—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Vision Optical

13 Wikipedia bridge articles confirmed in both vertical ledgers. 245 deterministic cross-vertical edges. 6,942 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
245 Cross Edges
6,942 External Sources
276 Wikipedia Articles
18 🌲 Evergreen
171 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Vision Optical
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
245
External Sources Harvested
6,942
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  30 shared tokens
QID Bridge Titles (13)
IdahoZoningBroadbandCollege of Western IdahoTreasure ValleyBoise, IdahoAmericans with Disabilities Act of 1990Nampa, IdahoCaldwell, IdahoAda County, IdahoCanyon County, IdahoMeridian, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadametropolitancapitaleastoregonwesterncanyontechnologyuseswestlocalcollegenampatreasurevalleyestimatedapproximately
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:44:04 UTC
Content Hash
39b3b3b10d35e236
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (30): "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "early", "east", "idaho", "linked", "manufacturing", "national", "official", "oregon", "people", "population", "products", "sector".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in vision_optical: "Idaho".
approximatelyassociatedbestboisecapitalcontainsdistinctdividedearlyeastidaholinkedmanufacturingnationalofficialoregonpeoplepopulationproductssectorseparatesignificantsmallsouthsuppliestechnologyuseswestwesternzone
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (25): "building", "density", "developed", "development", "different", "form", "government", "growth", "guidelines", "land-use", "local", "places", "planning", "policy", "regulations", "regulatory", "residential", "rules", "scale", "single".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in vision_optical: "Zoning".
buildingdensitydevelopeddevelopmentdifferentformgovernmentgrowthguidelinesland-uselocalplacesplanningpolicyregulationsregulatoryresidentialrulesscalesinglesystemsuseszonezoneszoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
(e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
pment may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Broadband
Q194163 EXACT TITLE 1.000
QID OVERLAP: Q194163 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (15): "access", "broadband", "data", "different", "high", "implementation", "integrated", "level", "network", "provide", "requirements", "signals", "technology", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband". | EXACT TITLE in vision_optical: "Broadband".
accessbroadbanddatadifferenthighimplementationintegratedlevelnetworkproviderequirementssignalstechnologytransferuses
nications, broadband or high speed is the wide-bandwidth data transmission that uses signals at a wide spread of frequencies or several different simultaneous frequencies. It is used in fast Internet access where the transmission medium can be coaxial cable, optical fiber, wireless Internet (radio), twisted pair cable, or satellite. Originally used to mean "using a wide-spread frequency" and for services that were analog at the lowest level, in the context of Internet access, "broadband" is now often used to mean any high-speed Internet access that is seemingly always "on" and is faster than dial-up access over traditional analog or ISDN PSTN services. The ideal telecommunication network has the following characteristics: broadband, multi-media, multi-point, multi-rate and economical implementation for a diversity of services (multi-services). The Broadband Integrated Services Digital Network (B-ISDN) was planned to provide these characteristics.
wireless Internet (radio), twisted pair cable, or satellite. Originally used to mean "using a wide-spread frequency" and for services that were analog at the lowest level, in the context of Internet access, "broadband" is now often used to mean any high-speed Internet access that is seemingly always "on" and is faster than dial-up access over traditional analog or ISDN PSTN services. The ideal telecommunication network has the following characteristics: broadband, multi-media, multi-point, multi-rate and economical implementation for a diversity of services (multi-services). The Broadband Integrated Services Digital Network (B-ISDN) was planned to provide these characteristics.
that were analog at the lowest level, in the context of Internet access, "broadband" is now often used to mean any high-speed Internet access that is seemingly always "on" and is faster than dial-up access over traditional analog or ISDN PSTN services. The ideal telecommunication network has the following characteristics: broadband, multi-media, multi-point, multi-rate and economical implementation for a diversity of services (multi-services). The Broadband Integrated Services Digital Network (B-ISDN) was planned to provide these characteristics.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (31): "academic", "ada", "board", "boise", "canyon", "classes", "college", "community", "comprehensive", "cwi", "development", "education", "idaho", "large", "nampa", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in vision_optical: "College of Western Idaho".
academicadaboardboisecanyonclassescollegecommunitycomprehensivecwidevelopmenteducationidaholargenampapopulationprimaryprogramspublicreportedresidentsservedsouthweststudentstudentstechnicaltransfertreasurevalleywestern+1
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (13): "association", "boise", "idaho", "local", "lower", "metropolitan", "oregon", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in vision_optical: "Treasure Valley".
associationboiseidaholocallowermetropolitanoregonregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "downtown", "east", "estimated", "feet", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "oregon", "population", "sectors", "technology", "treasure", "valley".
adaannualboisecapitaldowntowneastestimatedfeetidaholevellocallymajormanufacturingmetropolitanoregonpopulationsectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.780
QID OVERLAP: Q1111004 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:branch). | SHARED TOKENS (14): "accessibility", "ada", "against", "business", "covered", "disabilities", "disability", "later", "law", "national", "provide", "public", "requirements", "requires".
accessibilityadaagainstbusinesscovereddisabilitiesdisabilitylaterlawnationalprovidepublicrequirementsrequires
ual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Under Title III, no individual may be discriminated against on the basis of disability with regards to the full and equal enjoyment of the goods, services, facilities, or accommodations of any place of public accommodation by any person who owns, leases, or operates a place of public accommodation. Public accommodations include most places of lodging (such as inns and hotels), recreation, transportation, education, and dining, along with stores, care providers, and places of public displays. Under Title III of the ADA, all new construction (construction, modification or alterations) after the effective date of the ADA (approximately July 1992) must be fully compliant with the Americans With Disabilities Act Accessibility Guidelines (ADAAG) found in the Code of Federal Regulations at 28 C.F.R., Part 36, Appendix A. Title III also has applications to existing facilities. One of the definitions of "discrimination" under Title III of the ADA is a "failure to remove" architectural barriers in existing facilities. See 42 U.S.C. § 12182(b)(2)(A)(iv). This means that even facilities that have not been modified or altered in any way after the ADA was passed still have obligations. The standard is whether "removing barriers" (typically defined as bringing a condition into compliance with the ADAAG) is "readily achievable", defined as "...easily accomplished without much difficulty or expense". The statutory definition of "readily achievable" calls for a balancing test between the cost of the proposed alteration and the wherewithal of the business and/or owners of the business. Thus, what might be "readily achievable" for a sophisticated and financially capable corporation might not be readily achievable for a small or local business. There are exceptions to this title; many private clubs and religious organizations may not be bound by Title III. With regard to historic properties (those properties that are listed or that are eligible for listing in the National Register of Historic Places, or properties designated as historic under state or local law), those facilities must still comply with the provisions of Title III of the ADA to the "maximum extent feasible" but if following the usual standards would "threaten to destroy the historic significance of a feature of the building" then alternative standards may be used. Under 2010 revisions of Department of Justice regulations, newly constructed or altered swimming pools, wading pools, and spas must have an accessible means of entrance and exit to pools for disabled people. However, the requirement is conditioned on whether providing access through a fixed lift is "readily achievable". Other requirements exist, based on pool size, include providing a certain number of accessible means of entry and exit, which are outlined in Section 242 of the standards. However, businesses are free to consider the differences in the application of the rules depending on whether the pool is new or altered, or whether the swimming pool was in existence before the effective date of the new rule.
ADA Amendments Act, 2008 The ADA defines a covered disability as a physical or mental impairment that substantially limits one or more major life activities, a history of having such an impairment, or being regarded as having such an impairment. The Equal Employment Opportunity Commission (EEOC) was charged with interpreting the 1990 law with regard to discrimination in employment. The EEOC developed regulations limiting an individual's impairment to one that "severely or significantly restricts" a major life activity. The ADAAA directed the EEOC to amend its regulations and replace "severely or significantly" with "substantially limits", a more lenient standard. On September 25, 2008, President George W. Bush signed the ADA Amendments Act of 2008 (ADAAA) into law. The amendment broadened the definition of "disability", thereby extending the ADA's protections to a greater number of people. The ADAAA also added to the ADA examples of "major life activities" including, but not limited to, "caring for oneself, performing manual tasks, seeing, hearing, eating, sleeping, walking, standing, lifting, bending, speaking, breathing, learning, reading, concentrating, thinking, communicating, and working" as well as the operation of several specified "major bodily functions". The act overturned a 1999 US Supreme Court case that held that an employee was not disabled if the impairment could be corrected by mitigating measures; it specifically provides that such impairment must be determined without considering such ameliorative measures. It also overturned the court's finding that an impairment that substantially limits one major life activity must also limit others to be considered a disability. In 2008, the United States House Committee on Education and Labor stated that the amendment "makes it absolutely clear that the ADA is intended to provide broad coverage to protect anyone who faces discrimination on the basis of disability." Thus the ADAAA led to broader coverage of impaired employees. Web Content Accessibility Guidelines, 2019 In October 2019, the Supreme Court declined to resolve a circuit split as to whether websites are covered by the ADA. The Court turned down an appeal from Domino's Pizza and let stand a U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "west", "western".
boisecanyoncollegeidahomeridianmetropolitannampapopulationprincipalstudentuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Caldwell, Idaho
Q849592 QID OVERLAP 0.740
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (12): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "oregon", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and vision_optical (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "east", "estimated", "idaho", "local", "metropolitan", "population", "private", "roads".
adaboisecapitaldistricteastestimatedidaholocalmetropolitanpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahometropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "population".
adaamongboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and vision_optical (tier:branch). | SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "population".
adaboisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
232 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP232 edges
🌲 EVERGREEN5 edges
0.650
acquisitionagencyboardcommissionconstructionfederalgovernmentindependentmattersoversightpowersregulationregulatoryservedservessubjecttransportationwater
SHARED TOKENS (18): "acquisition", "agency", "board", "commission", "construction", "federal", "government", "independent", "matters", "oversight", "powers", "regulation", "regulatory", "served", "serves", "subject", "transportation", "water". | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
Optometry ↗ EXACT TITLE
academicadvancedcarecollegeconditionscontacthealthcarelicensedmanagementmeasuremedicalmonitoringpracticeprovideprovidingrequireresearchschooltrainedtraining
SHARED TOKENS (22): "academic", "advanced", "care", "college", "conditions", "contact", "healthcare", "licensed", "management", "measure", "medical", "monitoring", "practice", "provide", "providing", "require", "research", "school", "trained", "training".... | URL->B (1): http://idaho.aoa.org/. | EXACT TITLE in vision_optical: "Optometry".
0.650
acquisitionadministrationamericancommercialfederalfiscalfundinggeneralgrantslightingplanningprogramprojectspublicrevenuesignage
SHARED TOKENS (16): "acquisition", "administration", "american", "commercial", "federal", "fiscal", "funding", "general", "grants", "lighting", "planning", "program", "projects", "public", "revenue", "signage". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaagenciesamonganotherauthoritybasebestboisecanyoncapacitycapitalcenterconventionalcrossdemanddistricteagleearlyemployerfederal
SHARED TOKENS (65): "ada", "agencies", "among", "another", "authority", "base", "best", "boise", "canyon", "capacity", "capital", "center", "conventional", "cross", "demand", "district", "eagle", "early", "employer", "federal".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.610
agencybegancreatingdepartmentenforcementidaholawlegislaturemunicipalorganizationpresentpublicstatewide
SHARED TOKENS (13): "agency", "began", "creating", "department", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
🌿 BRANCH171 edges
0.500
Culvert ↗ Q4168092 EXACT TITLE
crossdesignedembeddedfrequentlyitselfmaterialneedperformancepracticeprocessrequirementsroadroadsstructurewater
SHARED TOKENS (15): "cross", "designed", "embedded", "frequently", "itself", "material", "need", "performance", "practice", "process", "requirements", "road", "roads", "structure", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Myopia ↗ Q168403 EXACT TITLE
adultsaffectamongassociatedbillionconditioncontactdiagnosisdifferentestimatedfocusinsidelargelowerpeopleplacementpopulationproceduresproviderural
SHARED TOKENS (21): "adults", "affect", "among", "associated", "billion", "condition", "contact", "diagnosis", "different", "estimated", "focus", "inside", "large", "lower", "people", "placement", "population", "procedures", "provide", "rural".... | EXACT TITLE in vision_optical: "Myopia".
0.500
canyonconstructionemergencygeneralidahointegratedmissionmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (15): "canyon", "construction", "emergency", "general", "idaho", "integrated", "mission", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
Neonatology ↗ Q898674 EXACT TITLE
academicadvancescareclinicalcomplexconditionsdecisionsdevelopmentdisabilitymedicalmonitoringneedperiodprovideresearchsupporttechnologytreatment
SHARED TOKENS (18): "academic", "advances", "care", "clinical", "complex", "conditions", "decisions", "development", "disability", "medical", "monitoring", "need", "period", "provide", "research", "support", "technology", "treatment". | EXACT TITLE in vision_optical: "Neonatology".
0.500
accessadvantagesapplicationsbranchcarecentersdiagnosisequipmentmajormedicalmonitoringneedneedspopulationsrequiringreviewscreeningspecialistspecialiststechnicians
SHARED TOKENS (24): "access", "advantages", "applications", "branch", "care", "centers", "diagnosis", "equipment", "major", "medical", "monitoring", "need", "needs", "populations", "requiring", "review", "screening", "specialist", "specialists", "technicians".... | EXACT TITLE in vision_optical: "Teleophthalmology".
0.500
absenceadultsageamongconditionsdevelopingdiagnosisdirectlyestimatesfuturehealthimpactindividualmedicalorganizationpeopleproblemsrehabilitationscreeningsignificant
SHARED TOKENS (23): "absence", "adults", "age", "among", "conditions", "developing", "diagnosis", "directly", "estimates", "future", "health", "impact", "individual", "medical", "organization", "people", "problems", "rehabilitation", "screening", "significant".... | EXACT TITLE in vision_optical: "Visual impairment".
0.500
administrationauthoritycareclinicaleducationfunctionhealthhealthcarehelpsmanagementmedicalpatientphysicalpracticeprimaryprivateprovideprovidingpublicresearch
SHARED TOKENS (21): "administration", "authority", "care", "clinical", "education", "function", "health", "healthcare", "helps", "management", "medical", "patient", "physical", "practice", "primary", "private", "provide", "providing", "public", "research".... | EXACT TITLE in vision_optical: "Physical therapy".
0.500
applicablebuildingcentercenterscommercialdedicateddemanddirectlydistributionequipmentfacilityfunctionhandlinginventorylaborlargemarketneedednetworkoperate
SHARED TOKENS (37): "applicable", "building", "center", "centers", "commercial", "dedicated", "demand", "directly", "distribution", "equipment", "facility", "function", "handling", "inventory", "labor", "large", "market", "needed", "network", "operate".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Glaucoma ↗ Q159701 EXACT TITLE
ageassociatedconditionsdifferentearlyemergencyessentialevengrouphelpshistoryincreaseinformationinsidemajormedicalperiodperipheralpressureprogression
SHARED TOKENS (24): "age", "associated", "conditions", "different", "early", "emergency", "essential", "even", "group", "helps", "history", "increase", "information", "inside", "major", "medical", "period", "peripheral", "pressure", "progression".... | EXACT TITLE in vision_optical: "Glaucoma".
0.500
americanassociationbillioncampusescenterscompetedevelopmentdistrictdivisionmedicalnationalpublicresearchspacesystemsuniversitywest
SHARED TOKENS (17): "american", "association", "billion", "campuses", "centers", "compete", "development", "district", "division", "medical", "national", "public", "research", "space", "systems", "university", "west". | EXACT TITLE in vision_optical: "University of Washington".
0.500
affectedageawaycenterconditiondiagnosisemergencyinformationinsidelayermedicalneededrequiressmalltissuetreatmentvisual
SHARED TOKENS (17): "affected", "age", "away", "center", "condition", "diagnosis", "emergency", "information", "inside", "layer", "medical", "needed", "requires", "small", "tissue", "treatment", "visual". | EXACT TITLE in vision_optical: "Retinal detachment".
0.500
accesscomprehensivecontinuingfederalformationfundingfuturegovernmentlawlocalmetropolitanorganizationparticipationplanningplanspopulationprocessprogramsprojectspublic
SHARED TOKENS (25): "access", "comprehensive", "continuing", "federal", "formation", "funding", "future", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "plans", "population", "process", "programs", "projects", "public".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
agreementbillionboardcreatedesignatedequipmentindexinsuranceintegratedlicensingmajormanufacturersmarketsownershiprevenuestockthem
SHARED TOKENS (17): "agreement", "billion", "board", "create", "designated", "equipment", "index", "insurance", "integrated", "licensing", "major", "manufacturers", "markets", "ownership", "revenue", "stock", "them". | EXACT TITLE in vision_optical: "EssilorLuxottica".
0.500
branchclinicclinicalcompletiondirecteducationhospitalindividualknowledgelicensemedicalphysicalpracticepracticesrequirementresidentschoolseniorskillsspecific
SHARED TOKENS (21): "branch", "clinic", "clinical", "completion", "direct", "education", "hospital", "individual", "knowledge", "license", "medical", "physical", "practice", "practices", "requirement", "resident", "school", "senior", "skills", "specific".... | EXACT TITLE in vision_optical: "Residency (medicine)".
0.500
Hypertension ↗ Q41861 EXACT TITLE
adultsambulatoryappearsapplyarterialassociatedconditioncontroldifferentessentialhealthhighincreaseitselflowermajormedicalmonitoringpeopleperiod
SHARED TOKENS (28): "adults", "ambulatory", "appears", "apply", "arterial", "associated", "condition", "control", "different", "essential", "health", "high", "increase", "itself", "lower", "major", "medical", "monitoring", "people", "period".... | EXACT TITLE in vision_optical: "Hypertension".
0.500
broadercomprehensivecoveringdevelopmentfocusgrowthindividualinfrastructureland-uselargerlevelmanagementnationalneedsnetworkplacementplanningplanspracticesregion
SHARED TOKENS (32): "broader", "comprehensive", "covering", "development", "focus", "growth", "individual", "infrastructure", "land-use", "larger", "level", "management", "national", "needs", "network", "placement", "planning", "plans", "practices", "region".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciesbroadbandcommunitycomponentsconditionsconnectivitydevelopmentdifferentdistinctemergencyenforcementessentialfacilitiesfocusfrequentlyfunctiongeneralhardhealth
SHARED TOKENS (45): "access", "agencies", "broadband", "community", "components", "conditions", "connectivity", "development", "different", "distinct", "emergency", "enforcement", "essential", "facilities", "focus", "frequently", "function", "general", "hard", "health".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in vision_optical: "Infrastructure".
0.500
academicbegancareclinicalcommunitiesdefinesdevelopeddevelopingdisabilityearlyequipmentformformalfunctiongrouphealthhealthcarehelpsnationalneed
SHARED TOKENS (33): "academic", "began", "care", "clinical", "communities", "defines", "developed", "developing", "disability", "early", "equipment", "form", "formal", "function", "group", "health", "healthcare", "helps", "national", "need".... | EXACT TITLE in vision_optical: "Occupational therapy".
0.500
billionconcentrateddemographicdevelopeddevelopmentdirectestimatesgroupgrowthhighimpactincreaseindividualinternationallimitedlivingmedicalpeoplepolicypopulation
SHARED TOKENS (28): "billion", "concentrated", "demographic", "developed", "development", "direct", "estimates", "group", "growth", "high", "impact", "increase", "individual", "international", "limited", "living", "medical", "people", "policy", "population".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in vision_optical: "Population growth".
0.500
alignmentcarecomprehensivedirectfocusfullfunctionhealthhistoryindividualmedicalnearotherwisepeoplepressureprimaryvisual
SHARED TOKENS (17): "alignment", "care", "comprehensive", "direct", "focus", "full", "function", "health", "history", "individual", "medical", "near", "otherwise", "people", "pressure", "primary", "visual". | EXACT TITLE in vision_optical: "Eye examination".
0.500
Ophthalmology ↗ EXACT TITLE
academicbecomebranchcarecompletediagnosishistorymedicalneededprimaryprovideresearchschoolsoughttrainingtreatingtreatment
SHARED TOKENS (17): "academic", "become", "branch", "care", "complete", "diagnosis", "history", "medical", "needed", "primary", "provide", "research", "school", "sought", "training", "treating", "treatment". | EXACT TITLE in vision_optical: "Ophthalmology".
0.500
boundariescertificationcompletecontinuedemployerextendformalhelpslaborlevellicensepeopleperiodplacementpracticepractitionersprofessionalregulatedsectorsstudy
SHARED TOKENS (22): "boundaries", "certification", "complete", "continued", "employer", "extend", "formal", "helps", "labor", "level", "license", "people", "period", "placement", "practice", "practitioners", "professional", "regulated", "sectors", "study".... | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
communitydescribesdevelopmenteconomicsfrequentlygrowthincreasesindividualinfrastructurelocalmarketpeoplepolicyprocessqualityregionwest
SHARED TOKENS (17): "community", "describes", "development", "economics", "frequently", "growth", "increases", "individual", "infrastructure", "local", "market", "people", "policy", "process", "quality", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
chainchainscomplexconsumercreatingdirectdirectlydistributionfacilitiesindependentlinkedmanagementmaterialsnetworkproductproductsstructuresupplysystemsystems
SHARED TOKENS (21): "chain", "chains", "complex", "consumer", "creating", "direct", "directly", "distribution", "facilities", "independent", "linked", "management", "materials", "network", "product", "products", "structure", "supply", "system", "systems".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyassetsauthoritycertificationcommercialcontroldepartmentfederalgovernmentinternationalorganizationpersonnelpowersregulatesspacestandardssurroundingtransportation
SHARED TOKENS (19): "administration", "agency", "assets", "authority", "certification", "commercial", "control", "department", "federal", "government", "international", "organization", "personnel", "powers", "regulates", "space", "standards", "surrounding", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
Human eye ↗ Q430024 EXACT TITLE
anotherapproximatelycomponentsconnectioncontrolsdevicefullfunctionshighlivingmakespowersystemvisiblevisual
SHARED TOKENS (15): "another", "approximately", "components", "connection", "controls", "device", "full", "functions", "high", "living", "makes", "power", "system", "visible", "visual". | EXACT TITLE in vision_optical: "Human eye".
0.500
acquisitionsbrandextendsformformationhistoryindependentinternationallatermajornetworkoperatesoperatingprincipalregionalroute
SHARED TOKENS (16): "acquisitions", "brand", "extends", "form", "formation", "history", "independent", "international", "later", "major", "network", "operates", "operating", "principal", "regional", "route". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessadultsamericanannualassetsbecomebillioncarecoveragecovereddisabilitiesdividedeligibilityestablishedfederalfinancialfundinggeneralgovernmenthealth
SHARED TOKENS (43): "access", "adults", "american", "annual", "assets", "become", "billion", "care", "coverage", "covered", "disabilities", "divided", "eligibility", "established", "federal", "financial", "funding", "general", "government", "health".... | EXACT TITLE in transportation_infrastructure: "Medicaid". | EXACT TITLE in vision_optical: "Medicaid".
0.500
Glasses ↗ Q37501 EXACT TITLE
againstbridgeconditionscontactdirectlyequipmentevenforminformationmaterialspeoplepowerprimaryspecializedspecificsupportthemtiedvisiblevisual
SHARED TOKENS (20): "against", "bridge", "conditions", "contact", "directly", "equipment", "even", "form", "information", "materials", "people", "power", "primary", "specialized", "specific", "support", "them", "tied", "visible", "visual". | EXACT TITLE in vision_optical: "Glasses".
0.500
appliedattendcarecompletedemanddepartmentgeneralhealthknowledgelimitedmoveneedneedsoperatingpossesspracticepractitionerproceduresprofessionalprogram
SHARED TOKENS (31): "applied", "attend", "care", "complete", "demand", "department", "general", "health", "knowledge", "limited", "move", "need", "needs", "operating", "possess", "practice", "practitioner", "procedures", "professional", "program".... | EXACT TITLE in vision_optical: "Surgical technologist".
0.500
accessibilityagenciesagencyamericanconditionscoordinationcurrentdatadepartmenteconomicsessentialfederalgovernmenthighlaborlocalmajormanagementneedoffice
SHARED TOKENS (28): "accessibility", "agencies", "agency", "american", "conditions", "coordination", "current", "data", "department", "economics", "essential", "federal", "government", "high", "labor", "local", "major", "management", "need", "office".... | EXACT TITLE in vision_optical: "Bureau of Labor Statistics".
0.500
administrationagencyapproximatelyauthoritybillioncombinedconnectingdatadepartmentenforcementfacilitiesfederalfiscalgovernmentlawlocalmissionoperatedpartnerspersonnel
SHARED TOKENS (35): "administration", "agency", "approximately", "authority", "billion", "combined", "connecting", "data", "department", "enforcement", "facilities", "federal", "fiscal", "government", "law", "local", "mission", "operated", "partners", "personnel".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
anotherchaincollectiondedicatedequipmentfacilityfoodinformationmanagementmaterialmaterialsmodelneedsoperationalphysicalplanningproblemsproductionproductsprofessional
SHARED TOKENS (27): "another", "chain", "collection", "dedicated", "equipment", "facility", "food", "information", "management", "material", "materials", "model", "needs", "operational", "physical", "planning", "problems", "production", "products", "professional".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentgrantslocalofficeoperateoperatorspeopleprogramsprovidersprovidingpublic
SHARED TOKENS (27): "administration", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "grants", "local", "office", "operate", "operators", "people", "programs", "providers", "providing", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbroadercapitalcategorycommunityconstructiondirectlyemploymentfacilitiesgovernmenthealthhospitalsinfrastructuremunicipaloperatorphysicalprivateprojectspublicrestoration
SHARED TOKENS (27): "assets", "broader", "capital", "category", "community", "construction", "directly", "employment", "facilities", "government", "health", "hospitals", "infrastructure", "municipal", "operator", "physical", "private", "projects", "public", "restoration".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
amongauthorityclinicalcollegecompetitivecompletedcompletiondirectorydividededucationemerginggeneralgovernmenthospitalsinternationallegallylevellicensedlicensinglocal
SHARED TOKENS (41): "among", "authority", "clinical", "college", "competitive", "completed", "completion", "directory", "divided", "education", "emerging", "general", "government", "hospitals", "international", "legally", "level", "licensed", "licensing", "local".... | EXACT TITLE in vision_optical: "Medical school".
0.500
absenceagencyassetsassistancebeganboardcareclassificationcompletecontrolcoveragecurrentdatadevelopmentestablishedfinancialfoodfunctionshealthinternational
SHARED TOKENS (51): "absence", "agency", "assets", "assistance", "began", "board", "care", "classification", "complete", "control", "coverage", "current", "data", "development", "established", "financial", "food", "functions", "health", "international".... | EXACT TITLE in vision_optical: "World Health Organization".
0.500
accessarrangementsassociationcompetingcompetitivecontractingcoordinationcorridorsdesignateddevelopmentfinancialfrequentlyfundinggeneralgovernmenthistoricalinfrastructureintegratedintendedinternational
SHARED TOKENS (47): "access", "arrangements", "association", "competing", "competitive", "contracting", "coordination", "corridors", "designated", "development", "financial", "frequently", "funding", "general", "government", "historical", "infrastructure", "integrated", "intended", "international".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
becomecareclinicclinicalcoveringgrouphealthhealthcarelicensedmedicaloccupationalofficepracticepractitionersproceduresprofessionalprogramtrainedwork
SHARED TOKENS (19): "become", "care", "clinic", "clinical", "covering", "group", "health", "healthcare", "licensed", "medical", "occupational", "office", "practice", "practitioners", "procedures", "professional", "program", "trained", "work". | EXACT TITLE in vision_optical: "Medical assistant".
0.500
Diabetes ↗ Q12206 EXACT TITLE
adultsaffectedalreadybeyondbillionconditionconditionsearlyestimatedformgrouphealthhealthcarehighincreaselivingmajorpeoplepopulationpresent
SHARED TOKENS (26): "adults", "affected", "already", "beyond", "billion", "condition", "conditions", "early", "estimated", "form", "group", "health", "healthcare", "high", "increase", "living", "major", "people", "population", "present".... | EXACT TITLE in vision_optical: "Diabetes".
0.500
appliedconstructioncontroldescribeddesignedequipmentfrequentlyfunctionsinformationlaborlargeoperationsotherwisepeoplepowerprimarysourcestructuresystemstrain
SHARED TOKENS (22): "applied", "construction", "control", "described", "designed", "equipment", "frequently", "functions", "information", "labor", "large", "operations", "otherwise", "people", "power", "primary", "source", "structure", "systems", "train".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
approveddepartmentfacilitiesfederalfocusidentifiedindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningroadsservingsystemtransportation
SHARED TOKENS (19): "approved", "department", "facilities", "federal", "focus", "identified", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "roads", "serving", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
americanauthoritybeganboundariesconcentrateddifferentdistrictdistrictsdividedentitiesformgovernmentindependentlawlegallylevellocallocallymultipleplaces
SHARED TOKENS (29): "american", "authority", "began", "boundaries", "concentrated", "different", "district", "districts", "divided", "entities", "form", "government", "independent", "law", "legally", "level", "local", "locally", "multiple", "places".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in vision_optical: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescomponentsconstructiondesignateddevelopmentequipmentestablishgovernmenthistorylawlegalownershipplanningprofessionalresearchsalesstructuralthemtransportation
SHARED TOKENS (21): "analysis", "boundaries", "components", "construction", "designated", "development", "equipment", "establish", "government", "history", "law", "legal", "ownership", "planning", "professional", "research", "sales", "structural", "them", "transportation".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
activityamongboisebusinesscollegecompetedivisioneconomicseducationfiscalhealthhighidahoindependentprogramprogramspublicreportedresearchschool
SHARED TOKENS (22): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "fiscal", "health", "high", "idaho", "independent", "program", "programs", "public", "reported", "research", "school".... | EXACT TITLE in transportation_infrastructure: "Boise State University".
0.500
Concussion ↗ Q326921 EXACT TITLE
adultsaffectaffectedamonganotherassociatedconditionconditionscontactdirectdisabilityestimatedevidenceforceshistoryincreaseinformationlaterlevelmechanism
SHARED TOKENS (42): "adults", "affect", "affected", "among", "another", "associated", "condition", "conditions", "contact", "direct", "disability", "estimated", "evidence", "forces", "history", "increase", "information", "later", "level", "mechanism".... | EXACT TITLE in vision_optical: "Concussion".
0.500
adabaseboisecentercombinedcommercialcommissiondepartmentdowntownfacilityfunctionsgeneralidahoincreaseinternationalnationaloperatedoperatesrequiringsouth
SHARED TOKENS (24): "ada", "base", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "facility", "functions", "general", "idaho", "increase", "international", "national", "operated", "operates", "requiring", "south".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
administeredadministrationageannualbillioncarecenterscovereddifferentdisabilitiesdividedfederalgovernmentgrouphealthhealthcarehospitalinsurancelimitsmedicaid
SHARED TOKENS (31): "administered", "administration", "age", "annual", "billion", "care", "centers", "covered", "different", "disabilities", "divided", "federal", "government", "group", "health", "healthcare", "hospital", "insurance", "limits", "medicaid".... | EXACT TITLE in vision_optical: "Medicare (United States)".
0.500
administeradministrationagenciesagencyassistancecorridordepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublicregulationsrehabilitation
SHARED TOKENS (23): "administer", "administration", "agencies", "agency", "assistance", "corridor", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "rehabilitation".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationapplicationsbridgecareclinicalconditionsdatadefineseducationevenfacilitiesfundinghealthhealthcareinformationinterpretationlimited
SHARED TOKENS (41): "access", "administration", "another", "application", "applications", "bridge", "care", "clinical", "conditions", "data", "defines", "education", "even", "facilities", "funding", "health", "healthcare", "information", "interpretation", "limited".... | EXACT TITLE in vision_optical: "Telehealth".
0.500
administeredagencyassistancecodifiedcontrolcoordinationdirectlyfederalformfundinggoverninglawlegislationmajorphysicalprimaryprovidingprovisionspubliclyquality
SHARED TOKENS (24): "administered", "agency", "assistance", "codified", "control", "coordination", "directly", "federal", "form", "funding", "governing", "law", "legislation", "major", "physical", "primary", "providing", "provisions", "publicly", "quality".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
advancesbridgebuiltcommunitycomplexconnectingconnectionconstructioncreatecrossdesigndesignedearlyfrequentlyintendedlocalmajornetworkpermittedphysical
SHARED TOKENS (32): "advances", "bridge", "built", "community", "complex", "connecting", "connection", "construction", "create", "cross", "design", "designed", "early", "frequently", "intended", "local", "major", "network", "permitted", "physical".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in vision_optical: "Bridge".
0.500
Irrigation ↗ Q11453 EXACT TITLE
applicationappliescollectionconditionsconsolidationcontroldevelopeddirectlydistributeddistributionformfullgrowthhelpshighmanagementnetworkoperationspracticepractices
SHARED TOKENS (36): "application", "applies", "collection", "conditions", "consolidation", "control", "developed", "directly", "distributed", "distribution", "form", "full", "growth", "helps", "high", "management", "network", "operations", "practice", "practices".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
accessbegandatadevelopmentdividedearlyformindependentindividualinformationmeansphysicalpowersignalssingletechnologyusers
SHARED TOKENS (17): "access", "began", "data", "development", "divided", "early", "form", "independent", "individual", "information", "means", "physical", "power", "signals", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
aloneanotherapproximatelycannotcentercombinedcomplexconditionscontactdependsdescribesdevelopedearlyfocusfunctionhealthhighinfluencelargermeans
SHARED TOKENS (31): "alone", "another", "approximately", "cannot", "center", "combined", "complex", "conditions", "contact", "depends", "describes", "developed", "early", "focus", "function", "health", "high", "influence", "larger", "means".... | EXACT TITLE in vision_optical: "Visual acuity".
0.500
becomecapitalcaredevelopeddevelopingdevelopmentearlyequipmentformationfrequentlyfullhospitallocaloperationsproceduressmallstandardtreatmentvisual
SHARED TOKENS (19): "become", "capital", "care", "developed", "developing", "development", "early", "equipment", "formation", "frequently", "full", "hospital", "local", "operations", "procedures", "small", "standard", "treatment", "visual". | EXACT TITLE in vision_optical: "Cataract surgery".
0.500
Medicine ↗ Q11190 EXACT TITLE
absenceappliedappliesapplybecomecareconnectionsdiagnosisfrequentlyhealthknowledgelevellocalmedicalpracticepracticesremainresearchtechnologytreatment
SHARED TOKENS (20): "absence", "applied", "applies", "apply", "become", "care", "connections", "diagnosis", "frequently", "health", "knowledge", "level", "local", "medical", "practice", "practices", "remain", "research", "technology", "treatment". | EXACT TITLE in vision_optical: "Medicine".
0.500
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancialfinancinggenerallimitedmanagementoperationalotherwiseownershippartnershipsprivateprivate-equityproduct
SHARED TOKENS (30): "active", "business", "capital", "category", "control", "described", "development", "expansion", "financial", "financing", "general", "limited", "management", "operational", "otherwise", "ownership", "partnerships", "private", "private-equity", "product".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
agenciesbuiltcomponentsconstructiondepartmentsdesigngovernmentinfrastructurelocallymunicipalnationalphysicalprivateprofessionalpublicroadssectorstructuralsystems
SHARED TOKENS (19): "agencies", "built", "components", "construction", "departments", "design", "government", "infrastructure", "locally", "municipal", "national", "physical", "private", "professional", "public", "roads", "sector", "structural", "systems". | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
americanapproximatelybillionboardbusinesscorridordirectlyfederalfiscallimitedmetropolitannationalnetworkoperateoperatesoperatororganizationreportingrevenueserve
SHARED TOKENS (27): "american", "approximately", "billion", "board", "business", "corridor", "directly", "federal", "fiscal", "limited", "metropolitan", "national", "network", "operate", "operates", "operator", "organization", "reporting", "revenue", "serve".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
Cataract ↗ Q127724 EXACT TITLE
affectageapproximatelybecomedevelopeddevelopingdevelopmentdiagnosisearlyexaminedformationinsideneededpeoplepresentproblemsprocessqualityremainsingle
SHARED TOKENS (23): "affect", "age", "approximately", "become", "developed", "developing", "development", "diagnosis", "early", "examined", "formation", "inside", "needed", "people", "present", "problems", "process", "quality", "remain", "single".... | EXACT TITLE in vision_optical: "Cataract".
0.500
acquisitionapplicationsbeyondcareclinicalcommercialdescribeddevelopingdevelopmentdiagnosiseducationestimatedgrouplawlicensedmanagementmedicalmonitoringparallelperformance
SHARED TOKENS (31): "acquisition", "applications", "beyond", "care", "clinical", "commercial", "described", "developing", "development", "diagnosis", "education", "estimated", "group", "law", "licensed", "management", "medical", "monitoring", "parallel", "performance".... | EXACT TITLE in vision_optical: "Optical coherence tomography".
0.500
administrationagencyassociatedauthoritybegancontrolcurrentdepartmentdirectlyfederalfocusfoodhealthmedicalprimaryproductspublicregulatedregulationsuses
SHARED TOKENS (21): "administration", "agency", "associated", "authority", "began", "control", "current", "department", "directly", "federal", "focus", "food", "health", "medical", "primary", "products", "public", "regulated", "regulations", "uses".... | EXACT TITLE in vision_optical: "Food and Drug Administration".
0.500
americanannualcenterscompletecomplexessentialhistoryinternationallargemedicalphysicalpublishessignificantstudysystemvisual
SHARED TOKENS (16): "american", "annual", "centers", "complete", "complex", "essential", "history", "international", "large", "medical", "physical", "publishes", "significant", "study", "system", "visual". | EXACT TITLE in vision_optical: "Neuro-ophthalmology".
0.500
agenciesapplycomprehensivedesignfacilitiesfuturegovernmentinfluencemoveneedspeopleplanningprivateprocesspublicsystemtransportation
SHARED TOKENS (17): "agencies", "apply", "comprehensive", "design", "facilities", "future", "government", "influence", "move", "needs", "people", "planning", "private", "process", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcommunitydesigneddevelopeddevelopingdisabilitiesextendsformformalgovernmentlocalmetropolitanmobilityoperateoperatedoperatesoperatorsorganizations
SHARED TOKENS (34): "access", "agencies", "beyond", "community", "designed", "developed", "developing", "disabilities", "extends", "form", "formal", "government", "local", "metropolitan", "mobility", "operate", "operated", "operates", "operators", "organizations".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
agencyauthoritybuildingbusinesscodecodifiedcommissionconsumerdepartmentdivisionenforcementestablishedfederalgovernmentindependentlawmissionmonitoringofficeprincipal
SHARED TOKENS (34): "agency", "authority", "building", "business", "code", "codified", "commission", "consumer", "department", "division", "enforcement", "established", "federal", "government", "independent", "law", "mission", "monitoring", "office", "principal".... | EXACT TITLE in vision_optical: "Federal Trade Commission".
0.480
associatedbuildingbuiltconstructiondesigndevelopmentextendfacilitiesfinancinginfrastructureplanningprocessproductswork
SHARED TOKENS (14): "associated", "building", "built", "construction", "design", "development", "extend", "facilities", "financing", "infrastructure", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in vision_optical: "Construction".
0.480
branchcaredistincthealthmedicalphysicalpractitionersprimaryscopespecialistsstandardstrainingtreatmentwork
SHARED TOKENS (14): "branch", "care", "distinct", "health", "medical", "physical", "practitioners", "primary", "scope", "specialists", "standards", "training", "treatment", "work". | EXACT TITLE in vision_optical: "Sports medicine".
0.480
cannotcentercontactfunctionindependentindividuallivingmedicalphysicalprocessqualityrehabilitationskillsvisual
SHARED TOKENS (14): "cannot", "center", "contact", "function", "independent", "individual", "living", "medical", "physical", "process", "quality", "rehabilitation", "skills", "visual". | EXACT TITLE in vision_optical: "Vision rehabilitation".
0.480
controlscrossdesigndifferentlanemajorotherwisepracticereflectsroadroadsseparatespecifieduses
SHARED TOKENS (14): "controls", "cross", "design", "different", "lane", "major", "otherwise", "practice", "reflects", "road", "roads", "separate", "specified", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.480
adultsaffectedageamongassociatedawaybillioncannotcontactdiagnosisestimatedpeopleprovidewhose
SHARED TOKENS (14): "adults", "affected", "age", "among", "associated", "away", "billion", "cannot", "contact", "diagnosis", "estimated", "people", "provide", "whose". | EXACT TITLE in vision_optical: "Refractive error".
0.480
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingcomponentsdesigneddirectlyfacilityfunctionlargemanufacturersmanufacturingmaterialsproductionstandardwarehouse
SHARED TOKENS (14): "associated", "building", "components", "designed", "directly", "facility", "function", "large", "manufacturers", "manufacturing", "materials", "production", "standard", "warehouse". | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in vision_optical: "Warehouse".
0.480
administrationagencydepartmentdivisionfederalmajorofficeprogramprogramspublicroadroadsroletransportation
SHARED TOKENS (14): "administration", "agency", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.470
Vision therapy ↗ EXACT TITLE
americanevidenceproblemssupportsupportingtreatment
SHARED TOKENS (6): "american", "evidence", "problems", "support", "supporting", "treatment". | URL->B (1): https://aapos.org/glossary/vision-therapy. | EXACT TITLE in vision_optical: "Vision therapy".
0.460
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlocalprimaryprivatepublicroadroadsroutestreetwhose
SHARED TOKENS (13): "access", "another", "design", "distinction", "local", "primary", "private", "public", "road", "roads", "route", "street", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in vision_optical: "Road".
0.460
affectedbranchdevelopmentdifferentdirectlyfunctionfunctionsgrowthratherspecificsystemthereforetissue
SHARED TOKENS (13): "affected", "branch", "development", "different", "directly", "function", "functions", "growth", "rather", "specific", "system", "therefore", "tissue". | EXACT TITLE in vision_optical: "Endocrinology".
0.460
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcreatingdesignatedearlymobilitymotornetworkpeopleprofessionalrecordroadsrural
SHARED TOKENS (13): "american", "associated", "creating", "designated", "early", "mobility", "motor", "network", "people", "professional", "record", "roads", "rural". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.460
Neurology ↗ Q83042 EXACT TITLE
branchclinicalconditionsdiagnosismedicalmultipleperipheralpracticeresearchstudysystemtrainedtreatment
SHARED TOKENS (13): "branch", "clinical", "conditions", "diagnosis", "medical", "multiple", "peripheral", "practice", "research", "study", "system", "trained", "treatment". | EXACT TITLE in vision_optical: "Neurology".
0.460
agenciescertificationeducationgovernmentindividualmobilityprivaterehabilitationschoolsspecialiststrainingtravelwork
SHARED TOKENS (13): "agencies", "certification", "education", "government", "individual", "mobility", "private", "rehabilitation", "schools", "specialists", "training", "travel", "work". | EXACT TITLE in vision_optical: "Orientation and Mobility".
0.450
Optician ↗ Q1996635 EXACT TITLE
contactindividualmakesproductswork
SHARED TOKENS (5): "contact", "individual", "makes", "products", "work". | URL->B (1): https://www.bls.gov/ooh/healthcare/opticians-dispensing.htm. | EXACT TITLE in vision_optical: "Optician".
0.440
Nystagmus ↗ Q220989 EXACT TITLE
associatedconditionconditionsidentifiedlaterlimitedmeanspeoplesignalssystemtreatmentvisual
SHARED TOKENS (12): "associated", "condition", "conditions", "identified", "later", "limited", "means", "people", "signals", "system", "treatment", "visual". | EXACT TITLE in vision_optical: "Nystagmus".
0.440
Strabismus ↗ Q179951 EXACT TITLE
anothercenteredconditioncrossdependsdiagnosisearlyhistorylargepresentproblemstreatment
SHARED TOKENS (12): "another", "centered", "condition", "cross", "depends", "diagnosis", "early", "history", "large", "present", "problems", "treatment". | EXACT TITLE in vision_optical: "Strabismus".
0.420
becomedisabilitiesemploymentfinancialfocushealthoccupationsprocessrehabilitationretentionsupport
SHARED TOKENS (11): "become", "disabilities", "employment", "financial", "focus", "health", "occupations", "process", "rehabilitation", "retention", "support". | EXACT TITLE in vision_optical: "Vocational rehabilitation".
0.420
associationcorridorsfrequentlymobilitymultiplepeopleruralserveservesusersutility
SHARED TOKENS (11): "association", "corridors", "frequently", "mobility", "multiple", "people", "rural", "serve", "serves", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.420
LASIK ↗ Q278846 EXACT TITLE
advancesanothercannotcreatehighpeopleprocedurestreatedtreatmentusesvisual
SHARED TOKENS (11): "advances", "another", "cannot", "create", "high", "people", "procedures", "treated", "treatment", "uses", "visual". | EXACT TITLE in vision_optical: "LASIK".
0.420
conditiondevelopeddevelopingevenlivingmedicalmonitoringpeopleprogressionthoughtreatment
SHARED TOKENS (11): "condition", "developed", "developing", "even", "living", "medical", "monitoring", "people", "progression", "though", "treatment". | EXACT TITLE in vision_optical: "Diabetic retinopathy".
0.400
Utility ↗ Q466707 EXACT TITLE
amongdevelopeddistincteconomicsfunctionfunctionsmeasurerelationshipsourceutility
SHARED TOKENS (10): "among", "developed", "distinct", "economics", "function", "functions", "measure", "relationship", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in vision_optical: "Utility".
0.400
capabledirectmedicalperiodpermittedpracticeprogramspecialisttrainedtraining
SHARED TOKENS (10): "capable", "direct", "medical", "period", "permitted", "practice", "program", "specialist", "trained", "training". | EXACT TITLE in vision_optical: "Fellowship (medicine)".
0.400
boiseexpansionidahooperatingoregonrestorationrouteservethoughtrain
SHARED TOKENS (10): "boise", "expansion", "idaho", "operating", "oregon", "restoration", "route", "serve", "though", "train". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.400
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericandesignedmobilitymotorprivateroadsidesouthstreet
SHARED TOKENS (10): "adjacent", "american", "designed", "mobility", "motor", "private", "road", "side", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.380
Floodplain ↗ Q193110 EXACT TITLE
adjacentbasecontroldevelopedfrequentlyhighnearvalleywater
SHARED TOKENS (9): "adjacent", "base", "control", "developed", "frequently", "high", "near", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.380
Lens ↗ Q768575 EXACT TITLE
devicefocusformmaterialmaterialsmeanssinglevisiblevisual
SHARED TOKENS (9): "device", "focus", "form", "material", "materials", "means", "single", "visible", "visual". | EXACT TITLE in vision_optical: "Lens".
0.360
americancrossroadroadsstandardsystemthoughuses
SHARED TOKENS (8): "american", "cross", "road", "roads", "standard", "system", "though", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in vision_optical: "Interchange (road)".
0.360
adjacentamericanchaincorporateindependentinternationaloperatedretail
SHARED TOKENS (8): "adjacent", "american", "chain", "corporate", "independent", "international", "operated", "retail". | EXACT TITLE in vision_optical: "LensCrafters".
0.360
americancarechaincorporatedecemberforminternationaloperated
SHARED TOKENS (8): "american", "care", "chain", "corporate", "december", "form", "international", "operated". | EXACT TITLE in vision_optical: "Pearle Vision".
0.340
Snowplow ↗ Q14976 EXACT TITLE
devicefrequentlyintendedlargeservingspecifictransportation
SHARED TOKENS (7): "device", "frequently", "intended", "large", "serving", "specific", "transportation". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.320
accommodationfocusnearpositionpowerprocess
SHARED TOKENS (6): "accommodation", "focus", "near", "position", "power", "process". | EXACT TITLE in transportation_infrastructure: "Accommodation (vertebrate eye)". | EXACT TITLE in vision_optical: "Accommodation (vertebrate eye)".
0.300
accesschaindirecteconomicsgeneralgroupintendedinternationalitselfmaterialoperatingpracticepracticesregionspecializedtraintrainstransportation
SHARED TOKENS (18): "access", "chain", "direct", "economics", "general", "group", "intended", "international", "itself", "material", "operating", "practice", "practices", "region", "specialized", "train", "trains", "transportation".
0.300
advancedapproximatelycarecategorycertificationclassificationclinicalconnectiondifferentdistincteducationestimatedfacilitieshealthhospitalsinternationallicensingmodelpracticepractitioners
SHARED TOKENS (35): "advanced", "approximately", "care", "category", "certification", "classification", "clinical", "connection", "different", "distinct", "education", "estimated", "facilities", "health", "hospitals", "international", "licensing", "model", "practice", "practitioners"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialdensitydescribeddevelopmentexpansionformgrowthinfrastructurelargemeasurepeopleplanningpopulationprivaterequireresidential
SHARED TOKENS (28): "agency", "associated", "become", "building", "commercial", "density", "described", "development", "expansion", "form", "growth", "infrastructure", "large", "measure", "people", "planning", "population", "private", "require", "residential"....
0.300
Refraction ↗ Q72277 EXACT TITLE
anotherindexmaterialsphysicalwater
SHARED TOKENS (5): "another", "index", "materials", "physical", "water". | EXACT TITLE in vision_optical: "Refraction".
0.300
Optic neuritis ↗ Q972514 KW CROSS HIGH
absenceaffectedclinicalcompleteconditiondiagnosisinformationmedicalmultiplepathwayspracticepresentreporttreatmentvisual
SHARED TOKENS (15): "absence", "affected", "clinical", "complete", "condition", "diagnosis", "information", "medical", "multiple", "pathways", "practice", "present", "report", "treatment", "visual".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomedesignfullincreaselowermakesneedpermittedrequireresearchresultingroadrulessignalssignificantthemtrainvisualwork
SHARED TOKENS (20): "associated", "become", "design", "full", "increase", "lower", "makes", "need", "permitted", "require", "research", "resulting", "road", "rules", "signals", "significant", "them", "train", "visual", "work".
0.300
creatingdemanddisabilityformfunctionsmedicalneedsnetworkolderpeopleprivateprogramsprovidepublicratherrouteruralsharedtechnologytransit
SHARED TOKENS (21): "creating", "demand", "disability", "form", "functions", "medical", "needs", "network", "older", "people", "private", "programs", "provide", "public", "rather", "route", "rural", "shared", "technology", "transit"....
0.300
alreadyamonganalysisapplicationcareclinicalcomplexdatadevelopmentdiagnosisexaminedhealthhealthcaremedicalmonitoringpatientplanningpublicregulatorysupport
SHARED TOKENS (23): "already", "among", "analysis", "application", "care", "clinical", "complex", "data", "development", "diagnosis", "examined", "health", "healthcare", "medical", "monitoring", "patient", "planning", "public", "regulatory", "support"....
0.300
americanawaybuiltcentersdemographicdevelopmentdriveeastexpansionformationgrowthmodelpatternsperipheralpopulationpopulationsprocessresidentsruralshift
SHARED TOKENS (22): "american", "away", "built", "centers", "demographic", "development", "drive", "east", "expansion", "formation", "growth", "model", "patterns", "peripheral", "population", "populations", "process", "residents", "rural", "shift"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscommunitiesconnectingdifferentdistrictseastinsidemetropolitanmultipleoperateoperatespricingregionalsystemstrainstransitzone
SHARED TOKENS (17): "business", "communities", "connecting", "different", "districts", "east", "inside", "metropolitan", "multiple", "operate", "operates", "pricing", "regional", "systems", "trains", "transit", "zone".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedbestclassesclassificationscontrolenforcementguidelineshealthidentifiedimpactlevelmotoroccupationalpracticesprovidingpublicrapidlyremainrequiringroad
SHARED TOKENS (29): "applied", "best", "classes", "classifications", "control", "enforcement", "guidelines", "health", "identified", "impact", "level", "motor", "occupational", "practices", "providing", "public", "rapidly", "remain", "requiring", "road"....
0.300
buildingbusinesscenterdedicateddesigneddevelopmentformgrowthincreaseintegratednetworkplanningprivatepublicrelationshipresidentialscaleservingspacetrain
SHARED TOKENS (21): "building", "business", "center", "dedicated", "designed", "development", "form", "growth", "increase", "integrated", "network", "planning", "private", "public", "relationship", "residential", "scale", "serving", "space", "train"....
0.300
adultsbroadercategorycommunitycompletecomplexdiagnosisdisabilityemergencyemploymentimpactlatermajormechanismoccupationalolderphysicalpressurerehabilitationrules
SHARED TOKENS (26): "adults", "broader", "category", "community", "complete", "complex", "diagnosis", "disability", "emergency", "employment", "impact", "later", "major", "mechanism", "occupational", "older", "physical", "pressure", "rehabilitation", "rules"....
0.300
anotherbecomebeganchaincomplexconsolidationdescribeddifferentdirectlyintegratedinternationallargemanagementmarketneedneededownershipportionspositionproduct
SHARED TOKENS (25): "another", "become", "began", "chain", "complex", "consolidation", "described", "different", "directly", "integrated", "international", "large", "management", "market", "need", "needed", "ownership", "portions", "position", "product"....
0.300
careconcerningcoveragecoveredentitiesfederalgovernsgroupguidelineshealthhealthcareinformationinsurancelawlimitedmedicalnationalpatientplansproviders
SHARED TOKENS (26): "care", "concerning", "coverage", "covered", "entities", "federal", "governs", "group", "guidelines", "health", "healthcare", "information", "insurance", "law", "limited", "medical", "national", "patient", "plans", "providers"....
0.300
advancesageamongconditioncontactdependsdiagnosisdistinctestablishedfitincreasemakesmeansmedicalolderpeoplepopulationpressureproductionsystem
SHARED TOKENS (22): "advances", "age", "among", "condition", "contact", "depends", "diagnosis", "distinct", "established", "fit", "increase", "makes", "means", "medical", "older", "people", "population", "pressure", "production", "system"....
0.300
Orthoptics ↗ Q1241279 KW CROSS HIGH
careconditionsdiagnosismanagementmonitoringmultiplepracticeproblemsscreeningspecifictogethertrainedtrainingtreatingtreatmentwork
SHARED TOKENS (16): "care", "conditions", "diagnosis", "management", "monitoring", "multiple", "practice", "problems", "screening", "specific", "together", "trained", "training", "treating", "treatment", "work".
0.300
Astigmatism ↗ Q177895 KW CROSS HIGH
accommodationadultsaffectapplycomponentscontactdiagnosisdifferentearlyevenlatermechanismpeoplepowerpowerspresentprovidereportedrequiressingle
SHARED TOKENS (21): "accommodation", "adults", "affect", "apply", "components", "contact", "diagnosis", "different", "early", "even", "later", "mechanism", "people", "power", "powers", "present", "provide", "reported", "requires", "single"....
0.300
absenceaffectageclassesconditionconditionsdevicediagnosisforcesformfullindividualpeoplephysicalresearchtrain
SHARED TOKENS (16): "absence", "affect", "age", "classes", "condition", "conditions", "device", "diagnosis", "forces", "form", "full", "individual", "people", "physical", "research", "train".
0.300
Nyctalopia ↗ Q7758678 KW CROSS HIGH
absenceaffectedanotherbestconditioncontaindescribedfunctionperipheralproductsrequireresultingsignalsstructuralwork
SHARED TOKENS (15): "absence", "affected", "another", "best", "condition", "contain", "described", "function", "peripheral", "products", "require", "resulting", "signals", "structural", "work".
0.300
accessibleadministrationageagencyamericananotherawaybranchbuildingcenterscommercialconstructiondepartmentdistributiondivisiondriveeducationenginesfederalgoverning
SHARED TOKENS (47): "accessible", "administration", "age", "agency", "american", "another", "away", "branch", "building", "centers", "commercial", "construction", "department", "distribution", "division", "drive", "education", "engines", "federal", "governing"....
0.300
analysisannualanotherbillionclinicalcontaincreatingdatadesignedequipmentestablishesfunctiongraphintegratedlimitedmedicalpatientpowerproceduresprocess
SHARED TOKENS (24): "analysis", "annual", "another", "billion", "clinical", "contain", "creating", "data", "designed", "equipment", "establishes", "function", "graph", "integrated", "limited", "medical", "patient", "power", "procedures", "process"....
0.300
adultsaffectagealreadyamericancompleteconditiondividedearlyformgroupgrowthincreaseincreasesolderpeoplepopulationprogressionrolesmall
SHARED TOKENS (21): "adults", "affect", "age", "already", "american", "complete", "condition", "divided", "early", "form", "group", "growth", "increase", "increases", "older", "people", "population", "progression", "role", "small"....
0.300
capacitycentercontactdistinctearlyformintendeditselflayerlimitedpatientplacementpositionproceduresrapidlyremainsmallspecificationssystemtissue
SHARED TOKENS (21): "capacity", "center", "contact", "distinct", "early", "form", "intended", "itself", "layer", "limited", "patient", "placement", "position", "procedures", "rapidly", "remain", "small", "specifications", "system", "tissue"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecrossdifferentfacilityfullgovernmentlegallocaloperateotherwiseownershippeoplephysicalprivateroadroadsroutespecificthem
SHARED TOKENS (23): "authority", "capable", "cross", "different", "facility", "full", "government", "legal", "local", "operate", "otherwise", "ownership", "people", "physical", "private", "road", "roads", "route", "specific", "them"....
0.300
administeredbranchconcerningdepartmenteducationessentialfederalfundinggeneralgovernmentguidelineshealthhealthcaremattersmedicalmissionprimaryprivateprovidingpublic
SHARED TOKENS (23): "administered", "branch", "concerning", "department", "education", "essential", "federal", "funding", "general", "government", "guidelines", "health", "healthcare", "matters", "medical", "mission", "primary", "private", "providing", "public"....
0.300
americanapplicableappliedassociationauthoritybestcommunitiescommunitycomprehensiveconditionscreatingdependdependsdesigndevelopmentdistrictsessentialfacilitiesfunctionfuture
SHARED TOKENS (41): "american", "applicable", "applied", "association", "authority", "best", "communities", "community", "comprehensive", "conditions", "creating", "depend", "depends", "design", "development", "districts", "essential", "facilities", "function", "future"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomebillioncommunitiescompetitiveconditioncreatecreatescurrentdescribesdevelopeddevelopingdevelopmenteconomicseducationessentialforecastgeographygrowth
SHARED TOKENS (54): "approximately", "architecture", "become", "billion", "communities", "competitive", "condition", "create", "creates", "current", "describes", "developed", "developing", "development", "economics", "education", "essential", "forecast", "geography", "growth"....
0.300
anotherbecomecapacityconditiondemanddensitydepartmentsfocushighlaneplanningpublicresultingroadroadsroutetransportation
SHARED TOKENS (17): "another", "become", "capacity", "condition", "demand", "density", "departments", "focus", "high", "lane", "planning", "public", "resulting", "road", "roads", "route", "transportation".
0.300
Keratoconus ↗ Q611984 KW CROSS HIGH
affectedapprovedcannotconditioncontactdiagnosisearlyestimatesincreasesmedicalneededpeoplepopulationsprogressionqualitythough
SHARED TOKENS (16): "affected", "approved", "cannot", "condition", "contact", "diagnosis", "early", "estimates", "increases", "medical", "needed", "people", "populations", "progression", "quality", "though".
0.300
americancapacitycapitalconnectingconventionalcorridorsdedicateddesigndesignedlowernetworkpublicqualitysinglesystemsystemstransittransportation
SHARED TOKENS (18): "american", "capacity", "capital", "connecting", "conventional", "corridors", "dedicated", "design", "designed", "lower", "network", "public", "quality", "single", "system", "systems", "transit", "transportation".
0.300
ageamongcareclinicalcollectionconditionsdatadesigneddifferenthealthhealthcarehistoryinformationlargemeansmedicalmultipleneedpatientpool
SHARED TOKENS (31): "age", "among", "care", "clinical", "collection", "conditions", "data", "designed", "different", "health", "healthcare", "history", "information", "large", "means", "medical", "multiple", "need", "patient", "pool"....
0.300
activitycomponentsconditionsdifferentedgemeasuremedicalnearpatientpatternpresentreflectsresponseresultingshowingsignalssmallstandardizedsystem
SHARED TOKENS (19): "activity", "components", "conditions", "different", "edge", "measure", "medical", "near", "patient", "pattern", "present", "reflects", "response", "resulting", "showing", "signals", "small", "standardized", "system".
0.300
adoptedadvancedapplicationappliedcapacitycollectionconditionsdifferentemergencyincreaseinformationinfrastructuremanagementmobilityprovideroadroadssystemsystemstechnology
SHARED TOKENS (22): "adopted", "advanced", "application", "applied", "capacity", "collection", "conditions", "different", "emergency", "increase", "information", "infrastructure", "management", "mobility", "provide", "road", "roads", "system", "systems", "technology"....
0.300
americanappearsassistanceawaycombinedcrossdesignatedevenfacilitieslargelowerotherwiseroadroadsrulesschoolseparatesignagesignalsstreet
SHARED TOKENS (22): "american", "appears", "assistance", "away", "combined", "cross", "designated", "even", "facilities", "large", "lower", "otherwise", "road", "roads", "rules", "school", "separate", "signage", "signals", "street"....
0.300
ageapplicantscannotcareconditionscoveragecovereddemographiceducationeligibilityemployeressentialestimatesexpansionfederalfundinghealthhealthcareincreaseincreases
SHARED TOKENS (48): "age", "applicants", "cannot", "care", "conditions", "coverage", "covered", "demographic", "education", "eligibility", "employer", "essential", "estimates", "expansion", "federal", "funding", "health", "healthcare", "increase", "increases"....
0.300
Presbyopia ↗ Q319595 KW CROSS HIGH
accommodationadultsaffectedageassociatedawaybecomebillionconditioncontactdevelopingdiagnosisdifferentestimatedfocusmaterialmedicalmoveolderpeople
SHARED TOKENS (26): "accommodation", "adults", "affected", "age", "associated", "away", "become", "billion", "condition", "contact", "developing", "diagnosis", "different", "estimated", "focus", "material", "medical", "move", "older", "people"....
0.300
appliedappliesapprovalassociationdecisionsdefinesdevelopmentdocumentationimpactinternationalmajormanagementmoveparticipationplanplanspolicyprocessprogramproject
SHARED TOKENS (27): "applied", "applies", "approval", "association", "decisions", "defines", "development", "documentation", "impact", "international", "major", "management", "move", "participation", "plan", "plans", "policy", "process", "program", "project"....
0.300
accessadvancedamericanbuiltcapacitycompletedconnectconnectedconnectingdesignedevenimplieslimitsmedianmotornetworkparkingplansprovidequalification
SHARED TOKENS (32): "access", "advanced", "american", "built", "capacity", "completed", "connect", "connected", "connecting", "designed", "even", "implies", "limits", "median", "motor", "network", "parking", "plans", "provide", "qualification"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleastgeneralidahomajornationalnearofficialoregonparallelpositioningroadroadsrouteruleswestwestern
SHARED TOKENS (17): "caldwell", "east", "general", "idaho", "major", "national", "near", "official", "oregon", "parallel", "positioning", "road", "roads", "route", "rules", "west", "western".
0.300
agencyapprovedbegandecemberdepartmenteducationenforcementestablishingfederalfinancialgovernmentindependentinformationlegallevellocalmattersmonitoringnationalpowers
SHARED TOKENS (27): "agency", "approved", "began", "december", "department", "education", "enforcement", "establishing", "federal", "financial", "government", "independent", "information", "legal", "level", "local", "matters", "monitoring", "national", "powers"....
0.300
administeredbillionboardcentercenterscertificationcompletecontinuingdepartmenteducationfederalformalfundinggovernmenthealthhospitalhospitalslicensuremedicaidmedical
SHARED TOKENS (25): "administered", "billion", "board", "center", "centers", "certification", "complete", "continuing", "department", "education", "federal", "formal", "funding", "government", "health", "hospital", "hospitals", "licensure", "medicaid", "medical"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
ageagenciesamericancanyoncommercialconstructioncontrolcovereddevelopedeastflowshighhistoryidaholargelimitedlowermajornationalnear
SHARED TOKENS (37): "age", "agencies", "american", "canyon", "commercial", "construction", "control", "covered", "developed", "east", "flows", "high", "history", "idaho", "large", "limited", "lower", "major", "national", "near"....
0.300
beyondcomponentsextendsfocusformformationinformationprocessresearchresultingsurroundingsystemthoughvisiblevisual
SHARED TOKENS (15): "beyond", "components", "extends", "focus", "form", "formation", "information", "process", "research", "resulting", "surrounding", "system", "though", "visible", "visual".
0.300
agencyappliedbuildingclassificationcommercialcompletedconnectionsconstructiondesigndevelopmentfunctionsinstitutionalintegratedmultipleplanningpolicyprivateprojectsresidentialsingle
SHARED TOKENS (25): "agency", "applied", "building", "classification", "commercial", "completed", "connections", "construction", "design", "development", "functions", "institutional", "integrated", "multiple", "planning", "policy", "private", "projects", "residential", "single"....
0.300
Farsightedness ↗ Q177254 KW CROSS HIGH
absenceaccommodationagebestconditioncontactdiagnosishighhistoryindexmanagementnearolderpeoplepositionprovidetreatment
SHARED TOKENS (17): "absence", "accommodation", "age", "best", "condition", "contact", "diagnosis", "high", "history", "index", "management", "near", "older", "people", "position", "provide", "treatment".
0.300
accessibleadvantagescarecategorycentercenterscliniccommunityconditionsestimatedevenfacilityhealthhealthcarehospitalsmedicalneededpatientprovidersretail
SHARED TOKENS (20): "accessible", "advantages", "care", "category", "center", "centers", "clinic", "community", "conditions", "estimated", "even", "facility", "health", "healthcare", "hospitals", "medical", "needed", "patient", "providers", "retail".
0.300
associatedbillioncomplexcontrolsdesigndevicediscoveryestablishestablishedestimatedfederalfoodgeneralincreaseincreasesintendedlargerlatermajormarket
SHARED TOKENS (32): "associated", "billion", "complex", "controls", "design", "device", "discovery", "establish", "established", "estimated", "federal", "food", "general", "increase", "increases", "intended", "larger", "later", "major", "market"....
0.300
administrationagenciesassistanceauthorizationcodifiedcoordinationdepartmentdisabilitiesdisabilityeducationemploymentestablishextendfederalfinancialgovernmentgrantshealthlawpractices
SHARED TOKENS (29): "administration", "agencies", "assistance", "authorization", "codified", "coordination", "department", "disabilities", "disability", "education", "employment", "establish", "extend", "federal", "financial", "government", "grants", "health", "law", "practices"....
0.300
combinedconnectscurrentdirectdirectlydistinctdistributionevenformhandlingincreaselevellocallowermajormarketnetworkpowerregulationseparate
SHARED TOKENS (23): "combined", "connects", "current", "direct", "directly", "distinct", "distribution", "even", "form", "handling", "increase", "level", "local", "lower", "major", "market", "network", "power", "regulation", "separate"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontroldecemberdeviceflowsinformationlanelevellocalnationalneedroadsignalssouthsystemsystemstechnologyusers
SHARED TOKENS (20): "advanced", "capacity", "competing", "control", "december", "device", "flows", "information", "lane", "level", "local", "national", "need", "road", "signals", "south", "system", "systems", "technology", "users".
0.300
buildingconditionscreatesevenhealthmaterialspeoplepersonnelphysicalpublicregulationssignagespecificsubjectsystemthemtrained
SHARED TOKENS (17): "building", "conditions", "creates", "even", "health", "materials", "people", "personnel", "physical", "public", "regulations", "signage", "specific", "subject", "system", "them", "trained".
0.300
announcedapprovedbillioncentercreateitselflaternetworkoperatesoperatingplansprincipalprojectreportingroadroutesystemtransportationwestwestern
SHARED TOKENS (20): "announced", "approved", "billion", "center", "create", "itself", "later", "network", "operates", "operating", "plans", "principal", "project", "reporting", "road", "route", "system", "transportation", "west", "western".
0.300
accessadministrationadoptedapproximatelybeganbillionbranchbuiltcollectioncompleteconstructioncontinuedcreatingdesigndesigneddevelopedestablishedextendsfederalfunding
SHARED TOKENS (47): "access", "administration", "adopted", "approximately", "began", "billion", "branch", "built", "collection", "complete", "construction", "continued", "creating", "design", "designed", "developed", "established", "extends", "federal", "funding"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationadoptedanalysisanotherarchitecturebroaderbuiltbusinesscapitalcategorycodescommunitiescommunitycreatingdesigndevelopingdevelopmentdifferentdistribution
SHARED TOKENS (59): "accessibility", "administration", "adopted", "analysis", "another", "architecture", "broader", "built", "business", "capital", "category", "codes", "communities", "community", "creating", "design", "developing", "development", "different", "distribution"....
0.300
activityanalysisboundariesdesigndocumentationestablishedgeneralgovernmentlegallegislationlicenselicensedlicensurelocalplanspracticepractitionersprocessproductproducts
SHARED TOKENS (34): "activity", "analysis", "boundaries", "design", "documentation", "established", "general", "government", "legal", "legislation", "license", "licensed", "licensure", "local", "plans", "practice", "practitioners", "process", "product", "products"....
0.300
academiccollegecommunitydifferenteducationenrollmentformhighinstitutionspolicyprogramsschoolseniorstudentstransferuniversityworkforce
SHARED TOKENS (17): "academic", "college", "community", "different", "education", "enrollment", "form", "high", "institutions", "policy", "programs", "school", "senior", "students", "transfer", "university", "workforce".
0.300
administeradministersadministrationagencycarecenterscertificationclinicaldepartmentfacilitiesfederalfinancinggovhealthhealthcareinsurancemedicaidoversightprocessprogram
SHARED TOKENS (24): "administer", "administers", "administration", "agency", "care", "centers", "certification", "clinical", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "insurance", "medicaid", "oversight", "process", "program"....
0.300
activeadministeredagenciesapproximatelyauthoritybillionbranchbuildingbusinesscapacitycombinedcomponentsconstructioncontroldepartmentdesigndirectdirectlyeastestablish
SHARED TOKENS (52): "active", "administered", "agencies", "approximately", "authority", "billion", "branch", "building", "business", "capacity", "combined", "components", "construction", "control", "department", "design", "direct", "directly", "east", "establish"....
0.300
Visual system ↗ Q558363 KW CROSS HIGH
absenceassociatedcompletecomplexconcerningcoordinationdescribesdividedformationfunctionsindependentinformationmodelmotorpatternprocessprocessingsidesurroundingsystem
SHARED TOKENS (23): "absence", "associated", "complete", "complex", "concerning", "coordination", "describes", "divided", "formation", "functions", "independent", "information", "model", "motor", "pattern", "process", "processing", "side", "surrounding", "system"....
0.300
Optical fiber ↗ Q162 KW CROSS HIGH
alignmentanotherapplicationapplicationsappliedcomplexconnectionconnectionscontactdatademanddesigndesignedhighindexlinkslowermaterialmeanspower
SHARED TOKENS (28): "alignment", "another", "application", "applications", "applied", "complex", "connection", "connections", "contact", "data", "demand", "design", "designed", "high", "index", "links", "lower", "material", "means", "power"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
advantagesagreementanotherbrandbusinesscapitalchaincompeteconditionscontrollingcorporatedirectexpansionexplicitlyfinancialgrowthindividuallargelegallicenses
SHARED TOKENS (34): "advantages", "agreement", "another", "brand", "business", "capital", "chain", "compete", "conditions", "controlling", "corporate", "direct", "expansion", "explicitly", "financial", "growth", "individual", "large", "legal", "licenses"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationconnectdevelopmentevenfullfunctionsgovernmentimpactlaterlegalownersownershippaymentpowerprivatepublicrequireroads
SHARED TOKENS (27): "acquisition", "another", "application", "connect", "development", "even", "full", "functions", "government", "impact", "later", "legal", "owners", "ownership", "payment", "power", "private", "public", "require", "roads"....
0.300
anotherapplicableapplicationapplicationscannotclinicalconditiondiagnosisemergencyfuturehospitalsinformationinterpretationlimitedmedicalprocessprocessingprofessionalratherrole
SHARED TOKENS (27): "another", "applicable", "application", "applications", "cannot", "clinical", "condition", "diagnosis", "emergency", "future", "hospitals", "information", "interpretation", "limited", "medical", "process", "processing", "professional", "rather", "role"....
0.300
advancedagenciesbegancarecontactdepartmentdevelopingdriveemergencyfacilitieshospitalmedicalmodeloperatepatientpersonnelplacespresentprimaryprovide
SHARED TOKENS (35): "advanced", "agencies", "began", "care", "contact", "department", "developing", "drive", "emergency", "facilities", "hospital", "medical", "model", "operate", "patient", "personnel", "places", "present", "primary", "provide"....
0.300
conditionscontactcoveringdevelopmentdiagnosisextendsfithealthmedicalplanningpowerqualitystructurethereforetreatment
SHARED TOKENS (15): "conditions", "contact", "covering", "development", "diagnosis", "extends", "fit", "health", "medical", "planning", "power", "quality", "structure", "therefore", "treatment".
0.300
administrationagenciesamongcommunitiescompliancecontrolcurrentdecemberdefinesdepartmentdesigndesigneddevelopeddocumentfederalissuedlawlocalnationalparking
SHARED TOKENS (32): "administration", "agencies", "among", "communities", "compliance", "control", "current", "december", "defines", "department", "design", "designed", "developed", "document", "federal", "issued", "law", "local", "national", "parking"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
cannotcombinedconnectdesigndesignedeveninfrastructureinsidelargemunicipalparkingpublicrequireresidentialroadssewersmallstreetsystemswater
SHARED TOKENS (20): "cannot", "combined", "connect", "design", "designed", "even", "infrastructure", "inside", "large", "municipal", "parking", "public", "require", "residential", "roads", "sewer", "small", "street", "systems", "water".
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdifferentformindividuallowermultipleoperateoperatesoperatingoperationsstocksystemsystemstechnologytogethertraintransit
SHARED TOKENS (21): "broader", "capability", "capacity", "conditions", "different", "form", "individual", "lower", "multiple", "operate", "operates", "operating", "operations", "stock", "system", "systems", "technology", "together", "train", "transit"....
0.300
accommodationassociateddesignedfocusformfunctionincreasesinsidelimitedlocalmaterialmaterialsminutesneedotherwisepatientperiodpressureproblemsprocedures
SHARED TOKENS (26): "accommodation", "associated", "designed", "focus", "form", "function", "increases", "inside", "limited", "local", "material", "materials", "minutes", "need", "otherwise", "patient", "period", "pressure", "problems", "procedures"....
0.300
administrationbeganbrandcorporatecurrentgovernmentissuednationaloperateoperatingorganizationorganizationspolicypublicresearchserveservesunified
SHARED TOKENS (18): "administration", "began", "brand", "corporate", "current", "government", "issued", "national", "operate", "operating", "organization", "organizations", "policy", "public", "research", "serve", "serves", "unified".
0.300
americancarecomprehensivecontinuingfacilitieshealthhealthcarehospitalhospitalsidaholivingnetworkoperatesoperatingoregonpeopleseniorsouthsupportsystem
SHARED TOKENS (20): "american", "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "hospital", "hospitals", "idaho", "living", "network", "operates", "operating", "oregon", "people", "senior", "south", "support", "system".
0.300
accesscommunitycompletedesigndesignedhealthlivingoperatedpolicypractitionerspublicrequirestransportationtraveluserszones
SHARED TOKENS (16): "access", "community", "complete", "design", "designed", "health", "living", "operated", "policy", "practitioners", "public", "requires", "transportation", "travel", "users", "zones".
🫐 BERRY56 edges
0.280
Binocular vision ↗ EXACT TITLE
applicationsinfluencemedicalplacement
SHARED TOKENS (4): "applications", "influence", "medical", "placement". | EXACT TITLE in vision_optical: "Binocular vision".
0.280
adaboisecanyoncombineddesignatedidaholargermeridianmetropolitannampaoregonpopulationtreasurevalley
SHARED TOKENS (14): "ada", "boise", "canyon", "combined", "designated", "idaho", "larger", "meridian", "metropolitan", "nampa", "oregon", "population", "treasure", "valley".
0.280
caredevelopmenttreatingvisual
SHARED TOKENS (4): "care", "development", "treating", "visual". | EXACT TITLE in vision_optical: "Pediatric ophthalmology".
0.280
creatingdepartmentdesignateddesigneddifferentdividedevenpathwayprimaryprovideroutesharedtravelusers
SHARED TOKENS (14): "creating", "department", "designated", "designed", "different", "divided", "even", "pathway", "primary", "provide", "route", "shared", "travel", "users".
0.280
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastidahometropolitanmiddletonpopulationrapidlyschoolschoolssharedwest
SHARED TOKENS (14): "ada", "boise", "canyon", "district", "east", "idaho", "metropolitan", "middleton", "population", "rapidly", "school", "schools", "shared", "west".
0.280
contactdevicedirectlyvisual
SHARED TOKENS (4): "contact", "device", "directly", "visual". | EXACT TITLE in vision_optical: "Corrective lens".
0.280
assistancebrandconditionsdedicateddirectlyequipmentmedicalpatientperipheralplacessubjecttechniciantestingvisual
SHARED TOKENS (14): "assistance", "brand", "conditions", "dedicated", "directly", "equipment", "medical", "patient", "peripheral", "places", "subject", "technician", "testing", "visual".
0.260
Anti-VEGF ↗ Q23808471 KW CROSS HIGH
bestclinicalgrowthlaterprimaryprogressionratherrestorationreviewshowsmalltreatmentvisual
SHARED TOKENS (13): "best", "clinical", "growth", "later", "primary", "progression", "rather", "restoration", "review", "show", "small", "treatment", "visual".
0.260
createenginesuses
SHARED TOKENS (3): "create", "engines", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
conditionconditionsdevelopment
SHARED TOKENS (3): "condition", "conditions", "development". | EXACT TITLE in vision_optical: "Ptosis (eyelid)".
0.260
patientpowerspecified
SHARED TOKENS (3): "patient", "power", "specified". | EXACT TITLE in vision_optical: "Eyeglass prescription".
0.260
caredevelopmentsupport
SHARED TOKENS (3): "care", "development", "support". | EXACT TITLE in vision_optical: "Retinopathy of prematurity".
0.260
americandepartmentdepartmentsdirectlyfederalfiscalgovernmentmissionpeopleplanservingsystemtransportation
SHARED TOKENS (13): "american", "department", "departments", "directly", "federal", "fiscal", "government", "mission", "people", "plan", "serving", "system", "transportation".
0.260
branchnetworktransportation
SHARED TOKENS (3): "branch", "network", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeconstructionequipmentinfrastructurelargelegallimitsordinaryroadspecifiedstandardtransportationwater
SHARED TOKENS (13): "bridge", "construction", "equipment", "infrastructure", "large", "legal", "limits", "ordinary", "road", "specified", "standard", "transportation", "water".
0.240
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedbrandconditionsindependentneedsroleshowingspecifictechnicianwork
SHARED TOKENS (12): "already", "approval", "approved", "brand", "conditions", "independent", "needs", "role", "showing", "specific", "technician", "work".
0.240
advantagesambulatorycentercentersdepartmentearlyenterfacilityhospitalhospitalslowerrequire
SHARED TOKENS (12): "advantages", "ambulatory", "center", "centers", "department", "early", "enter", "facility", "hospital", "hospitals", "lower", "require".
0.240
Sunglasses ↗ Q217541 KW CROSS HIGH
againstamericanassociationdesignedearlyformfunctionperiodproblemsproceduresvisiblevisual
SHARED TOKENS (12): "against", "american", "association", "designed", "early", "form", "function", "period", "problems", "procedures", "visible", "visual".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
connectionslargemarketingmetropolitanparkingpeoplepoolpublicroadsystemtransfertransit
SHARED TOKENS (12): "connections", "large", "marketing", "metropolitan", "parking", "people", "pool", "public", "road", "system", "transfer", "transit".
0.240
accessarterialconnectingdesignedlocalmajormoveprovideresidentialroadroadsserves
SHARED TOKENS (12): "access", "arterial", "connecting", "designed", "local", "major", "move", "provide", "residential", "road", "roads", "serves".
0.240
alignmentconstructiondesignflowsfuturematerialsplanningprofessionalroadsstandardsstructuraltransportation
SHARED TOKENS (12): "alignment", "construction", "design", "flows", "future", "materials", "planning", "professional", "roads", "standards", "structural", "transportation".
0.240
Stereopsis ↗ Q247932 KW CROSS HIGH
differentextendinformationprocessingrelationshipsresearchresultingrolesinglespacetogethervisual
SHARED TOKENS (12): "different", "extend", "information", "processing", "relationships", "research", "resulting", "role", "single", "space", "together", "visual".
0.240
awayboisecrossdesignateddowntownidahomajormetropolitannearoregonrouteserves
SHARED TOKENS (12): "away", "boise", "cross", "designated", "downtown", "idaho", "major", "metropolitan", "near", "oregon", "route", "serves".
0.220
activityaffectanotherdifferentmaterialsreflectsrelationshipssingletrainstravelvertical
SHARED TOKENS (11): "activity", "affect", "another", "different", "materials", "reflects", "relationships", "single", "trains", "travel", "vertical".
0.220
academicapplicationdesignfacilitiesmanagementoccupationalpeopleplanningprovidetechnologytransportation
SHARED TOKENS (11): "academic", "application", "design", "facilities", "management", "occupational", "people", "planning", "provide", "technology", "transportation".
0.210
system
SHARED TOKENS (1): "system". | EXACT TITLE in vision_optical: "Convergence insufficiency".
0.200
administeradministrationapplieddirectlyinsidemeansprocessroutesitestandard
SHARED TOKENS (10): "administer", "administration", "applied", "directly", "inside", "means", "process", "route", "site", "standard".
0.200
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedeastidaholimitedoregonroutesouthsystemwestwestern
SHARED TOKENS (10): "continued", "east", "idaho", "limited", "oregon", "route", "south", "system", "west", "western".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationruralwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "rural", "western".
0.180
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahometropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate", "street".
0.180
Ophthalmoscopy ↗ Q837188 KW CROSS HIGH
carecomprehensivehealthinsidelaterphysicalprimaryprofessionalstructures
SHARED TOKENS (9): "care", "comprehensive", "health", "inside", "later", "physical", "primary", "professional", "structures".
0.180
accommodationdependsdesignfullgenerallevelolderpatientpower
SHARED TOKENS (9): "accommodation", "depends", "design", "full", "general", "level", "older", "patient", "power".
0.180
Diplopia ↗ Q775940 KW CROSS HIGH
cannotconditionsfocusfunctionpathwaysproblemsprocesssinglevisual
SHARED TOKENS (9): "cannot", "conditions", "focus", "function", "pathways", "problems", "process", "single", "visual".
0.160
becomedesignfocusphysicalroadroadsruleuses
SHARED TOKENS (8): "become", "design", "focus", "physical", "road", "roads", "rule", "uses".
0.160
adjacentassociatedcaregeneralpressurestructurestissuetreatment
SHARED TOKENS (8): "adjacent", "associated", "care", "general", "pressure", "structures", "tissue", "treatment".
0.160
canyonconnectingeagleeastidahomeridiannampavalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "east", "idaho", "meridian", "nampa", "valley".
0.140
boisecanyonidahometropolitanmiddletonnampapopulation
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
0.140
affectagehealthindividualmeanstissuetreats
SHARED TOKENS (7): "affect", "age", "health", "individual", "means", "tissue", "treats".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
absenceanothercombinedconditionshighreturnvisible
SHARED TOKENS (7): "absence", "another", "combined", "conditions", "high", "return", "visible".
0.120
adjacentawaycenterlargeperipheralvisual
SHARED TOKENS (6): "adjacent", "away", "center", "large", "peripheral", "visual".
0.120
alignmentgeneralhospitalpatientreturntrained
SHARED TOKENS (6): "alignment", "general", "hospital", "patient", "return", "trained".
0.120
americancommercialinternationalphysicalprocessproducts
SHARED TOKENS (6): "american", "commercial", "international", "physical", "process", "products".
0.120
administeredapplicationscarehealthpatientspecialized
SHARED TOKENS (6): "administered", "applications", "care", "health", "patient", "specialized".
0.120
affectedconditionmedicalsignalsthemvisual
SHARED TOKENS (6): "affected", "condition", "medical", "signals", "them", "visual".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "metropolitan", "population".
0.100
Slit lamp ↗ Q965041 KW CROSS HIGH
conditionsdevicesegmentsourcestructures
SHARED TOKENS (5): "conditions", "device", "segment", "source", "structures".
0.100
governinglegallimitedlocalmunicipal
SHARED TOKENS (5): "governing", "legal", "limited", "local", "municipal".
0.100
agencycertificationprofessionalpublicqualification
SHARED TOKENS (5): "agency", "certification", "professional", "public", "qualification".
0.100
commerciallargelicensematerialsoperate
SHARED TOKENS (5): "commercial", "large", "license", "materials", "operate".
0.100
handlingitselfmultipleroadtransportation
SHARED TOKENS (5): "handling", "itself", "multiple", "road", "transportation".
0.100
informationmajornearsystemvisual
SHARED TOKENS (5): "information", "major", "near", "system", "visual".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
Bike lane ↗ Q1378400 KW CROSS HIGH
lanemotorpermittedresearchroad
SHARED TOKENS (5): "lane", "motor", "permitted", "research", "road".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Vision Optical — Treasure Valley
HAIKU · HIGH GATE
How do transportation corridors in Ada County affect Vision Optical's ability to serve patients across the Treasure Valley?
Vision Optical locations in Boise, Meridian, and Eagle depend on reliable highway access along I-84 and State Highway 55 to retain patients from across Ada County and western Idaho. The expansion of transportation infrastructure in the Treasure Valley metropolitan area directly determines how far patients can reasonably travel for optical services without excessive commute times.
What role does Americans with Disabilities Act compliance in Treasure Valley transportation play for Vision Optical accessibility?
Vision Optical facilities in Nampa and Caldwell must coordinate with Ada County and Canyon County transportation planning to ensure ADA-compliant parking and transit access under the Americans with Disabilities Act of 1990. Transportation infrastructure investments that improve sidewalk connectivity and public transit in these Canyon County communities directly enhance Vision Optical's accessibility to disabled patients.
How does Boise's technology sector growth influence Vision Optical's location strategy relative to transportation networks?
The Treasure Valley's expanding technology workforce in Boise and surrounding areas has increased demand for Vision Optical services along major commuter corridors connected by I-84. Transportation infrastructure development that supports this population growth in Ada County directly shapes where Vision Optical expands its practices to capture this demographic.
Why would Vision Optical consider proximity to College of Western Idaho when evaluating transportation infrastructure in the Treasure Valley?
College of Western Idaho's campus in Nampa sits along key transportation routes in Canyon County, creating opportunities for Vision Optical to serve the student and employee population through strategic location decisions. Transportation connections between the college's campus and population centers in Boise and Meridian determine the feasibility of Vision Optical serving this demographic efficiently.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Vision Optical 13 QID bridges 245 edges 6,942 ext links 2026-07-17 23:44:04 UTC 8bd6a96c526b54e8
Transportation Infrastructure corridor ↗ Vision Optical corridor ↗ Vision Optical × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals