", "trucks", "uses", "vehicle", "vehicles".
0.220
driveeventshighlocallongmountainnationaltrucksvehiclevehiclesyard
SHARED TOKENS (11): "drive", "events", "high", "local", "long", "mountain", "national", "trucks", "vehicle", "vehicles", "yard".
0.220
networktransportation
SHARED TOKENS (2): "network", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.220
departmentfederallawlocalnationalopenownedprivatelypublicsigntransportation
SHARED TOKENS (11): "department", "federal", "law", "local", "national", "open", "owned", "privately", "public", "sign", "transportation".
0.220
Light rail ↗ Q1268865 KW CROSS HIGH
heavylightlongmultipleoperateoperatesoperationsprimarilysystemsystemsuses
SHARED TOKENS (11): "heavy", "light", "long", "multiple", "operate", "operates", "operations", "primarily", "system", "systems", "uses".
0.220
Roof rack ↗ Q786771 EXACT TITLE
automobilevehicle
SHARED TOKENS (2): "automobile", "vehicle". | EXACT TITLE in automotive: "Roof rack".
0.220
americanclasseslightmodelsnamenationaloperatespartsvehiclevehicleswider
SHARED TOKENS (11): "american", "classes", "light", "models", "name", "national", "operates", "parts", "vehicle", "vehicles", "wider".
0.200
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegardengovernmentidahonamenearlysecondseparatestreet
SHARED TOKENS (10): "ada", "boise", "garden", "government", "idaho", "name", "nearly", "second", "separate", "street".
0.200
autoeventslegalmotormotorcyclesregionregulationstrucksvehiclevehicles
SHARED TOKENS (10): "auto", "events", "legal", "motor", "motorcycles", "region", "regulations", "trucks", "vehicle", "vehicles".
0.200
Lowrider ↗ Q916998 KW CROSS HIGH
americanbodycodedirectlyfeatureshotsystemstransportationvehiclevehicles
SHARED TOKENS (10): "american", "body", "code", "directly", "features", "hot", "systems", "transportation", "vehicle", "vehicles".
0.200
Street racing ↗ Q287988 KW CROSS HIGH
autoautomobileeventslegallocalmotorpolicepublicsafetystreet
SHARED TOKENS (10): "auto", "automobile", "events", "legal", "local", "motor", "police", "public", "safety", "street".
0.200
Window film ↗ Q480324 KW CROSS HIGH
associationautomotiveembeddedfoundedinternationalofficeperformanceprofessionalsafetytechnical
SHARED TOKENS (10): "association", "automotive", "embedded", "founded", "international", "office", "performance", "professional", "safety", "technical".
0.200
americandepartmentdepartmentsdirectlydotfederalgovernmentservingsystemtransportation
SHARED TOKENS (10): "american", "department", "departments", "directly", "dot", "federal", "government", "serving", "system", "transportation".
0.200
automotivecodehistoryinternationalmotormotorcyclespotentialsystemvehiclevehicles
SHARED TOKENS (10): "automotive", "code", "history", "international", "motor", "motorcycles", "potential", "system", "vehicle", "vehicles".
0.180
autocleanconditionequipmentgoaloperationsrestorationtechnicalvehicle
SHARED TOKENS (9): "auto", "clean", "condition", "equipment", "goal", "operations", "restoration", "technical", "vehicle".
0.180
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
easternidaholimitedlongmilesoregonsystemwestwestern
SHARED TOKENS (9): "eastern", "idaho", "limited", "long", "miles", "oregon", "system", "west", "western".
0.180
autoautomobilecompetingdealershipsdirectlyelectriclawssalesvehicles
SHARED TOKENS (9): "auto", "automobile", "competing", "dealerships", "directly", "electric", "laws", "sales", "vehicles".
0.180
Right of way ↗ Q17128254 KW CROSS HIGH
facilityfullgovernmentlegallocaloperatepartstransportationvehicles
SHARED TOKENS (9): "facility", "full", "government", "legal", "local", "operate", "parts", "transportation", "vehicles".
0.180
cleanfocusmotorregulatoryrequirementssystemstimesvehiclevehicles
SHARED TOKENS (9): "clean", "focus", "motor", "regulatory", "requirements", "systems", "times", "vehicle", "vehicles".
0.180
americanboisebrandfoundedhighidahomajorownedstorage
SHARED TOKENS (9): "american", "boise", "brand", "founded", "high", "idaho", "major", "owned", "storage".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyongrowingidahonamepartsstarwest
SHARED TOKENS (9): "ada", "boise", "canyon", "growing", "idaho", "name", "parts", "star", "west".
0.180
commercialheavylicenseoperatepartstrailerstrucksvehiclevehicles
SHARED TOKENS (9): "commercial", "heavy", "license", "operate", "parts", "trailers", "trucks", "vehicle", "vehicles".
0.180
automotivebatterychargingelectricelectricalmotorpowersystemsvehicle
SHARED TOKENS (9): "automotive", "battery", "charging", "electric", "electrical", "motor", "power", "systems", "vehicle".
0.180
Traffic light ↗ Q8004 KW CROSS HIGH
competinglawslightlocalnationalneedpolicesystemsystems
SHARED TOKENS (9): "competing", "laws", "light", "local", "national", "need", "police", "system", "systems".
0.180
Storm drain ↗ Q1139766 KW CROSS HIGH
connectfallsheavyinfrastructurepublicresidentialsmallstreetsystems
SHARED TOKENS (9): "connect", "falls", "heavy", "infrastructure", "public", "residential", "small", "street", "systems".
0.180
annualfacilityfoodgroupidahomajorownedproductriver
SHARED TOKENS (9): "annual", "facility", "food", "group", "idaho", "major", "owned", "product", "river".
0.160
americanassociationcategoryclassesfuelhotnationalsystem
SHARED TOKENS (8): "american", "association", "category", "classes", "fuel", "hot", "national", "system".
0.160
governmentlicensingmotorparkregisterregistrationvehiclevehicles
SHARED TOKENS (8): "government", "licensing", "motor", "park", "register", "registration", "vehicle", "vehicles".
0.160
buildingbusinesscenterlightnetworkpublicresidentialserving
SHARED TOKENS (8): "building", "business", "center", "light", "network", "public", "residential", "serving".
0.160
Pony car ↗ KW CROSS HIGH
americandrivelongmodelsoptionspartsvehiclevehicles
SHARED TOKENS (8): "american", "drive", "long", "models", "options", "parts", "vehicle", "vehicles".
0.160
infrastructurelawssafetysystemsystemstimestransportationvehicles
SHARED TOKENS (8): "infrastructure", "laws", "safety", "system", "systems", "times", "transportation", "vehicles".
0.160
autoautomotivebodycollisionnationalprofessionaltechniciansvehicle
SHARED TOKENS (8): "auto", "automotive", "body", "collision", "national", "professional", "technicians", "vehicle".
0.160
approvedlimitedmotorcyclesnearsidesuppliesvehiclesview
SHARED TOKENS (8): "approved", "limited", "motorcycles", "near", "side", "supplies", "vehicles", "view".
0.160
canyoneagleidaholongmeridiannamparivervalley
SHARED TOKENS (8): "canyon", "eagle", "idaho", "long", "meridian", "nampa", "river", "valley".
0.140
chaingroupinternationallogisticslongregiontransportation
SHARED TOKENS (7): "chain", "group", "international", "logistics", "long", "region", "transportation".
0.140
Lemon law ↗ Q452360 KW CROSS HIGH
lawlawsmotormotorcyclesperformancetrucksvehicles
SHARED TOKENS (7): "law", "laws", "motor", "motorcycles", "performance", "trucks", "vehicles".
0.140
driveeventfocuslicensemobileprimarilytimes
SHARED TOKENS (7): "drive", "event", "focus", "license", "mobile", "primarily", "times".
0.140
brandelectricfoundedmodelsmotormotorcyclesvehicles
SHARED TOKENS (7): "brand", "electric", "founded", "models", "motor", "motorcycles", "vehicles".
0.140
bodycitiesgoverninglegallimitedlocalowned
SHARED TOKENS (7): "body", "cities", "governing", "legal", "limited", "local", "owned".
0.140
Park and ride ↗ Q738031 KW CROSS HIGH
citieslightparkpublicsystemvehiclevehicles
SHARED TOKENS (7): "cities", "light", "park", "public", "system", "vehicle", "vehicles".
0.140
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahonampawestern
SHARED TOKENS (7): "boise", "caldwell", "canyon", "eastern", "idaho", "nampa", "western".
0.140
adabusinesscoalitionlawnationalpublicrequirements
SHARED TOKENS (7): "ada", "business", "coalition", "law", "national", "public", "requirements".
0.140
buildinggashotpublicregulationssafetysystem
SHARED TOKENS (7): "building", "gas", "hot", "public", "regulations", "safety", "system".
0.140
Oversize load ↗ Q680421 KW CROSS HIGH
equipmentheavyindustrialinfrastructurelegaltransportationtruck
SHARED TOKENS (7): "equipment", "heavy", "industrial", "infrastructure", "legal", "transportation", "truck".
0.120
americanbusinessescenterscitiesdrivegrowing
SHARED TOKENS (6): "american", "businesses", "centers", "cities", "drive", "growing".
0.120
Bullbar ↗ Q13705 KW CROSS HIGH
anothercollisionequipmentnamepolicevehicle
SHARED TOKENS (6): "another", "collision", "equipment", "name", "police", "vehicle".
0.120
Discount Tire ↗ Q5281735 KW CROSS HIGH
americanbusinesschainfoundedindependentoperates
SHARED TOKENS (6): "american", "business", "chain", "founded", "independent", "operates".
0.120
anotherchainlongopentimesvehicle
SHARED TOKENS (6): "another", "chain", "long", "open", "times", "vehicle".
0.120
americanidahomotorizedoregonvehiclevehicles
SHARED TOKENS (6): "american", "idaho", "motorized", "oregon", "vehicle", "vehicles".
0.120
centertowingtrailerstruckvehiclevertical
SHARED TOKENS (6): "center", "towing", "trailers", "truck", "vehicle", "vertical".
0.100
gardeni-84idahotreasurevalley
SHARED TOKENS (5): "garden", "i-84", "idaho", "treasure", "valley".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahokunanearly
SHARED TOKENS (5): "ada", "boise", "idaho", "kuna", "nearly".
0.100
Roundabout ↗ Q1525 KW CROSS HIGH
fullneedrulessafetyvehicles
SHARED TOKENS (5): "full", "need", "rules", "safety", "vehicles".
0.100
mobilenetworkprogramspublicvehicles
SHARED TOKENS (5): "mobile", "network", "programs", "public", "vehicles".
0.100
Spark plug ↗ Q193340 KW CROSS HIGH
designatedelectricfuelsidesystem
SHARED TOKENS (5): "designated", "electric", "fuel", "side", "system".
0.100
focusgrowingmotorizedsafetyuses
SHARED TOKENS (5): "focus", "growing", "motorized", "safety", "uses".
0.100
Motor oil ↗ Q193784 KW CROSS HIGH
cleanfuelmotorpartsperformance
SHARED TOKENS (5): "clean", "fuel", "motor", "parts", "performance".
0.100
featuresmotortruckvehiclevehicles
SHARED TOKENS (5): "features", "motor", "truck", "vehicle", "vehicles".
0.100
localmajorresidentialserveswider
SHARED TOKENS (5): "local", "major", "residential", "serves", "wider".
0.100
multipletransportationtrucktruckingvehicle
SHARED TOKENS (5): "multiple", "transportation", "truck", "trucking", "vehicle".
0.100
americandrivehightitlevalue
SHARED TOKENS (5): "american", "drive", "high", "title", "value".
0.100
communityhighopenprogramssecondary
SHARED TOKENS (5): "community", "high", "open", "programs", "secondary".
0.100
americanfoundedhistoryvehiclevehicles
SHARED TOKENS (5): "american", "founded", "history", "vehicle", "vehicles".
0.100
autoautomobilemechanicsrepairtechnicians
SHARED TOKENS (5): "auto", "automobile", "mechanics", "repair", "technicians".
0.100
Bike lane ↗ Q1378400 KW CROSS HIGH
businessesmarkedmotorsafetyvehicles
SHARED TOKENS (5): "businesses", "marked", "motor", "safety", "vehicles".
0.100
communityhomepublicsafetytransportation
SHARED TOKENS (5): "community", "home", "public", "safety", "transportation".
0.100
automobileeventeventsvehiclevehicles
SHARED TOKENS (5): "automobile", "event", "events", "vehicle", "vehicles".
◈ Frequently Asked Questions
Transportation Infrastructure × Automotive — Treasure Valley
HAIKU · HIGH GATE
How does Interstate 84 in Idaho affect diesel engine maintenance demand across Boise and Nampa?
Interstate 84 carries significant trucking industry traffic through Ada County and Canyon County, creating consistent demand for auto mechanics specializing in diesel engine service in both Boise and Nampa. The highway's heavy commercial use means repair shops along this corridor maintain higher volumes of truck maintenance than shops in areas with lighter traffic.
What role do Meridian and Eagle's growing road networks play in automotive repair service expansion?
Meridian and Eagle have experienced rapid infrastructure development that increased vehicle registration and daily commuting through Ada County, which directly expanded the customer base for auto mechanics in these communities. Transportation departments in the Treasure Valley designed these road systems to support population growth, which simultaneously created business opportunities for automotive service providers.
How do Canyon County's trucking industry operations depend on Caldwell-area road infrastructure?
Caldwell serves as a logistics hub for the trucking industry in the United States, with Canyon County's road network directly enabling freight movement to and from distribution centers. Auto mechanics in Caldwell specialize in diesel engine repair and maintenance because the local transportation infrastructure channels high volumes of commercial trucks through the region daily.
Why do Idaho State Police traffic enforcement patterns influence automotive repair priorities in the Treasure Valley?
Idaho State Police conduct safety inspections on Interstate 84 and local roads serving Boise, Nampa, and Meridian, which identifies vehicles requiring immediate mechanical repairs to maintain compliance. Auto mechanics throughout the Treasure Valley coordinate with law enforcement findings to prioritize diesel engine and brake system repairs on commercial vehicles that fail these roadside inspections.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Automotive 13 QID bridges 238 edges 7,043 ext links 2026-07-17 23:38:57 UTC 9232321259eba215
Transportation Infrastructure corridor ↗ Automotive corridor ↗ Automotive × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals