—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Data Center

12 Wikipedia bridge articles confirmed in both vertical ledgers. 186 deterministic cross-vertical edges. 5,104 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
186 Cross Edges
5,104 External Sources
219 Wikipedia Articles
14 🌲 Evergreen
123 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Data Center
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
186
External Sources Harvested
5,104
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (12)
ZoningEconomic developmentTelecommunicationsTreasure ValleyLand-use planningBoise, IdahoGarden City, IdahoNampa, IdahoAda County, IdahoKuna, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahosecondadadevelopmentlocallandnamecapitalallowinggovernmentgovernmentsgrowthland-useplanningpolicysingleaccordingeconomicfar
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:39:55 UTC
Content Hash
a5ed5b95279a86d3
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (25): "allowing", "building", "buildings", "density", "development", "different", "government", "governments", "growth", "industrial", "land", "land-use", "local", "method", "planning", "policy", "regulatory", "scale", "shape", "single".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in data_center: "Zoning".
allowingbuildingbuildingsdensitydevelopmentdifferentgovernmentgovernmentsgrowthindustriallandland-uselocalmethodplanningpolicyregulatoryscaleshapesinglesizesystemszonezoneszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
E
Q4530482 EXACT TITLE 1.000
QID OVERLAP: Q4530482 in transportation_infrastructure (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (18): "according", "describes", "development", "economic", "especially", "far", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "policies", "policy", "process", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development". | EXACT TITLE in data_center: "Economic development".
accordingdescribesdevelopmenteconomicespeciallyfargrowthhistoricallyincreasesindividualinfrastructurelocalmarketpoliciespolicyprocessregionwest
mics, economic development (or economic and social development) is the process by which the economic well-being and quality of life of a nation, region, local community, or an individual are improved according to targeted goals and objectives. The term has been used frequently in the 20th and 21st centuries, but the concept has existed in the West for far longer. "Modernization", "Globalization", and especially "Industrialization" are other terms often used while discussing economic development.
The precise definition of economic development has been contested: while economists in the 20th century viewed development primarily in terms of economic growth, sociologists instead emphasized broader processes of change and modernization. Development and urban studies scholar Karl Seidman summarizes economic development as "a process of creating and utilizing physical, human, financial, and social assets to generate improved and broadly shared economic well-being and quality of life for a community or region". Daphne Greenwood and Richard Holt distinguish economic development from economic growth on the basis that economic development is a "broadly based and sustainable increase in the overall standard of living for individuals within a community", and measures of growth such as per capita income do not necessarily correlate with improvements in quality of life. The United Nations Development Programme in 1997 defined development as increasing people‟s choices. Choices depend on the people in question and their nation. The UNDP indicates four chief factors in development, especially human development, which are empowerment, equity, productivity, and sustainability. Mansell and Wehn state that economic development has been understood by non-practitioners since the World War II to involve economic growth, namely the increases in per capita income, and (if currently absent) the attainment of a standard of living equivalent to that of industrialized countries. Economic development can also be considered as a static theory that documents the state of an economy at a certain place. According to Schumpeter and Backhaus (2003), the changes in this equilibrium state documented in economic theory can only be caused by intervening factors coming from the outside. History Economic development originated in the post-war period of reconstruction initiated by the United States.
"More than half the people of the world are living in conditions approaching misery. Their food is inadequate, they are victims of the disease. Their economic life is primitive and stagnant. Their poverty is a handicap and a threat both to them and to more prosperous areas. For the first time in history, humanity possesses the knowledge and the skill to relieve the suffering of these people ... I believe that we should make available to peace-loving people the benefits of our store of technical knowledge to help them realize their aspirations for a better life… What we envisage is a program of development based on the concepts of democratic fair dealing ... Greater production is the key to prosperity and peace. And the key to greater production is a wider and more vigorous application of modem scientific and technical knowledge." There have been several major phases of development theory since 1945. Alexander Gerschenkron argued that the less developed the country is at the outset of economic development (relative to others), the more likely certain conditions are to occur. Hence, all countries do not progress similarly. From the 1940s to the 1960s the state played a large role in promoting industrialization in developing countries, following the idea of modernization theory. This period was followed by a brief period of basic needs development focusing on human capital development and redistribution in the 1970s. Neoliberalism emerged in the 1980s pushing an agenda of free trade and removal of import substitution industrialization policies. In economics, the study of economic development was born out of an extension to traditional economics that focused entirely on the national product, or the aggregate output of goods and services. Economic development was concerned with the expansion of people's entitlements and their corresponding capabilities, such as morbidity, nourishment, literacy, education, and other socio-economic indicators. Borne out of the backdrop of Keynesian economics (advocating government intervention), and neoclassical economics (stressing reduced intervention), with the rise of high-growth countries (Singapore, South Korea, Hong Kong) and planned governments (Argentina, Chile, Sudan, Uganda), economic development and more generally development economics emerged amidst these mid-20th century theoretical interpretations of how economies prosper. Also, economist Albert O. Hirschman, a major contributor to development economics, asserted that economic development grew to concentrate on the poor regions of the world, primarily in Africa, Asia and Latin America yet on the outpouring of fundamental ideas and models. It has also been argued, notably by Asian and European proponents of infrastructure-based development, that systematic, long-term government investments in transportation, housing, education, and healthcare are necessary to ensure sustainable economic growth in emerging countries. During Robert McNamara's 13 years at the World Bank, he introduced key changes, most notably, shifting the Bank's economic development policies toward targeted poverty reduction. Before his tenure at the World Bank, poverty did not receive substantial attention as part of international and national economic development; the focus of development had been on industrialization and infrastructure. Poverty also came to be redefined as a condition faced by people rather than countries. According to Martha Finnemore, the World Bank under McNamara's tenure "sold" states poverty reduction "through a mixture of persuasion and coercion." Economic development goals The development of a country has been associated with different concepts but generally encompasses economic growth through higher productivity, political systems that represents the preferences of its citizens as accurately as possible, the extension of rights to all social groups and the opportunities to get them and proper functionalities of the institutions and the organizations that engages in more technical and complex tasks (i.e. raise taxes and deliver public services). These processes describe the State's capabilities to manage its economy, polity, society and public administration. Generally, economic development policies attempt to solve issues in those topics. Economic development is typically associated with improvements in a variety of areas or indicators (such as literacy rates, life expectancy, and poverty rates), that may be the causes of economic development rather than the consequences of specific economic development programs. For example, health and education improvements have been closely related to economic growth, but the causality with economic development may not be obvious. In any case, it is important to not expect that particular economic development programs be able to fix many problems at once as that would establish unsurmountable goals that are highly unlikely to be achieved. Any development policy should have targeted goals and a gradual approach should be to avoid those goals being burdensome which has been termed by Prittchet, Woolcock and Andrews as 'premature load bearing'. The State's capabilities, most often, limits the economic development goals of countries. For example, if a nation has minimum capacity to carry out basic functions, such as security and policing, or core service deliveries, it is unlikely that a program, that aims to foster a free-trade zone (special economic zones) or distribute vaccinations to vulnerable populations, can accomplish their goals. This has been overlooked by multiple international organizations, aid programs and even participating governments who attempt to carry out the 'best practices' from other places in a carbon-copy manner with Insignificant achievements. This isomorphic mimicry –adopting organizational forms that have been successful elsewhere– hide institutional dysfunctions without any solutions contributes countries stuck in 'capability traps' where the country does not meets its development goals. An example of this can be seen through some of the criticisms of foreign aid and its success rate at helping countries develop. Beyond the incentive compatibility problems that can happen to foreign aid donations –that foreign aid granting countries continue to give it to countries with little results of economic growth but with corrupt leaders that are aligned with the granting countries' geopolitical interests and agenda –there are problems of fiscal fragility associated to receiving an important amount of government revenues through foreign aid. Governments that can raise a significant amount of revenue from this source are less accountable to their citizens (they are more autonomous) as they have less pressure to legitimately use those resources. Just as it has been documented for countries with an abundant supply of natural resources such as oil, countries whose government budget consists largely of foreign aid donations and not regular taxes are less likely to have incentives to develop effective public institutions.
Telecommunications
Q418 EXACT TITLE 1.000
QID OVERLAP: Q418 in transportation_infrastructure (tier:evergreen) and data_center (tier:branch). | SHARED TOKENS (18): "access", "allowing", "data", "decades", "development", "digital", "divided", "electric", "electrical", "individual", "information", "means", "physical", "power", "signals", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
accessallowingdatadecadesdevelopmentdigitaldividedelectricelectricalindividualinformationmeansphysicalpowersignalssingletechnologyusers
dually been supplemented by data. The physical limitations of metallic media prompted the development of optical fibre. The Internet, a technology independent of any given medium, has provided global access to services for individual users and further reduced location and time limitations on communications. Definition At the 1932 Plenipotentiary Telegraph Conference and the International Radiotelegraph Conference in Madrid, the two organizations merged to form the International Telecommunication Union (ITU). They defined telecommunication as "any telegraphic or telephonic communication of signs, signals, writing, facsimiles and sounds of any kind, by wire, wireless or other systems or processes of electric signaling or visual signaling (semaphores)." The definition was later reconfirmed, according to Article 1.3 of the ITU Radio Regulations, which defined it as "Any transmission, emission or reception of signs, signals, writings, images and sounds or intelligence of any nature by wire, radio, optical, or other electromagnetic systems". As such, slow communications technologies like postal mail and pneumatic tubes are excluded from the telecommunication's definition. The term telecommunication was coined in 1904 by the French engineer and novelist Édouard Estaunié, who defined it as "remote transmission of thought through electricity". Telecommunication is a compound noun formed from the Greek prefix tele- (τῆλε), meaning distant, far off, or afar, and the Latin verb communicare, meaning to share. Communication was first used as an English word in the late 14th century.
Macroeconomics On the macroeconomic scale, Lars-Hendrik Röller and Leonard Waverman suggested a causal link between good telecommunication infrastructure and economic growth. Few dispute the existence of a correlation although some argue it is wrong to view the relationship as causal. Because of the economic benefits of good telecommunication infrastructure, there is increasing worry about the inequitable access to telecommunication services amongst various countries of the world—this is known as the digital divide. A 2003 survey by the International Telecommunication Union (ITU) revealed that roughly a third of countries have fewer than one mobile subscription for every 20 people and one-third of countries have fewer than one land-line telephone subscription for every 20 people. In terms of Internet access, roughly half of all countries have fewer than one out of 20 people with Internet access. From this information, as well as educational data, the ITU was able to compile an index that measures the overall ability of citizens to access and use information and communication technologies.
Social impact Telecommunication has played a significant role in social relationships. Nevertheless, devices like the telephone system were originally advertised with an emphasis on the practical dimensions of the device (such as the ability to conduct business or order home services) as opposed to the social dimensions. It was not until the late 1920s and 1930s that the social dimensions of the device became a prominent theme in telephone advertisements. New promotions started appealing to consumers' emotions, stressing the importance of social conversations and staying connected to family and friends. Since then, the role that telecommunications have played in social relations has become increasingly important. In recent years, the popularity of social networking sites has increased dramatically. These sites allow users to communicate with each other as well as post photographs, events and profiles for others to see. The profiles can list a person's age, interests, sexual preference and relationship status. In this way, these sites can play an important role in everything from organising social engagements to courtship. Prior to social networking sites, technologies like short message service (SMS) and the telephone also had a significant impact on social interactions. In 2000, market research group Ipsos MORI reported that 81% of 15- to 24-year-old SMS users in the United Kingdom had used the service to coordinate social arrangements and 42% to flirt. Entertainment, news, and advertising In cultural terms, telecommunication has increased the public's ability to access music and film. With television, people can watch films they have not seen before in their own home without having to travel to the video store or cinema. With radio and the Internet, people can listen to music they have not heard before without having to travel to the music store. Telecommunication has also transformed the way people receive their news. A 2006 survey (right table) of slightly more than 3,000 Americans by the non-profit Pew Internet and American Life Project in the United States the majority specified television or radio over newspapers. Telecommunication has had an equally significant impact on advertising.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (14): "agricultural", "boise", "commerce", "historically", "idaho", "land", "local", "lower", "name", "region", "resources", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in data_center: "Treasure Valley".
agriculturalboisecommercehistoricallyidaholandlocallowernameregionresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (35): "applied", "attractive", "central", "changes", "cities", "conditions", "depends", "design", "development", "economic", "efficiency", "environmental", "essential", "exposure", "facilities", "future", "goal", "governments", "land", "land-use"....
appliedattractivecentralchangescitiesconditionsdependsdesigndevelopmenteconomicefficiencyenvironmentalessentialexposurefacilitiesfuturegoalgovernmentslandland-usemeansneedsoptionsphysicalplanplanningprocessprojectregionalremains+5
n used interchangeably, and will depend on the state, county, and/or project in question. Despite confusing nomenclature, the essential function of land use planning remains the same whatever term is applied. The Canadian Institute of Planners offers a definition that land use planning means the scientific, aesthetic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
ies. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
Land use planning or land-use regulation is the process of regulating the use of land by a central authority. Usually, this is done to promote more desirable social and environmental outcomes as well as a more efficient use of resources. More specifically, the goals of modern land use planning often include environmental conservation, restraint of urban sprawl, minimization of transport costs, prevention of land use conflicts, and a reduction in exposure to pollutants. In the pursuit of these goals, planners assume that regulating the use of land will change the patterns of human behavior, and that these changes are beneficial. The first assumption, that regulating land use changes the patterns of human behavior is widely accepted. However, the second assumption – that these changes are beneficial – is contested, and depends on the location and regulations being discussed. In urban planning, land use planning seeks to order and regulate land use in an efficient and ethical way, thus preventing land use conflicts. Governments use land use planning to manage the development of land within their jurisdictions. In doing so, the governmental unit can plan for the needs of the community while safeguarding natural resources. To this end, it is the systematic assessment of land and water potential, alternatives for land use, and economic and social conditions in order to select and adopt the best land use options. Often one element of a comprehensive plan, a land use plan provides a vision for the future possibilities of development in neighborhoods, districts, cities, or any defined planning area. In the United States, the terms land use planning, regional planning, urban planning, and urban design are often used interchangeably, and will depend on the state, county, and/or project in question. Despite confusing nomenclature, the essential function of land use planning remains the same whatever term is applied. The Canadian Institute of Planners offers a definition that land use planning means the scientific, aesthetic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "capital", "downtown", "feet", "idaho", "major", "manufacturing", "technology", "treasure", "valley".
adaannualboisecapitaldowntownfeetidahomajormanufacturingtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
QID OVERLAP 0.700
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and data_center (tier:branch). | SHARED TOKENS (10): "ada", "boise", "government", "idaho", "municipal", "name", "nearly", "second", "separate", "street".
adaboisegovernmentidahomunicipalnamenearlysecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Nampa, Idaho
Q622633 QID OVERLAP 0.680
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (9): "according", "boise", "idaho", "meaning", "name", "nampa", "second", "west", "western".
accordingboiseidahomeaningnamenampasecondwestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and data_center (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "far", "idaho", "local", "private", "roads", "second".
adaboisecapitalfaridaholocalprivateroadssecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "nearly", "percent".
adaadditionalboiseidahokunanearlypercent
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (6): "ada", "boise", "capital", "cities", "idaho", "second".
adaboisecapitalcitiesidahosecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.560
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and data_center (tier:branch). | SHARED TOKENS (3): "boise", "idaho", "nampa".
boiseidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
174 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP174 edges
🌲 EVERGREEN3 edges
0.650
carriercarrierscommercecommissionconstructioneconomicgovernmentindustrymattersrateregulatoryrelevanttraffictransportationwater
SHARED TOKENS (15): "carrier", "carriers", "commerce", "commission", "construction", "economic", "government", "industry", "matters", "rate", "regulatory", "relevant", "traffic", "transportation", "water". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
commercialefficiencyfiscalfuellandmanagedpercentplanningprogramprojectspublicrevenuesizetaxtrust
SHARED TOKENS (15): "commercial", "efficiency", "fiscal", "fuel", "land", "managed", "percent", "planning", "program", "projects", "public", "revenue", "size", "tax", "trust". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalairanotherbaseboisecapacitycapitalcentercitiescostdemandenvironmentalfirmsfuelgovernmenthighidahoinsurancekuna
SHARED TOKENS (52): "ada", "additional", "air", "another", "base", "boise", "capacity", "capital", "center", "cities", "cost", "demand", "environmental", "firms", "fuel", "government", "high", "idaho", "insurance", "kuna".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH122 edges
0.500
Meta Platforms ↗ Q380 EXACT TITLE
businessdescribeddevelopmentdigitalestablishedlistmarketnetworkpercentplatformspublicrevenueshifttechnologythirdtoward
SHARED TOKENS (16): "business", "described", "development", "digital", "established", "list", "market", "network", "percent", "platforms", "public", "revenue", "shift", "technology", "third", "toward". | EXACT TITLE in data_center: "Meta Platforms".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlandlocalpathsplaceprimaryprivatepublicroadroadsstreettraffic
SHARED TOKENS (15): "access", "another", "design", "distinction", "land", "local", "paths", "place", "primary", "private", "public", "road", "roads", "street", "traffic". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in data_center: "Road".
0.500
assetassociatedbuildingbuildingsbuiltconstructiondesigndevelopmenteconomicfacilitiesindustrialindustryinfrastructurepercentplanningprocesswork
SHARED TOKENS (17): "asset", "associated", "building", "buildings", "built", "construction", "design", "development", "economic", "facilities", "industrial", "industry", "infrastructure", "percent", "planning", "process", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in data_center: "Construction".
0.500
agriculturalairapproximatelyclimateindustrialirrigationmultipleresourceresourcesservesmallsourcesouthsupplyusefulwater
SHARED TOKENS (16): "agricultural", "air", "approximately", "climate", "industrial", "irrigation", "multiple", "resource", "resources", "serve", "small", "source", "south", "supply", "useful", "water". | EXACT TITLE in transportation_infrastructure: "Water resources".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalapproximatelyassociatedboisecapitaldistinctdividedidaholandmanufacturingmillionnationalseparatesignificantsmallsouthtechnologyterritorywestwestern
SHARED TOKENS (21): "agricultural", "approximately", "associated", "boise", "capital", "distinct", "divided", "idaho", "land", "manufacturing", "million", "national", "separate", "significant", "small", "south", "technology", "territory", "west", "western".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in data_center: "Idaho".
0.500
airbuildingcentercenterscommercialdedicateddeliverydemandfacilityfirmshandlinglaborlargelogisticsmarketnameneedednetworkoperateorganizations
SHARED TOKENS (28): "air", "building", "center", "centers", "commercial", "dedicated", "delivery", "demand", "facility", "firms", "handling", "labor", "large", "logistics", "market", "name", "needed", "network", "operate", "organizations".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
accessexistingfuturegovernmentlawlocalparticipationplanningplansprocessprogramsprojectspublicregionaltransportation
SHARED TOKENS (15): "access", "existing", "future", "government", "law", "local", "participation", "planning", "plans", "process", "programs", "projects", "public", "regional", "transportation". | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
approachbroadercitiesdevelopmenteconomicenvironmentalfarmlandgrowthindividualindustrialinfrastructurelandland-usenationalneedsnetworkplanningplansregionregional
SHARED TOKENS (28): "approach", "broader", "cities", "development", "economic", "environmental", "farmland", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "national", "needs", "network", "planning", "plans", "region", "regional".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessclimateconditionsconnectivitydevelopmentdifferentdistincteconomicelectricalemergencyenvironmentenvironmentalespeciallyessentialfacilitiesfirmsgoalindustrialindustryinfrastructure
SHARED TOKENS (42): "access", "climate", "conditions", "connectivity", "development", "different", "distinct", "economic", "electrical", "emergency", "environment", "environmental", "especially", "essential", "facilities", "firms", "goal", "industrial", "industry", "infrastructure".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in data_center: "Infrastructure".
0.500
airalreadybecomecapacitycleanclimatecompetitivecostcurrentelectricityenergyenvironmentalespeciallyevenexpansionfarfinancialfuelgenerationgrowing
SHARED TOKENS (42): "air", "already", "become", "capacity", "clean", "climate", "competitive", "cost", "current", "electricity", "energy", "environmental", "especially", "even", "expansion", "far", "financial", "fuel", "generation", "growing".... | EXACT TITLE in data_center: "Renewable energy".
0.500
agriculturalchoicesclimateconcentrateddevelopmentdriverenvironmentenvironmentalgrowinggrowthhighimpactincreaseindividuallimitedmillionpolicyprocessprojectsrate
SHARED TOKENS (22): "agricultural", "choices", "climate", "concentrated", "development", "driver", "environment", "environmental", "growing", "growth", "high", "impact", "increase", "individual", "limited", "million", "policy", "process", "projects", "rate".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
Site selection ↗ EXACT TITLE
businesscorporatedataexpandedfacilitygovernmentgovernmentsnationalneedsoperationsprojectscaleselectionsitetraffic
SHARED TOKENS (15): "business", "corporate", "data", "expanded", "facility", "government", "governments", "national", "needs", "operations", "project", "scale", "selection", "site", "traffic". | EXACT TITLE in data_center: "Site selection".
0.500
accordingairapproachbecomeschangesclimatecompetitivecriticalenvironmentessentialexposuregrowthhistoryimpactincreasesknowledgelimitedloadloadsmeaning
SHARED TOKENS (24): "according", "air", "approach", "becomes", "changes", "climate", "competitive", "critical", "environment", "essential", "exposure", "growth", "history", "impact", "increases", "knowledge", "limited", "load", "loads", "meaning".... | EXACT TITLE in data_center: "Critical load".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralcommercialconnectedcontrolcustomerdifferentelectricelectricalenergygenerationhighindustrialinfrastructurelargeloweroperatedpowerreceivingsupply
SHARED TOKENS (22): "approximately", "central", "commercial", "connected", "control", "customer", "different", "electric", "electrical", "energy", "generation", "high", "industrial", "infrastructure", "large", "lower", "operated", "power", "receiving", "supply".... | EXACT TITLE in data_center: "Substation".
0.500
airapproximatelydatafacilitiesfiscalgovernmentlawlocaloperatedpoliciesprimaryregulatorysecuritysystemsystemstransittransportationtreatment
SHARED TOKENS (18): "air", "approximately", "data", "facilities", "fiscal", "government", "law", "local", "operated", "policies", "primary", "regulatory", "security", "system", "systems", "transit", "transportation", "treatment". | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganothercustomersdedicatedfacilityinformationlogisticsmanagedmodelneedsoperationalphysicalplanningproblemsprofessionalprovidepublicresourceresourcessignificant
SHARED TOKENS (23): "according", "another", "customers", "dedicated", "facility", "information", "logistics", "managed", "model", "needs", "operational", "physical", "planning", "problems", "professional", "provide", "public", "resource", "resources", "significant".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in data_center: "Logistics".
0.500
existingfinancialgovernmentlocalofficeoperateoperatorsprogramsprovidersprovidingpublicregionalsystemstechnicaltransittransporttransportation
SHARED TOKENS (17): "existing", "financial", "government", "local", "office", "operate", "operators", "programs", "providers", "providing", "public", "regional", "systems", "technical", "transit", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
broaderbuildingscapitalcategoryconstructedconstructioneconomicelectricalemploymentenvironmentalfacilitiesgovernmenthospitalsinfrastructurelong-termmunicipaloperatorphysicalprivateprojects
SHARED TOKENS (27): "broader", "buildings", "capital", "category", "constructed", "construction", "economic", "electrical", "employment", "environmental", "facilities", "government", "hospitals", "infrastructure", "long-term", "municipal", "operator", "physical", "private", "projects".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
advancedanalysisarchitectureassociatedbecomecreateenvironmentgrowthhistoryintelligenceknowledgelong-termmultipleoperationsplanningrisksspacesupportsystems
SHARED TOKENS (19): "advanced", "analysis", "architecture", "associated", "become", "create", "environment", "growth", "history", "intelligence", "knowledge", "long-term", "multiple", "operations", "planning", "risks", "space", "support", "systems". | EXACT TITLE in data_center: "Artificial intelligence".
0.500
accessairallowingcompetingcompetitivecontractingcoordinationcorridorsdevelopmenteconomicefficiencyestatefinancialgovernmentindustryinfrastructureintegratedintendedinvestmentlocal
SHARED TOKENS (44): "access", "air", "allowing", "competing", "competitive", "contracting", "coordination", "corridors", "development", "economic", "efficiency", "estate", "financial", "government", "industry", "infrastructure", "integrated", "intended", "investment", "local".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
appliedconstructioncontextcontroldescribeddesignedindustrialinformationinvolvinglaborlargeoperationspowerprimarysourcestructuresystems
SHARED TOKENS (17): "applied", "construction", "context", "control", "described", "designed", "industrial", "information", "involving", "labor", "large", "operations", "power", "primary", "source", "structure", "systems". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
approvedefficiencyfacilitiesindividuallocalmajornationalnetworkorganizationsplanningroadsservingsystemtransporttransportation
SHARED TOKENS (15): "approved", "efficiency", "facilities", "individual", "local", "major", "national", "network", "organizations", "planning", "roads", "serving", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingcitiesconcentrateddifferentdividedexistingformergovernmentgovernmentslawlocalmultiplepowerprovidingregionalspecificsubdivisionsubdivisionsterritorythem
SHARED TOKENS (20): "according", "cities", "concentrated", "different", "divided", "existing", "former", "government", "governments", "law", "local", "multiple", "power", "providing", "regional", "specific", "subdivision", "subdivisions", "territory", "them". | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in data_center: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisconstructiondevelopmentdigitalenvironmentgovernmenthistorylandlawplanningpointsprofessionalthemtransportationwork
SHARED TOKENS (15): "analysis", "construction", "development", "digital", "environment", "government", "history", "land", "law", "planning", "points", "professional", "them", "transportation", "work". | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
adaairbaseboisecentercommercialcommissiondowntownfacilityidahoincreasemillionnationaloperatedrightssouthsupportwestern
SHARED TOKENS (18): "ada", "air", "base", "boise", "center", "commercial", "commission", "downtown", "facility", "idaho", "increase", "million", "national", "operated", "rights", "south", "support", "western". | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
LEED ↗ Q1521623 EXACT TITLE
anotherbuildingbuildingscenterscertificationchoicesclimateconstructiondescribeddesignenergyenvironmentalfeetfinalframeworkgovernmentshealthcareindustrylocallower
SHARED TOKENS (37): "another", "building", "buildings", "centers", "certification", "choices", "climate", "construction", "described", "design", "energy", "environmental", "feet", "final", "framework", "governments", "healthcare", "industry", "local", "lower".... | EXACT TITLE in data_center: "LEED".
0.500
changescleancontrolcoordinationenvironmentalgovernmentsinvolvinglawmajornamephysicalprimaryprovidingrecoveryresourcetreatmentwater
SHARED TOKENS (17): "changes", "clean", "control", "coordination", "environmental", "governments", "involving", "law", "major", "name", "physical", "primary", "providing", "recovery", "resource", "treatment", "water". | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbuiltconcreteconnectionconstructedconstructioncontributionscreatedesigndesigneddesignsenvironmentimpactsindustrialintendedloadslocalmajormaximummeet
SHARED TOKENS (34): "allowing", "built", "concrete", "connection", "constructed", "construction", "contributions", "create", "design", "designed", "designs", "environment", "impacts", "industrial", "intended", "loads", "local", "major", "maximum", "meet".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalapplicationcentralchangesconditionscontrolcontrolledenvironmentalgrowthhelpshighimprovementsirrigationlandnetworkoperationspressureproblemsreducerole
SHARED TOKENS (26): "agricultural", "application", "central", "changes", "conditions", "control", "controlled", "environmental", "growth", "helps", "high", "improvements", "irrigation", "land", "network", "operations", "pressure", "problems", "reduce", "role".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in data_center: "Irrigation".
0.500
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingbuildingsbusinessescitiesdesignedfacilityindustriallargeloadloadingmanufacturersmanufacturingplacedtransport
SHARED TOKENS (15): "associated", "building", "buildings", "businesses", "cities", "designed", "facility", "industrial", "large", "load", "loading", "manufacturers", "manufacturing", "placed", "transport". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
buildingsbuiltconstructiondesignenvironmentfirmsgovernmentinfrastructuremunicipalnationalphysicalplaceprivateprofessionalpublicroadssystems
SHARED TOKENS (17): "buildings", "built", "construction", "design", "environment", "firms", "government", "infrastructure", "municipal", "national", "physical", "place", "private", "professional", "public", "roads", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalapproximatelybusinesscorridordailyfiscallimitedmanagedmillionnationalnearlynetworkoperateoperatorreportingrevenueroutesservesouthsupport
SHARED TOKENS (22): "additional", "approximately", "business", "corridor", "daily", "fiscal", "limited", "managed", "million", "national", "nearly", "network", "operate", "operator", "reporting", "revenue", "routes", "serve", "south", "support".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
adaboisedevelopmenteducationidaholargenampaprimaryprogramspublicreportedsouthwesttechnicaltreasurevalleywesternworkforce
SHARED TOKENS (17): "ada", "boise", "development", "education", "idaho", "large", "nampa", "primary", "programs", "public", "reported", "southwest", "technical", "treasure", "valley", "western", "workforce". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
capitalconnectiondesigneddieselelectricelectricalelectricityemergencyenergyevenfarfuelloadloadspowerprovidesizespecificsupplysupport
SHARED TOKENS (20): "capital", "connection", "designed", "diesel", "electric", "electrical", "electricity", "emergency", "energy", "even", "far", "fuel", "load", "loads", "power", "provide", "size", "specific", "supply", "support". | EXACT TITLE in data_center: "Diesel generator".
0.500
becomecentercontrolcreatescriticaldatadesignedelectricalgoalincreaseindustrymeanspowerreliabilitysmallsystemsystems
SHARED TOKENS (17): "become", "center", "control", "creates", "critical", "data", "designed", "electrical", "goal", "increase", "industry", "means", "power", "reliability", "small", "system", "systems". | EXACT TITLE in data_center: "Redundancy (engineering)".
0.500
Data center ↗ Q671224 EXACT TITLE
accordingaloneassociatedbuildingcentercenterscleanconditionsconnectioncontroldatademanddifferentdigitaledgeelectricalelectricityenergyenvironmentalfacilities
SHARED TOKENS (59): "according", "alone", "associated", "building", "center", "centers", "clean", "conditions", "connection", "control", "data", "demand", "different", "digital", "edge", "electrical", "electricity", "energy", "environmental", "facilities".... | EXACT TITLE in data_center: "Data center".
0.500
approachbusinessesdesigndesignsfacilitiesfuturegovernmentimpactsmoveneedsplanningpoliciesprivateprocesspublicsystemtransporttransportation
SHARED TOKENS (18): "approach", "businesses", "design", "designs", "facilities", "future", "government", "impacts", "move", "needs", "planning", "policies", "private", "process", "public", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessbeyondcitiescustomersdailydesignedeconomicgovernmentlocaloperateoperatedoperatorsorganizationsprivateprovideprovidingpublicroutesservingsmall
SHARED TOKENS (25): "access", "beyond", "cities", "customers", "daily", "designed", "economic", "government", "local", "operate", "operated", "operators", "organizations", "private", "provide", "providing", "public", "routes", "serving", "small".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
airconstructionemergencyidahoindustrialintegratedmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (14): "air", "construction", "emergency", "idaho", "industrial", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.480
activityboisebusinesseducationfiscalhighidahomillionprogramprogramspublicreportedschoolwest
SHARED TOKENS (14): "activity", "boise", "business", "education", "fiscal", "high", "idaho", "million", "program", "programs", "public", "reported", "school", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University".
0.460
articleconvertcustomersefficiencyfacilitieslogisticsnetworkstructuresupplysystemsystemsthemvalue
SHARED TOKENS (13): "article", "convert", "customers", "efficiency", "facilities", "logistics", "network", "structure", "supply", "system", "systems", "them", "value". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.440
Culvert ↗ Q4168092 EXACT TITLE
allowingconcretedesignedneedprocessroadroadsselectionshapestructuretrafficwater
SHARED TOKENS (12): "allowing", "concrete", "designed", "need", "process", "road", "roads", "selection", "shape", "structure", "traffic", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.440
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalhighintegratednetworkplannedprovidesignalstechnology
SHARED TOKENS (12): "access", "context", "data", "different", "digital", "high", "integrated", "network", "planned", "provide", "signals", "technology". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.440
commissioncustomerselectricityidahointermountainoperatedpowerprovidepublicutilitiesutilitywater
SHARED TOKENS (12): "commission", "customers", "electricity", "idaho", "intermountain", "operated", "power", "provide", "public", "utilities", "utility", "water". | EXACT TITLE in data_center: "Idaho Public Utilities Commission".
0.440
corridordevelopmentfinancialgovernmentnationalpolicyprogramsprovidepublicrightssupporttransportation
SHARED TOKENS (12): "corridor", "development", "financial", "government", "national", "policy", "programs", "provide", "public", "rights", "support", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.430
idaholawmunicipalpublic
SHARED TOKENS (4): "idaho", "law", "municipal", "public". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.400
corridorsenvironmentalespeciallyindustriallandmultiplerightsserveusersutility
SHARED TOKENS (10): "corridors", "environmental", "especially", "industrial", "land", "multiple", "rights", "serve", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.400
aircleaneducationenvironmentidahoprofessionalprogramspublicsupportswater
SHARED TOKENS (10): "air", "clean", "education", "environment", "idaho", "professional", "programs", "public", "supports", "water". | EXACT TITLE in data_center: "Idaho Conservation League".
0.400
articlecontrolsdesigndifferentmajormeetroadroadsseparatetraffic
SHARED TOKENS (10): "article", "controls", "design", "different", "major", "meet", "road", "roads", "separate", "traffic". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.400
Pedestrian ↗ Q221488 EXACT TITLE
associatedcitieshistoricallynetworkpathsprofessionalroadstraffictransportwider
SHARED TOKENS (10): "associated", "cities", "historically", "network", "paths", "professional", "roads", "traffic", "transport", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.400
airanotherdesignformerincreaseslawmethodmovesecondthem
SHARED TOKENS (10): "air", "another", "design", "former", "increases", "law", "method", "move", "second", "them". | EXACT TITLE in data_center: "Air cooling".
0.380
Colocation ↗ EXACT TITLE
businesscenterdatamethodofficesinglespacestructuresystem
SHARED TOKENS (9): "business", "center", "data", "method", "office", "single", "space", "structure", "system". | EXACT TITLE in data_center: "Colocation".
0.380
certificationcontinuedhelpslaborpermanentprofessionalregulatedsystemtraining
SHARED TOKENS (9): "certification", "continued", "helps", "labor", "permanent", "professional", "regulated", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.380
aircertificationcommercialcontrolgovernmentspacesurroundingtraffictransportation
SHARED TOKENS (9): "air", "certification", "commercial", "control", "government", "space", "surrounding", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.380
additionalaircarriershistorylatermajornetworkoperatingregional
SHARED TOKENS (9): "additional", "air", "carriers", "history", "later", "major", "network", "operating", "regional". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.380
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbanksbasecontrolhighlandnearvalleywater
SHARED TOKENS (9): "agricultural", "banks", "base", "control", "high", "land", "near", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.380
differentespeciallyirrigationlawphysicalsourcesystemsuserswater
SHARED TOKENS (9): "different", "especially", "irrigation", "law", "physical", "source", "systems", "users", "water". | EXACT TITLE in data_center: "Water right".
0.380
Sidewalk ↗ Q177749 EXACT TITLE
buildingsconcretedesignedlandprivateroadsidesouthstreet
SHARED TOKENS (9): "buildings", "concrete", "designed", "land", "private", "road", "side", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.380
majorofficeprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (9): "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.360
businesselectricalelectricitygenerationidahopowerregulatedutility
SHARED TOKENS (8): "business", "electrical", "electricity", "generation", "idaho", "power", "regulated", "utility". | EXACT TITLE in data_center: "Idaho Power".
0.360
centersdataindividualinfrastructurephysicalpointsprovidesystems
SHARED TOKENS (8): "centers", "data", "individual", "infrastructure", "physical", "points", "provide", "systems". | EXACT TITLE in data_center: "Internet infrastructure".
0.340
Snowplow ↗ Q14976 EXACT TITLE
especiallyintendedlargeservingspecifictransportationwinter
SHARED TOKENS (7): "especially", "intended", "large", "serving", "specific", "transportation", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.340
Disaster recovery ↗ EXACT TITLE
emergencyinformationinfrastructureplanprofessionalrecoverytechnology
SHARED TOKENS (7): "emergency", "information", "infrastructure", "plan", "professional", "recovery", "technology". | EXACT TITLE in data_center: "Disaster recovery".
0.320
Land development ↗ EXACT TITLE
buildingdevelopmentestatehousinglandreal
SHARED TOKENS (6): "building", "development", "estate", "housing", "land", "real". | EXACT TITLE in transportation_infrastructure: "Land development".
0.320
roadroadsroutessystemtraffictransport
SHARED TOKENS (6): "road", "roads", "routes", "system", "traffic", "transport". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.320
boiseexpansionformeridahooperatingserve
SHARED TOKENS (6): "boise", "expansion", "former", "idaho", "operating", "serve". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.300
architectureassociatedcentersdatademanddigitalenvironmentinfrastructurelargemapnodeoperatingprovideprovidersreducerequireresourcesscalestoragesystem
SHARED TOKENS (21): "architecture", "associated", "centers", "data", "demand", "digital", "environment", "infrastructure", "large", "map", "node", "operating", "provide", "providers", "reduce", "require", "resources", "scale", "storage", "system"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcitiescommercialdensitydescribeddevelopmentenvironmentenvironmentalexistingexpansiongrowthhousingindustrialinfrastructurelandlargeplanningprivate
SHARED TOKENS (28): "associated", "become", "building", "cities", "commercial", "density", "described", "development", "environment", "environmental", "existing", "expansion", "growth", "housing", "industrial", "infrastructure", "land", "large", "planning", "private"....
0.300
capacitycostdemandefficiencyelectricenergygenerationgoalgrowthintegratedirplawlong-termmeansmeetplanningpowerprocesspublicresource
SHARED TOKENS (24): "capacity", "cost", "demand", "efficiency", "electric", "energy", "generation", "goal", "growth", "integrated", "irp", "law", "long-term", "means", "meet", "planning", "power", "process", "public", "resource"....
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesigndieseldriverenvironmentincreaselowermakesmovesneedreducerequireroadsignalssignificantthemtrafficwork
SHARED TOKENS (20): "associated", "become", "central", "design", "diesel", "driver", "environment", "increase", "lower", "makes", "moves", "need", "reduce", "require", "road", "signals", "significant", "them", "traffic", "work".
0.300
accordingdemandneedsnetworkolderprivateprogramsprovidepublicratherrelevantroutestechnologytransittransportusers
SHARED TOKENS (16): "according", "demand", "needs", "network", "older", "private", "programs", "provide", "public", "rather", "relevant", "routes", "technology", "transit", "transport", "users".
0.300
builtbusinessescenterscentralchangescitiesdevelopmenteconomicenvironmentalexpansiongrowinggrowthmodelplannedprocessshiftsouthzone
SHARED TOKENS (18): "built", "businesses", "centers", "central", "changes", "cities", "development", "economic", "environmental", "expansion", "growing", "growth", "model", "planned", "process", "shift", "south", "zone".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcitiesdieseldifferentelectricinsidemultipleoperatepricingregionalsystemstransittransportzone
SHARED TOKENS (15): "business", "central", "cities", "diesel", "different", "electric", "inside", "multiple", "operate", "pricing", "regional", "systems", "transit", "transport", "zone".
0.300
additionalapplicationavailabilitycategorycontinuouscostcustomersdeliverydevelopmentefficiencyenvironmentincreasesinfrastructuremodeloperatingphysicalplatformproviderprovidingresources
SHARED TOKENS (24): "additional", "application", "availability", "category", "continuous", "cost", "customers", "delivery", "development", "efficiency", "environment", "increases", "infrastructure", "model", "operating", "physical", "platform", "provider", "providing", "resources"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedapproachcontrolcriticaldrivereventimpactproduceprovidingpublicremainroadroadssecondsidespecificsystemthemthirdtraffic
SHARED TOKENS (22): "applied", "approach", "control", "critical", "driver", "event", "impact", "produce", "providing", "public", "remain", "road", "roads", "second", "side", "specific", "system", "them", "third", "traffic"....
0.300
buildingbusinesscentercentraldedicateddesigneddevelopmentgrowthincreaseintegratedlandnetworkplanningprivateproblempublicscaleservingspacetransit
SHARED TOKENS (21): "building", "business", "center", "central", "dedicated", "designed", "development", "growth", "increase", "integrated", "land", "network", "planning", "private", "problem", "public", "scale", "serving", "space", "transit"....
0.300
Utility ↗ Q466707 EXACT TITLE
contextdistinctgoalsourceutility
SHARED TOKENS (5): "context", "distinct", "goal", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in data_center: "Utility".
0.300
allowingcentersconnectionscostcustomersdatadeliverydistinctefficiencyinfrastructurelargemultiplenetworkoperatepathsphysicalpointsprimaryprivateproviders
SHARED TOKENS (23): "allowing", "centers", "connections", "cost", "customers", "data", "delivery", "distinct", "efficiency", "infrastructure", "large", "multiple", "network", "operate", "paths", "physical", "points", "primary", "private", "providers"....
0.300
analyticsapplicationavailabilitycarrierscenterscriticaldatadeliverydifferentgeographicallyhighintelligencelargelayerloadmanagednetworkoperatorsprovideproviders
SHARED TOKENS (23): "analytics", "application", "availability", "carriers", "centers", "critical", "data", "delivery", "different", "geographically", "high", "intelligence", "large", "layer", "load", "managed", "network", "operators", "provide", "providers"....
0.300
Peak demand ↗ Q3393666 KW CROSS HIGH
annualcapacitycommercialcostcustomercustomersdailydemandelectricelectricalelectricityenergyevenhighindividualindustrialloadloadsoperatingpower
SHARED TOKENS (24): "annual", "capacity", "commercial", "cost", "customer", "customers", "daily", "demand", "electric", "electrical", "electricity", "energy", "even", "high", "individual", "industrial", "load", "loads", "operating", "power"....
0.300
airanotherbuildingcarriercenterscommercialconcreteconstructiondieseldrivereducationenvironmentalhandlingimprovementsindustryknowledgelandlargemanufacturingmove
SHARED TOKENS (29): "air", "another", "building", "carrier", "centers", "commercial", "concrete", "construction", "diesel", "driver", "education", "environmental", "handling", "improvements", "industry", "knowledge", "land", "large", "manufacturing", "move"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
differentestatefacilitygovernmentlandlocaloperatepathsphysicalprivaterealrightsroadroadsroutesspecificthemtraffictransportationutility
SHARED TOKENS (20): "different", "estate", "facility", "government", "land", "local", "operate", "paths", "physical", "private", "real", "rights", "road", "roads", "routes", "specific", "them", "traffic", "transportation", "utility".
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecitiescompetitivecontinuecreatecreatescurrentdecadesdescribesdevelopmenteconomiceducationenvironmentalessentialgeographygoalgrowthimpact
SHARED TOKENS (44): "approximately", "architecture", "become", "cities", "competitive", "continue", "create", "creates", "current", "decades", "describes", "development", "economic", "education", "environmental", "essential", "geography", "goal", "growth", "impact"....
0.300
accordingaircentraldesigneddevelopmentintegratedlimitsoperatingpermanentpowerprocessreducesinglesmallsystemsystems
SHARED TOKENS (16): "according", "air", "central", "designed", "development", "integrated", "limits", "operating", "permanent", "power", "process", "reduce", "single", "small", "system", "systems".
0.300
capacitycapitalcitiescorridorscostdailydedicateddesigndesignedelectriclowermillionnetworkpublicreducereliabilitysinglesystemsystemstraffic
SHARED TOKENS (22): "capacity", "capital", "cities", "corridors", "cost", "daily", "dedicated", "design", "designed", "electric", "lower", "million", "network", "public", "reduce", "reliability", "single", "system", "systems", "traffic"....
0.300
accessbecomebuiltconnectedcurrentcustomersdeliveryelectricelectricalelectricityenergyfargrowingincreaseslargemarketsmeaningmillionnearlyneed
SHARED TOKENS (29): "access", "become", "built", "connected", "current", "customers", "delivery", "electric", "electrical", "electricity", "energy", "far", "growing", "increases", "large", "markets", "meaning", "million", "nearly", "need"....
0.300
advancedapplicationappliedcapacitychangesconditionsdifferentefficiencyemergencyincreaseinformationinfrastructureprovidereduceroadroadssystemsystemstechnologytraffic
SHARED TOKENS (23): "advanced", "application", "applied", "capacity", "changes", "conditions", "different", "efficiency", "emergency", "increase", "information", "infrastructure", "provide", "reduce", "road", "roads", "system", "systems", "technology", "traffic"....
0.300
driverespeciallyevenfacilitieslargelowerplacepointsroadroadsschoolseparatesignalsstreettrafficusers
SHARED TOKENS (16): "driver", "especially", "even", "facilities", "large", "lower", "place", "points", "road", "roads", "school", "separate", "signals", "street", "traffic", "users".
0.300
appliedapprovalcontextdecisionsdevelopmentenvironmentalimpactimpactsjustifymajormoveparticipationplanplanspoliciespolicyprocessprogramprojectprojects
SHARED TOKENS (24): "applied", "approval", "context", "decisions", "development", "environmental", "impact", "impacts", "justify", "major", "move", "participation", "plan", "plans", "policies", "policy", "process", "program", "project", "projects"....
0.300
accessadvancedbuiltcapacitycentralchangescitiescompletedconnectedconstructeddecadesdesignedentrancesevenlimitsnetworkpathsplannedplansprovide
SHARED TOKENS (29): "access", "advanced", "built", "capacity", "central", "changes", "cities", "completed", "connected", "constructed", "decades", "designed", "entrances", "even", "limits", "network", "paths", "planned", "plans", "provide"....
0.300
additionalcommissioncontrolcontrolsdataestablishedfinancialframeworkinformationintegratedintendedissuenameoperatingorganizationsprovidepublicrelevantreportreporting
SHARED TOKENS (24): "additional", "commission", "control", "controls", "data", "established", "financial", "framework", "information", "integrated", "intended", "issue", "name", "operating", "organizations", "provide", "public", "relevant", "report", "reporting"....
0.300
accessbusinessbusinessescenterschangesconnectivitycustomersdatainformationlocalmanagednetworkprivateprovidersprovidingpublicsecurityservingtechnology
SHARED TOKENS (19): "access", "business", "businesses", "centers", "changes", "connectivity", "customers", "data", "information", "local", "managed", "network", "private", "providers", "providing", "public", "security", "serving", "technology".
0.300
Managed services ↗ KW CROSS HIGH
approachcontinuouscustomerdemandenvironmentinformationinfrastructurelong-termmanagedmodelproviderresponsibilitysystemstechnicaltechnologythird-party
SHARED TOKENS (16): "approach", "continuous", "customer", "demand", "environment", "information", "infrastructure", "long-term", "managed", "model", "provider", "responsibility", "systems", "technical", "technology", "third-party".
0.300
approachbusinesschangesconditionscontinuecontinuitydeliveryenvironmentenvironmentalgoalintendedoperationsorganizationsplanningprocessrecoverysystems
SHARED TOKENS (17): "approach", "business", "changes", "conditions", "continue", "continuity", "delivery", "environment", "environmental", "goal", "intended", "operations", "organizations", "planning", "process", "recovery", "systems".
0.300
approvededucationenergyenvironmentalfinancialgovernmentgovernmentsinformationlocalmattersmonitoringnationalpermittingprogramspublicregionalresponsibility
SHARED TOKENS (17): "approved", "education", "energy", "environmental", "financial", "government", "governments", "information", "local", "matters", "monitoring", "national", "permitting", "programs", "public", "regional", "responsibility".
0.300
accessbusinesscapabilitiescapacitycategorycommercialconnectionscorporatedatadatabasedevelopmentefficiencyessentialexistingfinancefutureimpactinformationintegratedlarge
SHARED TOKENS (38): "access", "business", "capabilities", "capacity", "category", "commercial", "connections", "corporate", "data", "database", "development", "efficiency", "essential", "existing", "finance", "future", "impact", "information", "integrated", "large"....
0.300
applicationcenterconnecteddatadeliverydesignedgeexpandedmodelnearplacereducestoragesystemsusers
SHARED TOKENS (15): "application", "center", "connected", "data", "delivery", "design", "edge", "expanded", "model", "near", "place", "reduce", "storage", "systems", "users".
0.300
Tax holiday ↗ Q3504234 KW CROSS HIGH
businessbusinessescorporatecreateexistinggovernmentsgrowthincreaseinvestmentlawlocalnationalprivatereduceresourcesretentiontax
SHARED TOKENS (17): "business", "businesses", "corporate", "create", "existing", "governments", "growth", "increase", "investment", "law", "local", "national", "private", "reduce", "resources", "retention", "tax".
0.300
Snake River ↗ Q272074 KW CROSS HIGH
centralcommercialconstructedconstructioncontroldecadesfarmlandgovernmentshighhistoryidahoirrigationlargelimitedlowermajornationalnearoncepolicy
SHARED TOKENS (33): "central", "commercial", "constructed", "construction", "control", "decades", "farmland", "governments", "high", "history", "idaho", "irrigation", "large", "limited", "lower", "major", "national", "near", "once", "policy"....
0.300
becomescriticaldatadigitalessentialexpandedfinancegrowinginformationinfrastructurenetworkphysicalpowerprovidesecuritysystemstechnologytherefore
SHARED TOKENS (18): "becomes", "critical", "data", "digital", "essential", "expanded", "finance", "growing", "information", "infrastructure", "network", "physical", "power", "provide", "security", "systems", "technology", "therefore".
0.300
activeavailabilitybuildingcentercenterscommercialcriticaldataevenfacilitiesfacilityframeworkgeographicallyhighiiiinfrastructurelargeloadmultipleoperational
SHARED TOKENS (32): "active", "availability", "building", "center", "centers", "commercial", "critical", "data", "even", "facilities", "facility", "framework", "geographically", "high", "iii", "infrastructure", "large", "load", "multiple", "operational"....
0.300
connectscurrentcustomersdeliverydistinctefficiencyelectricelectricalelectricityenergyevenhandlinghistoricallyincreaseindustrylocallowermajormarketnetwork
SHARED TOKENS (24): "connects", "current", "customers", "delivery", "distinct", "efficiency", "electric", "electrical", "electricity", "energy", "even", "handling", "historically", "increase", "industry", "local", "lower", "major", "market", "network"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontrolelectricityinformationlocalnationalneedreduceroadsignalssouthsystemsystemstechnologytrafficusers
SHARED TOKENS (18): "advanced", "capacity", "competing", "control", "electricity", "information", "local", "national", "need", "reduce", "road", "signals", "south", "system", "systems", "technology", "traffic", "users".
0.300
announcedapprovedcentercreatelaternetworkoperatingplansprojectreportingroadroutessystemtransportationwestwestern
SHARED TOKENS (16): "announced", "approved", "center", "create", "later", "network", "operating", "plans", "project", "reporting", "road", "routes", "system", "transportation", "west", "western".
0.300
accessadditionalapproximatelyavoidavoidingbuiltconstructioncontinuedcontrolledcostdecadesdesigndesignedestablishedfuelfuturegovernmentmeetmillionnational
SHARED TOKENS (36): "access", "additional", "approximately", "avoid", "avoiding", "built", "construction", "continued", "controlled", "cost", "decades", "design", "designed", "established", "fuel", "future", "government", "meet", "million", "national"....
0.300
aircannotclimatedecadesdemanddevelopmenteducationenergyenvironmentenvironmentalexpandedgovernmentsgrowingimpactimpactsindividualindustrialindustryinstitutionsland
SHARED TOKENS (35): "air", "cannot", "climate", "decades", "demand", "development", "education", "energy", "environment", "environmental", "expanded", "governments", "growing", "impact", "impacts", "individual", "industrial", "industry", "institutions", "land"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
airanalysisanotherapproacharchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiesdesigndesignsdevelopmentdifferenteconomicefficiencyelectricityenvironment
SHARED TOKENS (48): "air", "analysis", "another", "approach", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "design", "designs", "development", "different", "economic", "efficiency", "electricity", "environment"....
0.300
accordingactivityanalysisbecomesdesignenvironmentestablishedfargovernmentlocalplansprocessprofessionalprojectprojectsprovidepublicrelevantrequireresponsibility
SHARED TOKENS (22): "according", "activity", "analysis", "becomes", "design", "environment", "established", "far", "government", "local", "plans", "process", "professional", "project", "projects", "provide", "public", "relevant", "require", "responsibility"....
0.300
allowingcompliancecostdifferentefficiencyelectricityenergyfuellimitedmarketoctoberpercentpolicyprivateproduceprogramsregulatoryresourcessupplysupporting
SHARED TOKENS (21): "allowing", "compliance", "cost", "different", "efficiency", "electricity", "energy", "fuel", "limited", "market", "october", "percent", "policy", "private", "produce", "programs", "regulatory", "resources", "supply", "supporting"....
0.300
activeairapproximatelybuildingbusinesscapacitycleanconstructioncontroldesignenergyenvironmentenvironmentalfacilitiesgovernmentinfrastructuremanagednationalofficeoperating
SHARED TOKENS (40): "active", "air", "approximately", "building", "business", "capacity", "clean", "construction", "control", "design", "energy", "environment", "environmental", "facilities", "government", "infrastructure", "managed", "national", "office", "operating"....
0.300
accordingapplicationassociatedbusinesscapabilitiescentralcustomergrowinginformationinfrastructureintegratedneedoperatingoperationalorganizationsrelevanceresourcesrolestrategiessupport
SHARED TOKENS (24): "according", "application", "associated", "business", "capabilities", "central", "customer", "growing", "information", "infrastructure", "integrated", "need", "operating", "operational", "organizations", "relevance", "resources", "role", "strategies", "support"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
anotherapplicationbuildingsdevelopmentevenexpandedfinalgovernmentimpactlandlateroncepowerprivatepublicrequirerevenuesroadssubdivisionssurrounding
SHARED TOKENS (24): "another", "application", "buildings", "development", "even", "expanded", "final", "government", "impact", "land", "later", "once", "power", "private", "public", "require", "revenues", "roads", "subdivisions", "surrounding"....
0.300
Solar power ↗ Q1483757 KW CROSS HIGH
builtcapacityclimatecommercialconcentratedconvertcostcurrentelectricelectricityenergygenerationlargemethodneededpolicypowerprimarysecuritysingle
SHARED TOKENS (24): "built", "capacity", "climate", "commercial", "concentrated", "convert", "cost", "current", "electric", "electricity", "energy", "generation", "large", "method", "needed", "policy", "power", "primary", "security", "single"....
0.300
agreementagreementsapproachassetbuildingbuiltbusinessbusinessescommercialcontractscustomerdesignedelectricityenergyespeciallyfarmsfirmsfuelgenerationgovernment
SHARED TOKENS (31): "agreement", "agreements", "approach", "asset", "building", "built", "business", "businesses", "commercial", "contracts", "customer", "designed", "electricity", "energy", "especially", "farms", "firms", "fuel", "generation", "government"....
0.300
additionaladvancedbusinessesemergencyfacilitieshistoricallyhospitalmodeloperateprimaryprovideprovidingpublicremainsresourcessupportsystemstechnicalthemtraining
SHARED TOKENS (22): "additional", "advanced", "businesses", "emergency", "facilities", "historically", "hospital", "model", "operate", "primary", "provide", "providing", "public", "remains", "resources", "support", "systems", "technical", "them", "training"....
0.300
changescompliancecontrolcurrentdesigndesigneddocumentlawlocalnationalpublicroadroadssignalsspecifictraffictransportation
SHARED TOKENS (17): "changes", "compliance", "control", "current", "design", "designed", "document", "law", "local", "national", "public", "road", "roads", "signals", "specific", "traffic", "transportation".
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
buildingscannotdesigndesignedeveninfrastructureinsidelargemunicipalpublicrequireroadssewersmallstreetsystemswater
SHARED TOKENS (17): "buildings", "cannot", "design", "designed", "even", "infrastructure", "inside", "large", "municipal", "public", "require", "roads", "sewer", "small", "street", "systems", "water".
0.300
accordingapplicationavailabilitybuildingcapacitycenterscentralcompliancecustomercustomersdatadedicatedfarmsgovernmentgovernmentshighinfrastructurelocalmarketmarkets
SHARED TOKENS (41): "according", "application", "availability", "building", "capacity", "centers", "central", "compliance", "customer", "customers", "data", "dedicated", "farms", "government", "governments", "high", "infrastructure", "local", "market", "markets"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdifferentindividuallowermeaningmultipleoperateoperatingoperationssystemsystemstechnologytraffictransit
SHARED TOKENS (16): "broader", "capacity", "conditions", "different", "individual", "lower", "meaning", "multiple", "operate", "operating", "operations", "system", "systems", "technology", "traffic", "transit".
0.300
buildingsbusinesscentersdatadesignedelectricalemergencyenergylargeloadpowerprovidesinglesizesourcesupplysystem
SHARED TOKENS (17): "buildings", "business", "centers", "data", "designed", "electrical", "emergency", "energy", "large", "load", "power", "provide", "single", "size", "source", "supply", "system".
0.300
announcedannualcertificationclimatecontinueddecadesdifferentefficiencyenergyexistingframeworkgovernmentinvestmentmeaningnationalneedonceorganizationsplacerate
SHARED TOKENS (24): "announced", "annual", "certification", "climate", "continued", "decades", "different", "efficiency", "energy", "existing", "framework", "government", "investment", "meaning", "national", "need", "once", "organizations", "place", "rate"....
0.300
accessavailabilitybusinesscontinuitycontrolcriticaldatadigitalgovernmentimpactsindustryinformationinfrastructureinspectionintendedknowledgemajoroperationsphysicalplanning
SHARED TOKENS (32): "access", "availability", "business", "continuity", "control", "critical", "data", "digital", "government", "impacts", "industry", "information", "infrastructure", "inspection", "intended", "knowledge", "major", "operations", "physical", "planning"....
🫐 BERRY49 edges
0.280
aircreatedieselfuel
SHARED TOKENS (4): "air", "create", "diesel", "fuel". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.280
anotherarticlebecomecapacitydemanddensityhighplanningpublicroadroadstraffictransporttransportation
SHARED TOKENS (14): "another", "article", "become", "capacity", "demand", "density", "high", "planning", "public", "road", "roads", "traffic", "transport", "transportation".
0.280
accessdevelopmentgovernmentsinfrastructurelatermultiplenameoctoberplatformprofessionalprojectsupportssystemsthird-party
SHARED TOKENS (14): "access", "development", "governments", "infrastructure", "later", "multiple", "name", "october", "platform", "professional", "project", "supports", "systems", "third-party".
0.280
airbuildingconditionscreatesenvironmentevenhazardphysicalpublicrisksspecificsystemthemtransport
SHARED TOKENS (14): "air", "building", "conditions", "creates", "environment", "even", "hazard", "physical", "public", "risks", "specific", "system", "them", "transport".
0.280
involvingnetworktraffictransportation
SHARED TOKENS (4): "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.280
intermountainregionwestwestern
SHARED TOKENS (4): "intermountain", "region", "west", "western". | EXACT TITLE in data_center: "Intermountain West".
0.280
accessapproachdesigndesignedeconomicenvironmentaloperatedplannedpolicypublictraffictransportationuserszones
SHARED TOKENS (14): "access", "approach", "design", "designed", "economic", "environmental", "operated", "planned", "policy", "public", "traffic", "transportation", "users", "zones".
0.280
Oversize load ↗ Q680421 KW CROSS HIGH
airconstructionindustrialinfrastructurelargelimitsloadloadsordinaryroadsizetransporttransportationwater
SHARED TOKENS (14): "air", "construction", "industrial", "infrastructure", "large", "limits", "load", "loads", "ordinary", "road", "size", "transport", "transportation", "water".
0.260
boisedatademanddynamichighidahomajormanufacturersmarketsemiconductorsouthstoragetechnology
SHARED TOKENS (13): "boise", "data", "demand", "dynamic", "high", "idaho", "major", "manufacturers", "market", "semiconductor", "south", "storage", "technology".
0.260
accordinganalyticsannouncedapplicationcentersdatainfrastructuremultiplenameplatformpublicstatedstorage
SHARED TOKENS (13): "according", "analytics", "announced", "application", "centers", "data", "infrastructure", "multiple", "name", "platform", "public", "stated", "storage".
0.260
alreadycentralcreatedatafarhistorylargelowermultipleoperatepowerprocesssecond
SHARED TOKENS (13): "already", "central", "create", "data", "far", "history", "large", "lower", "multiple", "operate", "power", "process", "second".
0.260
HITRUST ↗ Q5629803 EXACT TITLE
complianceinformationtrust
SHARED TOKENS (3): "compliance", "information", "trust". | EXACT TITLE in data_center: "HITRUST".
0.260
buildingbuildingscapacityconnectedconnectionsconnectsdifferentenvironmentinformationlargeneedsnetworkproviding
SHARED TOKENS (13): "building", "buildings", "capacity", "connected", "connections", "connects", "different", "environment", "information", "large", "needs", "network", "providing".
0.260
appliedcentersdeliveryefficiencyinformationprovideprovidersreportsmallsupportssystemsystemstechnology
SHARED TOKENS (13): "applied", "centers", "delivery", "efficiency", "information", "provide", "providers", "report", "small", "supports", "system", "systems", "technology".
0.240
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedconditionscustomersdigitalinspectionneedsproblemrolespecificwork
SHARED TOKENS (12): "already", "approval", "approved", "conditions", "customers", "digital", "inspection", "needs", "problem", "role", "specific", "work".
0.240
Dark fibre ↗ Q1878571 KW CROSS HIGH
additionalcapacitycostdatademandinfrastructurelatermarketnetworkonceprivateprovider
SHARED TOKENS (12): "additional", "capacity", "cost", "data", "demand", "infrastructure", "later", "market", "network", "once", "private", "provider".
0.240
commercecontrolscostgovernmentinformationintendednationalprogramsprovidesecuritysystemstechnology
SHARED TOKENS (12): "commerce", "controls", "cost", "government", "information", "intended", "national", "programs", "provide", "security", "systems", "technology".
0.220
connectionsdatadesignedelectricalespeciallyhighhistoricallynetworksignalsspecializedstructure
SHARED TOKENS (11): "connections", "data", "designed", "electrical", "especially", "high", "historically", "network", "signals", "specialized", "structure".
0.220
meanswater
SHARED TOKENS (2): "means", "water". | EXACT TITLE in data_center: "Liquid cooling".
0.220
anticipatedconcretedesigneddifferentdividedevenpathsprimaryprovidetransportusers
SHARED TOKENS (11): "anticipated", "concrete", "designed", "different", "divided", "even", "paths", "primary", "provide", "transport", "users".
0.220
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
continueidahomajornationalnearplannedpositioningroadroadswestwestern
SHARED TOKENS (11): "continue", "idaho", "major", "national", "near", "planned", "positioning", "road", "roads", "west", "western".
0.220
categorycentercentersdatadescribesefficiencyenergyfacilityinfrastructurepowersupports
SHARED TOKENS (11): "category", "center", "centers", "data", "describes", "efficiency", "energy", "facility", "infrastructure", "power", "supports".
0.220
accessdesignedformerlocalmajormoveprovideroadroadstrafficwider
SHARED TOKENS (11): "access", "designed", "former", "local", "major", "move", "provide", "road", "roads", "traffic", "wider".
0.200
accessespeciallyintendedlogisticsmaximumoperatingregionspecializedtransporttransportation
SHARED TOKENS (10): "access", "especially", "intended", "logistics", "maximum", "operating", "region", "specialized", "transport", "transportation".
0.200
anothercarrierelectricalhighinformationlocalplacesecondsignalsvisible
SHARED TOKENS (10): "another", "carrier", "electrical", "high", "information", "local", "place", "second", "signals", "visible".
0.200
applicationdecisionsdesignedinformationmakesnetworkpathspoliciessystemsystems
SHARED TOKENS (10): "application", "decisions", "designed", "information", "makes", "network", "paths", "policies", "system", "systems".
0.200
becomechangesdesignespeciallygrowingphysicalroadroadsstrategiestraffic
SHARED TOKENS (10): "become", "changes", "design", "especially", "growing", "physical", "road", "roads", "strategies", "traffic".
0.200
adabusinesschangesfinallaterlawnationalprovidepublicrights
SHARED TOKENS (10): "ada", "business", "changes", "final", "later", "law", "national", "provide", "public", "rights".
0.200
applicationdigitalestablishedfinancefinancialfirmsindustryplatformssystemstechnology
SHARED TOKENS (10): "application", "digital", "established", "finance", "financial", "firms", "industry", "platforms", "systems", "technology".
0.180
airbuildingenergylargeprocessreducestrategiessystemswater
SHARED TOKENS (9): "air", "building", "energy", "large", "process", "reduce", "strategies", "systems", "water".
0.180
commercedevelopmenteconomicgrowthidahopublicresourcesstate-leveltax
SHARED TOKENS (9): "commerce", "development", "economic", "growth", "idaho", "public", "resources", "state-level", "tax".
0.180
annualcenterdataelectricityenergyon-siteproducingsitewater
SHARED TOKENS (9): "annual", "center", "data", "electricity", "energy", "on-site", "producing", "site", "water".
0.160
Machine learning ↗ Q2539 KW CROSS HIGH
analysisapproximatelydatadescribeddevelopmentexplicitlyframeworkintelligence
SHARED TOKENS (8): "analysis", "approximately", "data", "described", "development", "explicitly", "framework", "intelligence".
0.160
aircommercialenvironmentlandlogisticsphysicalprocesstransport
SHARED TOKENS (8): "air", "commercial", "environment", "land", "logistics", "physical", "process", "transport".
0.160
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargepublicroadsystemtransittransport
SHARED TOKENS (8): "cities", "connections", "large", "public", "road", "system", "transit", "transport".
0.160
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisegrowingidahonameschoolschoolswest
SHARED TOKENS (8): "ada", "boise", "growing", "idaho", "name", "school", "schools", "west".
0.160
differenteducationhighinstitutionspolicyprogramsschoolworkforce
SHARED TOKENS (8): "different", "education", "high", "institutions", "policy", "programs", "school", "workforce".
0.160
applicationdesignfacilitiesplanningprovidetechnologytransporttransportation
SHARED TOKENS (8): "application", "design", "facilities", "planning", "provide", "technology", "transport", "transportation".
0.160
451 Group ↗ Q55602817 KW CROSS HIGH
analyticscenterdataindustryinformationoperatingoperatorstechnology
SHARED TOKENS (8): "analytics", "center", "data", "industry", "information", "operating", "operators", "technology".
0.160
constructiondesignfutureplanningprofessionalroadstraffictransportation
SHARED TOKENS (8): "construction", "design", "future", "planning", "professional", "roads", "traffic", "transportation".
0.140
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedidaholimitedsouthsystemwestwestern
SHARED TOKENS (7): "continued", "idaho", "limited", "south", "system", "west", "western".
0.140
handlingmethodmultipleroadsecuritytransporttransportation
SHARED TOKENS (7): "handling", "method", "multiple", "road", "security", "transport", "transportation".
0.140
boisecitiesdowntownidahomajornearroutes
SHARED TOKENS (7): "boise", "cities", "downtown", "idaho", "major", "near", "routes".
0.120
fiscalgovernmentplanservingsystemtransportation
SHARED TOKENS (6): "fiscal", "government", "plan", "serving", "system", "transportation".
0.100
accessdemandnetworkphysicalresources
SHARED TOKENS (5): "access", "demand", "network", "physical", "resources".
0.100
centercontrolmonitoringnetworkoperations
SHARED TOKENS (5): "center", "control", "monitoring", "network", "operations".
0.100
commercialdriverlargeoperatesize
SHARED TOKENS (5): "commercial", "driver", "large", "operate", "size".
0.100
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesigndesignedloadmaximum
SHARED TOKENS (5): "connected", "design", "designed", "load", "maximum".
0.100
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicroadshowstraffic
SHARED TOKENS (5): "businesses", "economic", "road", "shows", "traffic".
◈ Frequently Asked Questions
Transportation Infrastructure × Data Center — Treasure Valley
HAIKU · HIGH GATE
How do Ada County and Canyon County zoning decisions affect data center access to major transportation routes?
Ada County and Canyon County zoning codes determine where data centers can locate relative to Interstate 84 and US Route 95, which directly impacts logistics costs and connectivity speed. Land-use planning in Boise, Meridian, and Nampa has designated industrial zones that balance proximity to transportation corridors with residential separation requirements.
What role do Treasure Valley transportation networks play in economic development for data center operators?
Data centers in Ada County require reliable access to fiber optic routes that follow existing transportation corridors managed by local governments in Boise, Garden City, and Kuna. The regional transportation infrastructure determines redundancy options and latency performance for facilities serving the Idaho capital region.
How do Meridian and Nampa use land-use planning to coordinate data center growth with transportation capacity?
Meridian and Nampa planning departments align data center zoning approvals with transportation infrastructure assessments to prevent congestion on local roads serving these power-intensive facilities. Both municipalities require developers to address how truck traffic for equipment delivery and maintenance will use existing highway systems.
What telecommunications infrastructure dependencies exist between Treasure Valley transportation systems and regional data centers?
Data centers throughout Ada County and Canyon County rely on fiber routes that parallel transportation corridors including I-84, creating shared right-of-way issues managed by Boise and regional governments. Telecommunications planning in Meridian, Nampa, and Garden City must account for how transportation development affects buried cable capacity and network redundancy.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Data Center 12 QID bridges 186 edges 5,104 ext links 2026-07-17 23:39:55 UTC 8cc175e02f7de6a8
Transportation Infrastructure corridor ↗ Data Center corridor ↗ Data Center × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals