—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Faith Religious

17 Wikipedia bridge articles confirmed in both vertical ledgers. 243 deterministic cross-vertical edges. 6,655 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
243 Cross Edges
6,655 External Sources
268 Wikipedia Articles
23 🌲 Evergreen
177 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Faith Religious
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
243
External Sources Harvested
6,655
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  26 shared tokens
QID Bridge Titles (17)
IdahoZoningTreasure ValleySnake RiverBoise State UniversityAda County, IdahoNampa, IdahoLand-use planningStar, IdahoBoise, IdahoGarden City, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoMeridian, IdahoMiddleton, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadawestcanyonnorthwestoregoncapitallandrivernameeasterngovernmentslocalvalleycollegehomenampa
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:40:33 UTC
Content Hash
7fcac44399722363
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (26): "agricultural", "approximately", "associated", "boise", "capital", "contains", "distinct", "eastern", "economy", "idaho", "land", "mining", "national", "northwest", "official", "oregon", "people", "population", "river", "separate".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in faith_religious: "Idaho".
agriculturalapproximatelyassociatedboisecapitalcontainsdistincteasterneconomyidaholandminingnationalnorthwestofficialoregonpeoplepopulationriverseparatesignificantsmallsuppliestechnologyuseswest
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (32): "allowing", "building", "buildings", "certain", "density", "determine", "developed", "development", "different", "form", "government", "governments", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in faith_religious: "Zoning".
allowingbuildingbuildingscertaindensitydeterminedevelopeddevelopmentdifferentformgovernmentgovernmentsgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesystemsurban+2
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (19): "agricultural", "association", "boise", "eastern", "historically", "idaho", "land", "local", "metropolitan", "name", "opportunities", "oregon", "primarily", "region", "resources", "river", "rural", "treasure", "valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in faith_religious: "Treasure Valley".
agriculturalassociationboiseeasternhistoricallyidaholandlocalmetropolitannameopportunitiesoregonprimarilyregionresourcesriverruraltreasurevalley
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in transportation_infrastructure (tier:branch) and faith_religious (tier:evergreen). | SHARED TOKENS (44): "age", "agencies", "american", "americans", "canyon", "central", "commercial", "constructed", "construction", "control", "created", "developed", "eastern", "governments", "high", "history", "idaho", "irrigation", "large", "limited".... | EXACT TITLE in faith_religious: "Snake River".
ageagenciesamericanamericanscanyoncentralcommercialconstructedconstructioncontrolcreateddevelopedeasterngovernmentshighhistoryidahoirrigationlargelimitedlongmajormilitarynationalnearnorthwestonceoregonpolicypopulations+14
reas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success. The proposed removal of the four lower Snake River dams for fish passage is a significant ongoing policy debate in the Pacific Northwest. Course The Snake River starts to the north of Two Ocean Pass near the southern border of Yellowstone National Park, about 9,200 feet (2,800 m) above sea level in the Rocky Mountains of Wyoming. The river descends west through the high mountains of the Teton Wilderness meeting the Lewis River and continuing south into Jackson Lake in Grand Teton National Park, a natural glacial lake enlarged by Jackson Lake Dam. Joined by Pacific Creek and Buffalo Fork below the dam, it meanders southward through the alpine valley of Jackson Hole situated on the plain in front of the Teton Range to the west and the Gros Ventre Range to the east. Below the town of Jackson it forms the Snake River Canyon of Wyoming, turns west and crosses into Idaho, where the Palisades Dam forms Palisades Reservoir. From there it flows northwest through Swan Valley to join the Henrys Fork on an alluvial plain near Rexburg. The Henrys Fork is sometimes called the "North Fork" of the Snake River, while the section of the main Snake River above their confluence is sometimes called the "South Fork". Turning southwest, the river begins its long journey across the Snake River Plain, passing through Idaho Falls and receiving the Blackfoot River from the left before entering the 20-mile (32 km)-long American Falls Reservoir, formed by American Falls Dam. From American Falls it turns west, flowing through Minidoka Dam and Milner Dam, where large volumes of water are diverted for irrigation. Below Milner Dam it enters the Snake River Canyon of Idaho, where the river narrows, forming rapids and waterfalls. In the 70-mile (110 km) stretch between Milner Dam and the confluence with the Malad River near Hagerman Fossil Beds National Monument, the Snake River descends a total of 1,300 feet (400 m) over a series of cataracts and rapids, chief of which include Caldron Linn, Twin, Shoshone, Pillar, Auger, and Salmon Falls. Idaho Power operates several small hydroelectric plants along this stretch of the river.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "division", "education", "founded", "health", "high", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "university", "west". | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in faith_religious: "Boise State University".
activityamongboisebusinesscollegedivisioneducationfoundedhealthhighidahoindependentprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Ada County, Idaho
Q109820 QID OVERLAP 0.910
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "streets". | URL->B (1): https://adacounty.id.gov/Assessor.
adaboisecapitaldistricthomeidahojurisdictionlocalmetropolitannorthwestpopulationprivatestreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (17): "according", "boise", "canyon", "college", "comes", "home", "idaho", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "principal", "student", "university", "west".
accordingboisecanyoncollegecomeshomeidahomeridianmetropolitannamenampanorthwestpopulationprincipalstudentuniversitywest
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (43): "act", "american", "applicable", "association", "authority", "central", "communities", "community", "comprehensive", "conditions", "conflicts", "creating", "design", "development", "districts", "essential", "facilities", "founded", "function", "governments"....
actamericanapplicableassociationauthoritycentralcommunitiescommunitycomprehensiveconditionsconflictscreatingdesigndevelopmentdistrictsessentialfacilitiesfoundedfunctiongovernmentshealthinstitutejurisdictionslandland-useneedspatternspeoplephysicalplanning+13
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Star, Idaho
Q1516815 QID OVERLAP 0.800
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (16): "ada", "boise", "canyon", "district", "growing", "house", "idaho", "metropolitan", "middleton", "name", "population", "school", "schools", "shared", "star", "west".
adaboisecanyondistrictgrowinghouseidahometropolitanmiddletonnamepopulationschoolschoolssharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (18): "ada", "annual", "boise", "capital", "counties", "employers", "feet", "home", "idaho", "locally", "major", "metropolitan", "oregon", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployersfeethomeidaholocallymajormetropolitanoregonpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
QID OVERLAP 0.740
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and faith_religious (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "nearly", "population", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalnamenearlypopulationseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "oregon", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.680
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (9): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "nearly", "percent", "population".
adaadditionalboiseidahokunametropolitannearlypercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Middleton, Idaho
Q1517595 QID OVERLAP 0.640
QID OVERLAP: Q1517595 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
boisecanyonidahometropolitanmiddletonnampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and faith_religious (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
226 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP226 edges
🌲 EVERGREEN6 edges
0.650
accessagencyestablishedfoundedhistoricalidahomaintainsmaterialofficeofficialplacespreservationprogrampublicrecordssitessociety
SHARED TOKENS (17): "access", "agency", "established", "founded", "historical", "idaho", "maintains", "material", "office", "official", "places", "preservation", "program", "public", "records", "sites", "society". | URL->B (1): http://www.history.idaho.gov/. | EXACT TITLE in faith_religious: "Idaho State Historical Society".
0.650
acquisitionagencyboardcommissionconstructioncreatedfederalgovernmentindependentindustryjurisdictionmatterspipelinespreviouslyrailregulationregulatoryrelevantservestraffic
SHARED TOKENS (21): "acquisition", "agency", "board", "commission", "construction", "created", "federal", "government", "independent", "industry", "jurisdiction", "matters", "pipelines", "previously", "rail", "regulation", "regulatory", "relevant", "serves", "traffic".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
actadministrationagencyassistanceconditionsdecemberdepartmenteducationemploymentestablishedfederalhealthinspectlaborlawmissionoccupationalprovidingregulationsregulatory
SHARED TOKENS (28): "act", "administration", "agency", "assistance", "conditions", "december", "department", "education", "employment", "established", "federal", "health", "inspect", "labor", "law", "mission", "occupational", "providing", "regulations", "regulatory".... | URL->B (1): https://www.osha.gov/. | EXACT TITLE in faith_religious: "Occupational Safety and Health Administration".
0.650
acquisitionadministrationamericancommercialfederalfundfundinggenerallandpercentplanningprogramprojectspublicrevenuesafetysoldstationstaxtaxes
SHARED TOKENS (20): "acquisition", "administration", "american", "commercial", "federal", "fund", "funding", "general", "land", "percent", "planning", "program", "projects", "public", "revenue", "safety", "sold", "stations", "tax", "taxes". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamonganotherauthorityboisecanyoncapacitycapitalcenterconventionalcrossdemanddistricteagleemployeremployersfederalfirms
SHARED TOKENS (76): "ada", "additional", "agencies", "among", "another", "authority", "boise", "canyon", "capacity", "capital", "center", "conventional", "cross", "demand", "district", "eagle", "employer", "employers", "federal", "firms".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.630
agencycreatedcreatingdepartmentenforceenforcementidaholawlegislaturemunicipalorganizationpresentpublicstatewide
SHARED TOKENS (14): "agency", "created", "creating", "department", "enforce", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
🌿 BRANCH177 edges
0.590
boisebuildingbuildingscapitaldistrictidahonationalneighborhoodplacespropertyregisterstreet
SHARED TOKENS (12): "boise", "building", "buildings", "capital", "district", "idaho", "national", "neighborhood", "places", "property", "register", "street". | URL->B (1): http://www.boisecathedral.org/. | EXACT TITLE in faith_religious: "Cathedral of St. John the Evangelist (Boise, Idaho)".
0.530
agencydepartmentdevelopmentidahoinsurancelaborselectedtechnologyworkforce
SHARED TOKENS (9): "agency", "department", "development", "idaho", "insurance", "labor", "selected", "technology", "workforce". | URL->B (1): https://www.labor.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho Department of Labor". | EXACT TITLE in faith_religious: "Idaho Department of Labor".
0.530
adaboisehighidahooperatedprivateschoolschoolssecondary
SHARED TOKENS (9): "ada", "boise", "high", "idaho", "operated", "private", "school", "schools", "secondary". | URL->B (1): http://www.bk.org/. | EXACT TITLE in faith_religious: "Bishop Kelly High School".
0.500
adoptedageamericancentercentralcommunitiescontinuouseasternestimatesfoundedfreeidentifiedidentifyinternationallawlawslimitedmajornamepeople
SHARED TOKENS (31): "adopted", "age", "american", "center", "central", "communities", "continuous", "eastern", "estimates", "founded", "free", "identified", "identify", "international", "law", "laws", "limited", "major", "name", "people".... | EXACT TITLE in faith_religious: "Reform Judaism".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlandlocalplaceprimarilyprimaryprivatepublicroadroutestreetstreetstrafficurbanwhose
SHARED TOKENS (18): "access", "another", "design", "distinction", "land", "local", "place", "primarily", "primary", "private", "public", "road", "route", "street", "streets", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in faith_religious: "Road".
0.500
assetassociatedbuildingbuildingsbuiltconstructiondesigndevelopmentexpandfacilitiesfinancingindustrialindustryinfrastructuremaintenancepercentplanningprocesswork
SHARED TOKENS (19): "asset", "associated", "building", "buildings", "built", "construction", "design", "development", "expand", "facilities", "financing", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in faith_religious: "Construction".
0.500
Food bank ↗ Q113603 EXACT TITLE
activeadministrationassistancecommunitiescommunityconditionscreatedirectlydistributionemergencyespeciallyestablishedevenfinancialfoodgrowthhealthcarehistoryindividualslaw
SHARED TOKENS (31): "active", "administration", "assistance", "communities", "community", "conditions", "create", "directly", "distribution", "emergency", "especially", "established", "even", "financial", "food", "growth", "healthcare", "history", "individuals", "law".... | EXACT TITLE in faith_religious: "Food bank".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingcrossdesignedfrequentlyitselfmaterialneedplacingpracticeprocessrequirementsroadshapestructuretraffic
SHARED TOKENS (15): "allowing", "cross", "designed", "frequently", "itself", "material", "need", "placing", "practice", "process", "requirements", "road", "shape", "structure", "traffic". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
actcodifieddiscriminationfederalhouseindividualsinstitutionslandlawlawspdfproblemsprotectsrestorationzoning
SHARED TOKENS (15): "act", "codified", "discrimination", "federal", "house", "individuals", "institutions", "land", "law", "laws", "pdf", "problems", "protects", "restoration", "zoning". | EXACT TITLE in faith_religious: "Religious Land Use and Institutionalized Persons Act".
0.500
commerciallycontextcorporationdevelopeddevelopmentestablishedfunctionlawmobilenationaloperateorganizationsotherspercentpracticeprimarilypublicrecordshowstations
SHARED TOKENS (22): "commercially", "context", "corporation", "developed", "development", "established", "function", "law", "mobile", "national", "operate", "organizations", "others", "percent", "practice", "primarily", "public", "record", "show", "stations".... | EXACT TITLE in faith_religious: "Religious broadcasting".
0.500
associationcreatedespeciallyfrequentlyindustriallandlandscapemultiplepeoplerecreationalrightsruralservesurbanusers
SHARED TOKENS (15): "association", "created", "especially", "frequently", "industrial", "land", "landscape", "multiple", "people", "recreational", "rights", "rural", "serves", "urban", "users". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
canyoncivilconstructionemergencygeneralhomeidahoindustrialintegratedmilitarymissionmunicipalnampanationalprivatepublicriversystemstraining
SHARED TOKENS (19): "canyon", "civil", "construction", "emergency", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "municipal", "nampa", "national", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
affectsageagencyamongbecomecarecommunityconcernsconditionscreateddatadescribedespeciallygeneralgovernmentgrouphealthhighhomelack
SHARED TOKENS (35): "affects", "age", "agency", "among", "become", "care", "community", "concerns", "conditions", "created", "data", "described", "especially", "general", "government", "group", "health", "high", "home", "lack".... | EXACT TITLE in faith_religious: "Foster care".
0.500
applicablebuildingcentercenterscommercialdedicateddeliverydemanddirectlydistributionfacilityfirmsfunctionhandlinglaborlargelogisticsmarketnamenetwork
SHARED TOKENS (37): "applicable", "building", "center", "centers", "commercial", "dedicated", "delivery", "demand", "directly", "distribution", "facility", "firms", "function", "handling", "labor", "large", "logistics", "market", "name", "network".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
adaboisecanyoncombinedcountiesdesignatedhomeidaholargermeridianmetropolitannampanearlynorthwestoregonpercentpopulationtreasurevalleywider
SHARED TOKENS (20): "ada", "boise", "canyon", "combined", "counties", "designated", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "nearly", "northwest", "oregon", "percent", "population", "treasure", "valley", "wider". | EXACT TITLE in faith_religious: "Boise metropolitan area".
0.500
affectsbusinessescorporatedemonstrateentitiesespeciallyfinancialforminformationinvestmentlawlegalmajormeetnonprofitoperatedorganizationorganizationalorganizationsprimary
SHARED TOKENS (30): "affects", "businesses", "corporate", "demonstrate", "entities", "especially", "financial", "form", "information", "investment", "law", "legal", "major", "meet", "nonprofit", "operated", "organization", "organizational", "organizations", "primary".... | EXACT TITLE in faith_religious: "Charitable organization".
0.500
agencyamericanbusinessbusinessescommunitiescommunitycontaincurrentdatadepartmentdepartmentseconomyfederalgovernmenthospitalshouseinformationinfrastructurelocalmaking
SHARED TOKENS (30): "agency", "american", "business", "businesses", "communities", "community", "contain", "current", "data", "department", "departments", "economy", "federal", "government", "hospitals", "house", "information", "infrastructure", "local", "making".... | EXACT TITLE in faith_religious: "United States Census Bureau".
0.500
amongcommunitydifferentinstitutionalinstitutionsinternationallargerlocalmajornationalpeopleregionalrolestudythroughouttraining
SHARED TOKENS (16): "among", "community", "different", "institutional", "institutions", "international", "larger", "local", "major", "national", "people", "regional", "role", "study", "throughout", "training". | EXACT TITLE in faith_religious: "Interfaith dialogue".
0.500
accessactcomprehensivecontinuingcreatedexistingfederalfederallyformationfundinggovernedgovernmentlawlocalmetropolitanorganizationparticipationplanningpopulationprocess
SHARED TOKENS (27): "access", "act", "comprehensive", "continuing", "created", "existing", "federal", "federally", "formation", "funding", "governed", "government", "law", "local", "metropolitan", "organization", "participation", "planning", "population", "process".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
accessaffectagenciesarticlebeyondcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteducationenvironmentespeciallyevenfreegovernmentgovernments
SHARED TOKENS (54): "access", "affect", "agencies", "article", "beyond", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "education", "environment", "especially", "even", "free", "government", "governments".... | EXACT TITLE in faith_religious: "Child protection".
0.500
broadercertaincomprehensivedevelopmentgrowthindustrialinfrastructurelandland-uselargerlawsmanagementmilitarynationalneedsnetworkplanningpracticesregionregional
SHARED TOKENS (31): "broader", "certain", "comprehensive", "development", "growth", "industrial", "infrastructure", "land", "land-use", "larger", "laws", "management", "military", "national", "needs", "network", "planning", "practices", "region", "regional".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
approximatelyboisedatadistrictdistrictsevengovernmenthouseidaholegislaturelimitspeoplepopulationresidentssinglesubsequent
SHARED TOKENS (16): "approximately", "boise", "data", "district", "districts", "even", "government", "house", "idaho", "legislature", "limits", "people", "population", "residents", "single", "subsequent". | EXACT TITLE in faith_religious: "Idaho Legislature".
0.500
accessagenciescommunityconditionscreateddevelopmentdifferentdistincteconomyelectricalemergencyenforcementenvironmentespeciallyessentialfacilitiesfirmsfocusedfrequentlyfunction
SHARED TOKENS (47): "access", "agencies", "community", "conditions", "created", "development", "different", "distinct", "economy", "electrical", "emergency", "enforcement", "environment", "especially", "essential", "facilities", "firms", "focused", "frequently", "function".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in faith_religious: "Infrastructure".
0.500
agriculturalchoicesconcentratedconcernsdevelopeddevelopmentdirectdriverenvironmentestimatesfocusedfreegroupgrowinggrowthhighindividualsinternationallimitedliving
SHARED TOKENS (34): "agricultural", "choices", "concentrated", "concerns", "developed", "development", "direct", "driver", "environment", "estimates", "focused", "free", "group", "growing", "growth", "high", "individuals", "international", "limited", "living".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in faith_religious: "Population growth".
0.500
accordingamongapproximatelybecomebodyconcerningcurrentdistinguishdistricteasternestablishedlargerpopulationsignificanttitle
SHARED TOKENS (15): "according", "among", "approximately", "become", "body", "concerning", "current", "distinguish", "district", "eastern", "established", "larger", "population", "significant", "title". | EXACT TITLE in faith_religious: "Coptic Orthodox Church".
0.500
boundariescertificationcompleteemployerlaborlicensepeopleperiodpermanentpracticepractitionersprofessionalreachregulatedstudysystemtraining
SHARED TOKENS (17): "boundaries", "certification", "complete", "employer", "labor", "license", "people", "period", "permanent", "practice", "practitioners", "professional", "reach", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmentespeciallyfocusedfrequentlygrowthhistoricallyinfrastructurelocalmarketpeoplepoliciespolicyprocessregionwest
SHARED TOKENS (18): "according", "community", "describes", "development", "especially", "focused", "frequently", "growth", "historically", "infrastructure", "local", "market", "people", "policies", "policy", "process", "region", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
againstapplicationappliesbecomecannotcertaindiscriminationemploymentfreegoverninggovernmentinstitutionslaterlawslegalrelationshiprelationshipsschoolseekingserves
SHARED TOKENS (21): "against", "application", "applies", "become", "cannot", "certain", "discrimination", "employment", "free", "governing", "government", "institutions", "later", "laws", "legal", "relationship", "relationships", "school", "seeking", "serves".... | EXACT TITLE in faith_religious: "Ministerial exception".
0.500
articlechainscomplexconsumercreatingdirectdirectlydistributionfacilitiesindependentlogisticsmanagementmaterialsnetworkstructuresupplierssupplysystemsystemsthem
SHARED TOKENS (20): "article", "chains", "complex", "consumer", "creating", "direct", "directly", "distribution", "facilities", "independent", "logistics", "management", "materials", "network", "structure", "suppliers", "supply", "system", "systems", "them". | EXACT TITLE in transportation_infrastructure: "Supply chain". | EXACT TITLE in faith_religious: "Supply chain".
0.500
administrationagencyassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalgovernmentinternationalorganizationpersonnelregulatessettingspacestandardstraffic
SHARED TOKENS (21): "administration", "agency", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "government", "international", "organization", "personnel", "regulates", "setting", "space", "standards", "traffic".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
acquiredadditionalallianceextendsformformationhistoryindependentinternationallatermajornetworkoperatesoperatingprincipalregionalroutestarthroughout
SHARED TOKENS (19): "acquired", "additional", "alliance", "extends", "form", "formation", "history", "independent", "international", "later", "major", "network", "operates", "operating", "principal", "regional", "route", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Social work ↗ Q205398 EXACT TITLE
academicadministrationadvocacyagenciesbecomecommunitiescommunityconcernsdevelopeddevelopmentdirectlyeducationengagegovernmentgrouphealthindividualsindustriallaborlarger
SHARED TOKENS (41): "academic", "administration", "advocacy", "agencies", "become", "communities", "community", "concerns", "developed", "development", "directly", "education", "engage", "government", "group", "health", "individuals", "industrial", "labor", "larger".... | EXACT TITLE in faith_religious: "Social work".
0.500
behavioralcareclassesclinicalcredentialededucationgrouphealthcarehistoryhospitalintegrationorganizationsothersplacepracticeprimaryproviderssettingsmallstandard
SHARED TOKENS (25): "behavioral", "care", "classes", "clinical", "credentialed", "education", "group", "healthcare", "history", "hospital", "integration", "organizations", "others", "place", "practice", "primary", "providers", "setting", "small", "standard".... | EXACT TITLE in faith_religious: "Clinical pastoral education".
0.500
accordingauthoritybuiltcurrentdedicateddescribeddistincteasternestablishedfoundedgrowthhealthhistoricalhistoryindependentinternationallargelargerlaterlaws
SHARED TOKENS (46): "according", "authority", "built", "current", "dedicated", "described", "distinct", "eastern", "established", "founded", "growth", "health", "historical", "history", "independent", "international", "large", "larger", "later", "laws".... | EXACT TITLE in faith_religious: "The Church of Jesus Christ of Latter-day Saints".
0.500
accordingapproximatelycentercentralcreatedecemberdesignedformerfoundedgeneralgroupidentifiedjanuarylargermajormembershipmissionorganizationpercentpopulation
SHARED TOKENS (26): "according", "approximately", "center", "central", "create", "december", "designed", "former", "founded", "general", "group", "identified", "january", "larger", "major", "membership", "mission", "organization", "percent", "population".... | EXACT TITLE in faith_religious: "United Methodist Church".
0.500
authoritybuildingsestategoverninggovernmentjurisdictionjurisdictionslandmultiplenationalpropertyrealregionrequiressystemtaxtransactiontransferwhose
SHARED TOKENS (19): "authority", "buildings", "estate", "governing", "government", "jurisdiction", "jurisdictions", "land", "multiple", "national", "property", "real", "region", "requires", "system", "tax", "transaction", "transfer", "whose". | EXACT TITLE in transportation_infrastructure: "Property tax". | EXACT TITLE in faith_religious: "Property tax".
0.500
actagainstapplicationapplycodifieddivisionemploymentenforcementfederalfreegeneralgovernmentgovernmentshouselawlawslocalnearlyprovidingrequires
SHARED TOKENS (22): "act", "against", "application", "apply", "codified", "division", "employment", "enforcement", "federal", "free", "general", "government", "governments", "house", "law", "laws", "local", "nearly", "providing", "requires".... | EXACT TITLE in faith_religious: "Religious Freedom Restoration Act".
0.500
Quakers ↗ Q170208 EXACT TITLE
acquiredadoptedamericanauthoritycontextdedicationdevelopeddirectespeciallyestablishedfinancialfocusedformfoundedhistoricallyidentifyindependentinstitutionslightmultiple
SHARED TOKENS (35): "acquired", "adopted", "american", "authority", "context", "dedication", "developed", "direct", "especially", "established", "financial", "focused", "form", "founded", "historically", "identify", "independent", "institutions", "light", "multiple".... | EXACT TITLE in faith_religious: "Quakers".
0.500
accessibilityagenciesagencyamericanbusinessesconditionscoordinationcurrentdatadepartmentessentialfederalgovernmentgovernmentshighlaborlocalmajormanagementneed
SHARED TOKENS (29): "accessibility", "agencies", "agency", "american", "businesses", "conditions", "coordination", "current", "data", "department", "essential", "federal", "government", "governments", "high", "labor", "local", "major", "management", "need".... | EXACT TITLE in faith_religious: "Bureau of Labor Statistics".
0.500
administrationagencyapproximatelyauthoritycertaincombinedcreateddatadepartmentenforcementfacilitiesfederalgovernmentlawlocalmissionoperatedpartnerspersonnelpipelines
SHARED TOKENS (31): "administration", "agency", "approximately", "authority", "certain", "combined", "created", "data", "department", "enforcement", "facilities", "federal", "government", "law", "local", "mission", "operated", "partners", "personnel", "pipelines".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherarmycivildedicatedfacilityfoodinformationlogisticsmaintainingmanagementmaterialmaterialsmilitarymodelmovingneedsoperationalphysicalplanning
SHARED TOKENS (30): "according", "another", "army", "civil", "dedicated", "facility", "food", "information", "logistics", "maintaining", "management", "material", "materials", "military", "model", "moving", "needs", "operational", "physical", "planning".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in faith_religious: "Logistics".
0.500
administrationagenciesagencyassistancedepartmentdistrictexistingfederalfinancialfunctionsgovernmentlightlocalofficeoperateoperatorspeopleprimarilyprogramsproviders
SHARED TOKENS (31): "administration", "agencies", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "government", "light", "local", "office", "operate", "operators", "people", "primarily", "programs", "providers".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
againstconcernsdescribeddifferentdiscriminationemploymentevengrouphousinginstitutionallawlawslegallightpeoplepoliciespublicregulatedremainsthem
SHARED TOKENS (22): "against", "concerns", "described", "different", "discrimination", "employment", "even", "group", "housing", "institutional", "law", "laws", "legal", "light", "people", "policies", "public", "regulated", "remains", "them".... | EXACT TITLE in faith_religious: "Religious discrimination".
0.500
assetsbodybroaderbuildingscapitalcategorycommunityconstructedconstructiondirectlyelectricalemploymentfacilitiesgovernmenthealthhospitalsinfrastructuremunicipaloperatorphysical
SHARED TOKENS (35): "assets", "body", "broader", "buildings", "capital", "category", "community", "constructed", "construction", "directly", "electrical", "employment", "facilities", "government", "health", "hospitals", "infrastructure", "municipal", "operator", "physical".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
academicaccordingagainstdifferentdiscriminationeducationfreegeneralinstructionintendedlawlawsopenoperatingpubliclyseparatestudysupport
SHARED TOKENS (18): "academic", "according", "against", "different", "discrimination", "education", "free", "general", "instruction", "intended", "law", "laws", "open", "operating", "publicly", "separate", "study", "support". | EXACT TITLE in faith_religious: "Religious education".
0.500
approximatelybodyformgeneralgrouphistoricallyindependentjunemaintainsmattersnationalopenparticipationpercentpopulationpracticeresearchsupport
SHARED TOKENS (18): "approximately", "body", "form", "general", "group", "historically", "independent", "june", "maintains", "matters", "national", "open", "participation", "percent", "population", "practice", "research", "support". | EXACT TITLE in faith_religious: "United Church of Christ".
0.500
accessallowingarrangementsassociationcoordinationdesignateddevelopmentestatefinancialfrequentlyfundinggeneralgovernmenthistoricalindustryinfrastructureintegratedintendedinternationalinvestment
SHARED TOKENS (53): "access", "allowing", "arrangements", "association", "coordination", "designated", "development", "estate", "financial", "frequently", "funding", "general", "government", "historical", "industry", "infrastructure", "integrated", "intended", "international", "investment".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
constructioncontextcontroldescribeddesignedfrequentlyfunctionsindustrialinformationinvolvinglaborlargemobileoperationspeopleprimarysourcestructuresystemsuses
SHARED TOKENS (21): "construction", "context", "control", "described", "designed", "frequently", "functions", "industrial", "information", "involving", "labor", "large", "mobile", "operations", "people", "primary", "source", "structure", "systems", "uses".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
articlecontrolscrossdesigndifferentgradeintersectionsjurisdictionsmajormeetpracticeprimarilyroadseparatetrafficuses
SHARED TOKENS (16): "article", "controls", "cross", "design", "different", "grade", "intersections", "jurisdictions", "major", "meet", "practice", "primarily", "road", "separate", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in faith_religious: "Intersection (road)".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcreatingdesignatedhistoricallynetworkpeopleprofessionalrecordruralsafetystreetstraffictransporturbanwider
SHARED TOKENS (16): "american", "associated", "creating", "designated", "historically", "network", "people", "professional", "record", "rural", "safety", "streets", "traffic", "transport", "urban", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.500
departmentfacilitiesfederalidentifiedlocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningrailsafetyservingstationssystemtransporttransportation
SHARED TOKENS (20): "department", "facilities", "federal", "identified", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "rail", "safety", "serving", "stations", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingamericanauthorityboundariescertaincivilconcentratedconsolidatedcountiesdifferentdistrictdistrictsentitiesexistingformformergovernmentgovernmentsindependentlaw
SHARED TOKENS (32): "according", "american", "authority", "boundaries", "certain", "civil", "concentrated", "consolidated", "counties", "different", "district", "districts", "entities", "existing", "form", "former", "government", "governments", "independent", "law".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in faith_religious: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationsconstructiondesignateddevelopmentdigitalenvironmentestablishgovernmenthistorylandlawlegalownershipplanningprofessionalpropertyresearch
SHARED TOKENS (26): "analysis", "boundaries", "civil", "communications", "construction", "designated", "development", "digital", "environment", "establish", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "research".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
certaincompletecontributionscurrentdedicateddifferentfederalfreehomeinternationaljurisdictionliabilitylocalorganizationspropertyprovidequalifyingreducedrulestax
SHARED TOKENS (21): "certain", "complete", "contributions", "current", "dedicated", "different", "federal", "free", "home", "international", "jurisdiction", "liability", "local", "organizations", "property", "provide", "qualifying", "reduced", "rules", "tax".... | EXACT TITLE in faith_religious: "Tax exemption".
0.500
agenciesconsumercreatedenforcemententitiesgeneralidaholawlawslegallimitslocalofficeownershippropertyprovide
SHARED TOKENS (16): "agencies", "consumer", "created", "enforcement", "entities", "general", "idaho", "law", "laws", "legal", "limits", "local", "office", "ownership", "property", "provide". | EXACT TITLE in faith_religious: "Idaho Attorney General".
0.500
adaboisecentercombinedcommercialcommissiondepartmentfacilityfunctionsgeneralidahointernationalmilitarynationaloperatedoperatesreceiverightssupporttimes
SHARED TOKENS (21): "ada", "boise", "center", "combined", "commercial", "commission", "department", "facility", "functions", "general", "idaho", "international", "military", "national", "operated", "operates", "receive", "rights", "support", "times".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
accessibilityadministrationadoptedanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycivilcodescommunicationscommunitiescommunitycreatingdesigndevelopment
SHARED TOKENS (63): "accessibility", "administration", "adopted", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "civil", "codes", "communications", "communities", "community", "creating", "design", "development".... | EXACT TITLE in faith_religious: "Urban planning".
0.500
actadministeradministrationagenciesagencyassistancecivilcorridorcreateddepartmentdevelopmentenforcefederalfinancialgovernmentmanagementnationaloperatespolicyprograms
SHARED TOKENS (29): "act", "administer", "administration", "agencies", "agency", "assistance", "civil", "corridor", "created", "department", "development", "enforce", "federal", "financial", "government", "management", "national", "operates", "policy", "programs".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationapplicationscareclinicalconditionscontinuousdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcarehomeinformation
SHARED TOKENS (42): "access", "administration", "another", "application", "applications", "care", "clinical", "conditions", "continuous", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare", "home", "information".... | EXACT TITLE in faith_religious: "Telehealth".
0.500
actaddressingadministeredagencyarmyassistancecodifiedcontrolcoordinationdirectlyfederalformfundinggoverninggovernmentsinvolvinglawlawsmaintainingmajor
SHARED TOKENS (32): "act", "addressing", "administered", "agency", "army", "assistance", "codified", "control", "coordination", "directly", "federal", "form", "funding", "governing", "governments", "involving", "law", "laws", "maintaining", "major".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbuiltcommunitycomplexconnectionconstructedconstructioncontributionscreatecrossdesigndesignedenvironmentfrequentlyindustrialintendedlocalmajormeetnetwork
SHARED TOKENS (38): "allowing", "built", "community", "complex", "connection", "constructed", "construction", "contributions", "create", "cross", "design", "designed", "environment", "frequently", "industrial", "intended", "local", "major", "meet", "network".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalapplicationappliescentralconditionsconsolidationcontroldevelopeddirectlydistributeddistributionformgrowthhighirrigationlandlandscapemanagementminingnetwork
SHARED TOKENS (37): "agricultural", "application", "applies", "central", "conditions", "consolidation", "control", "developed", "directly", "distributed", "distribution", "form", "growth", "high", "irrigation", "land", "landscape", "management", "mining", "network".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in faith_religious: "Irrigation".
0.500
accessallowingcommunicationsdatadevelopmentdigitalelectricalformindependentinformationmediaphysicalreducedsingletechnologyusers
SHARED TOKENS (16): "access", "allowing", "communications", "data", "development", "digital", "electrical", "form", "independent", "information", "media", "physical", "reduced", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
accessactiveaffectsageagencyagriculturalanotheravailabilitybeyondcreatedevelopmentdisruptionestimatesevenfoodgrowthhealthhighindividualsland
SHARED TOKENS (35): "access", "active", "affects", "age", "agency", "agricultural", "another", "availability", "beyond", "create", "development", "disruption", "estimates", "even", "food", "growth", "health", "high", "individuals", "land".... | EXACT TITLE in faith_religious: "Food security".
0.500
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancefinancialfinancingfirmsfundgeneralinvestmentlimitedmanagementoperationalothersownership
SHARED TOKENS (29): "active", "business", "capital", "category", "control", "described", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "general", "investment", "limited", "management", "operational", "others", "ownership".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
Warehouse ↗ Q181623 EXACT TITLE
associatedbuildingbuildingsbusinessesdesigneddirectlyfacilityfunctionindustriallargematerialsmovingstandardtransportwarehouse
SHARED TOKENS (15): "associated", "building", "buildings", "businesses", "designed", "directly", "facility", "function", "industrial", "large", "materials", "moving", "standard", "transport", "warehouse". | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in faith_religious: "Warehouse".
0.500
agenciesbuildingsbuiltcivilconstructiondepartmentsdesigndistinguishenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysicalpipelines
SHARED TOKENS (26): "agencies", "buildings", "built", "civil", "construction", "departments", "design", "distinguish", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical", "pipelines".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelyboardbusinesscorporationcorridordirectlyfederalfoundedlimitedmetropolitannationalnearlynetworkoperateoperatesoperatororganizationrail
SHARED TOKENS (27): "additional", "american", "approximately", "board", "business", "corporation", "corridor", "directly", "federal", "founded", "limited", "metropolitan", "national", "nearly", "network", "operate", "operates", "operator", "organization", "rail".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicadaboardboisecanyonclassescollegecommunitycomprehensivecountiesdevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprograms
SHARED TOKENS (32): "academic", "ada", "board", "boise", "canyon", "classes", "college", "community", "comprehensive", "counties", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
aloneamericanamongarmycommunityderiveseducationespeciallyestablishesfoundedfoundersfundinggeneralinternationalmajormembershipmilitarymissionnationalneed
SHARED TOKENS (36): "alone", "american", "among", "army", "community", "derives", "education", "especially", "establishes", "founded", "founders", "funding", "general", "international", "major", "membership", "military", "mission", "national", "need".... | EXACT TITLE in faith_religious: "Salvation Army".
0.500
anotherassetcommercialcontrolsdescribedentityeveninternationallawlawslegalownersownershippropertyrecordrightsspecificstatutorythemthough
SHARED TOKENS (22): "another", "asset", "commercial", "controls", "described", "entity", "even", "international", "law", "laws", "legal", "owners", "ownership", "property", "record", "rights", "specific", "statutory", "them", "though".... | EXACT TITLE in faith_religious: "Beneficial ownership".
0.500
americancarecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalhospitalsidaholivingnetworkoperatesoperatingoregonpeoplesupportsystem
SHARED TOKENS (19): "american", "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "living", "network", "operates", "operating", "oregon", "people", "support", "system". | EXACT TITLE in faith_religious: "Trinity Health".
0.500
accessacteducationessentialfederalfederallyfocusedformlawprogramsprovidepublicschoolschoolssecondarysecuritystudentstudentsstudytitle
SHARED TOKENS (20): "access", "act", "education", "essential", "federal", "federally", "focused", "form", "law", "programs", "provide", "public", "school", "schools", "secondary", "security", "student", "students", "study", "title". | EXACT TITLE in faith_religious: "Equal Access Act".
0.500
agenciesapplybusinessescomprehensivedesignfacilitiesgovernmentinfluenceneedspeopleplanningpoliciesprivateprocesspublicsitingstreetssystemtransporttransportation
SHARED TOKENS (20): "agencies", "apply", "businesses", "comprehensive", "design", "facilities", "government", "influence", "needs", "people", "planning", "policies", "private", "process", "public", "siting", "streets", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
Chaplain ↗ Q208762 EXACT TITLE
adultsbuildingscodedepartmentdistinguishfacilityforceshealthcarehospitalsinstitutionsitselflawmilitarynameneedofficialolderpeopleprofessionalrole
SHARED TOKENS (31): "adults", "buildings", "code", "department", "distinguish", "facility", "forces", "healthcare", "hospitals", "institutions", "itself", "law", "military", "name", "need", "official", "older", "people", "professional", "role".... | EXACT TITLE in faith_religious: "Chaplain".
0.500
accessagenciesbeyondcommunitydesigneddevelopeddisabilitiesextendsformgovernmentlocalmetropolitanoperateoperatedoperatesoperatorsorganizationspeopleprivateprovide
SHARED TOKENS (32): "access", "agencies", "beyond", "community", "designed", "developed", "disabilities", "extends", "form", "government", "local", "metropolitan", "operate", "operated", "operates", "operators", "organizations", "people", "private", "provide".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
administrationagencydepartmentdivisionfederalmajorofficepreviouslyprogramprogramspublicroadroletransportation
SHARED TOKENS (14): "administration", "agency", "department", "division", "federal", "major", "office", "previously", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.460
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalhighintegratednetworkproviderequirementstechnologytransferuses
SHARED TOKENS (13): "access", "context", "data", "different", "digital", "high", "integrated", "network", "provide", "requirements", "technology", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.460
americancrossgradepermitroadroutesstandardstreetssystemthoughtraffictransportuses
SHARED TOKENS (13): "american", "cross", "grade", "permit", "road", "routes", "standard", "streets", "system", "though", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)". | EXACT TITLE in faith_religious: "Interchange (road)".
0.460
boisedenvereasternexpansionformeridahooperatingoregonrailrestorationroutesaltthough
SHARED TOKENS (13): "boise", "denver", "eastern", "expansion", "former", "idaho", "operating", "oregon", "rail", "restoration", "route", "salt", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.450
actagencyaggregatecapacityclassescorporationdifferententityformfunctiongovernmentincorporatedlawlawsneednonprofitofficialorganizationpermittedproperty
SHARED TOKENS (25): "act", "agency", "aggregate", "capacity", "classes", "corporation", "different", "entity", "form", "function", "government", "incorporated", "law", "laws", "need", "nonprofit", "official", "organization", "permitted", "property".... | URL->B (1): https://www.irs.gov/charities-non-profits/churches-integrated-auxiliaries-and-conventions-or-associations-of-churches.
0.450
boisecollegeidahonearprivate
SHARED TOKENS (5): "boise", "college", "idaho", "near", "private". | URL->B (1): https://www.boisebible.edu/. | EXACT TITLE in faith_religious: "Boise Bible College".
0.450
boiseidahojurisdictionmetropolitanwhose
SHARED TOKENS (5): "boise", "idaho", "jurisdiction", "metropolitan", "whose". | URL->B (1): https://www.boisecathedral.org/. | EXACT TITLE in faith_religious: "Diocese of Boise".
0.450
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | URL->B (1): https://nnu.edu/. | EXACT TITLE in faith_religious: "Northwest Nazarene University".
0.440
Floodplain ↗ Q193110 EXACT TITLE
adjacentagriculturalbodycontroldevelopedfrequentlyhighlandnearriverurbanvalley
SHARED TOKENS (12): "adjacent", "agricultural", "body", "control", "developed", "frequently", "high", "land", "near", "river", "urban", "valley". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.440
alreadyanotherfinancialgrowthpeopleplanningpracticepracticesprocessrelationshipschoolsseeking
SHARED TOKENS (12): "already", "another", "financial", "growth", "people", "planning", "practice", "practices", "process", "relationship", "schools", "seeking". | EXACT TITLE in faith_religious: "Spiritual direction".
0.440
academicaccommodationdefinesdisabilitiesdiscriminationlawneedothersphysicalrightssystemthem
SHARED TOKENS (12): "academic", "accommodation", "defines", "disabilities", "discrimination", "law", "need", "others", "physical", "rights", "system", "them". | EXACT TITLE in faith_religious: "Reasonable accommodation".
0.420
Utility ↗ Q466707 EXACT TITLE
amongcertaincontextdevelopeddistinctfunctionfunctionsmaintainingmeasurerelationshipsource
SHARED TOKENS (11): "among", "certain", "context", "developed", "distinct", "function", "functions", "maintaining", "measure", "relationship", "source". | EXACT TITLE in transportation_infrastructure: "Utility".
0.420
Rabbi ↗ Q133485 EXACT TITLE
anothercommunitydevelopeddifferentformhistorylawsoverlappingrequirementsstudytitle
SHARED TOKENS (11): "another", "community", "developed", "different", "form", "history", "laws", "overlapping", "requirements", "study", "title". | EXACT TITLE in faith_religious: "Rabbi".
0.420
Sales tax ↗ Q11055488 EXACT TITLE
bodycertainconsumerdirectlyeducationfoodgoverninglawsprovidesalestax
SHARED TOKENS (11): "body", "certain", "consumer", "directly", "education", "food", "governing", "laws", "provide", "sales", "tax". | EXACT TITLE in transportation_infrastructure: "Sales tax".
0.420
Snowplow ↗ Q14976 EXACT TITLE
clearespeciallyfrequentlyintendedlargerailreceiveservingspecificstreetstransportation
SHARED TOKENS (11): "clear", "especially", "frequently", "intended", "large", "rail", "receive", "serving", "specific", "streets", "transportation". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
announcedarchitectureconstructiondesigndesignedgeneralidahomeridianpartnershipschool
SHARED TOKENS (10): "announced", "architecture", "construction", "design", "designed", "general", "idaho", "meridian", "partnership", "school". | EXACT TITLE in faith_religious: "Meridian Idaho Temple".
0.400
authoritycommunitiescreatedeasternformerhistoryinsidejurisdictionmetropolitanprimary
SHARED TOKENS (10): "authority", "communities", "created", "eastern", "former", "history", "inside", "jurisdiction", "metropolitan", "primary". | EXACT TITLE in faith_religious: "Russian Orthodox Church".
0.380
Imam ↗ Q125482 EXACT TITLE
applicablebecomecommunitycontextfoundedprovidestudytimestitle
SHARED TOKENS (9): "applicable", "become", "community", "context", "founded", "provide", "study", "times", "title". | EXACT TITLE in faith_religious: "Imam".
0.380
careframeworkhealthcaremodeloperatesproviderprovidingspecificsupport
SHARED TOKENS (9): "care", "framework", "healthcare", "model", "operates", "provider", "providing", "specific", "support". | EXACT TITLE in faith_religious: "Pastoral care".
0.380
Sidewalk ↗ Q177749 EXACT TITLE
adjacentamericanbuildingsdesignedlandprimarilyprivateroadstreet
SHARED TOKENS (9): "adjacent", "american", "buildings", "designed", "land", "primarily", "private", "road", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.360
accordingassociationdistinctinternationallicensedsolelysourcetherefore
SHARED TOKENS (8): "according", "association", "distinct", "international", "licensed", "solely", "source", "therefore". | EXACT TITLE in faith_religious: "Christian counseling".
0.340
announcedboisebuiltconstructeddedicatedidahooperating
SHARED TOKENS (7): "announced", "boise", "built", "constructed", "dedicated", "idaho", "operating". | EXACT TITLE in faith_religious: "Boise Idaho Temple".
0.340
Clergy ↗ Q177826 EXACT TITLE
differentestablishedfunctionshistorylongpracticesspecific
SHARED TOKENS (7): "different", "established", "functions", "history", "long", "practices", "specific". | EXACT TITLE in faith_religious: "Clergy".
0.340
buildingsbuiltdevelopmentenvironmenthistoricalmaintainspreservation
SHARED TOKENS (7): "buildings", "built", "development", "environment", "historical", "maintains", "preservation". | EXACT TITLE in faith_religious: "Historic preservation".
0.340
concernsconventionalhealthpractitionersprovidesupporttraining
SHARED TOKENS (7): "concerns", "conventional", "health", "practitioners", "provide", "support", "training". | EXACT TITLE in faith_religious: "Pastoral counseling".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverurban
SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "river", "urban". | EXACT TITLE in transportation_infrastructure: "Boise River". | EXACT TITLE in faith_religious: "Boise River".
0.300
accordingactamericanamericanscenterciviccommunityeducationengageestimatesformergroupgrowthhighidentifyinstituteintegrationlargelargerlegal
SHARED TOKENS (39): "according", "act", "american", "americans", "center", "civic", "community", "education", "engage", "estimates", "former", "group", "growth", "high", "identify", "institute", "integration", "large", "larger", "legal"....
0.300
accessdirectespeciallygeneralgroupintendedinternationalitselflogisticslongmaterialmovingoperatingpracticepracticesrailregionspecializedtransporttransportation
SHARED TOKENS (20): "access", "direct", "especially", "general", "group", "intended", "international", "itself", "logistics", "long", "material", "moving", "operating", "practice", "practices", "rail", "region", "specialized", "transport", "transportation".
0.300
actadministrationagainstamericancivilcreateddiscriminationeasternestablishedfederalhistoryindividualslawlegalmakingnationalpeoplepermanentpolicyresidents
SHARED TOKENS (25): "act", "administration", "against", "american", "civil", "created", "discrimination", "eastern", "established", "federal", "history", "individuals", "law", "legal", "making", "national", "people", "permanent", "policy", "residents"....
0.300
accessaccordingallowingamericansannualassociationcannotdepartmentdevelopmentemergingevenfoodhealthhighhistoricallyhomehousingindividualsindustryissue
SHARED TOKENS (48): "access", "according", "allowing", "americans", "annual", "association", "cannot", "department", "development", "emerging", "even", "food", "health", "high", "historically", "home", "housing", "individuals", "industry", "issue"....
0.300
agencycenterscommunityconditionscreateemergencyhousingindividualsmanagementoperateoperatedpeoplepopulationsproblemsprovideresidentssafetysimultaneouslyspecificsystems
SHARED TOKENS (20): "agency", "centers", "community", "conditions", "create", "emergency", "housing", "individuals", "management", "operate", "operated", "people", "populations", "problems", "provide", "residents", "safety", "simultaneously", "specific", "systems".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialdensedensitydescribeddevelopmentenvironmentexistingexpansionformgrowthhousingindustrialinfrastructurelacklandlarge
SHARED TOKENS (41): "agency", "associated", "become", "building", "commercial", "dense", "density", "described", "development", "environment", "existing", "expansion", "form", "growth", "housing", "industrial", "infrastructure", "lack", "land", "large"....
0.300
American Jews ↗ Q678551 KW CROSS HIGH
accordingadditionaladultsamericanamericansapproximatelycategorycommunitiescommunitydatadefinitionsidentifylawpeoplepopulationrepresentedresearchsmall
SHARED TOKENS (18): "according", "additional", "adults", "american", "americans", "approximately", "category", "communities", "community", "data", "definitions", "identify", "law", "people", "population", "represented", "research", "small".
0.300
Cremation ↗ Q207315 EXACT TITLE
bodyhealthremainssitetimes
SHARED TOKENS (5): "body", "health", "remains", "site", "times". | EXACT TITLE in faith_religious: "Cremation".
0.300
americananotherbecomecontrolestablishingfederalformfreegovernmentgovernmentsinterpretationlaterlawlimitsofficialpracticepracticesprohibitsrightssecurity
SHARED TOKENS (23): "american", "another", "become", "control", "establishing", "federal", "form", "free", "government", "governments", "interpretation", "later", "law", "limits", "official", "practice", "practices", "prohibits", "rights", "security"....
0.300
activitycommissioncommunitieseasternfoundedhistoryindependentinstitutionsnationalprimarilyprimaryregionrolesharedwest
SHARED TOKENS (15): "activity", "commission", "communities", "eastern", "founded", "history", "independent", "institutions", "national", "primarily", "primary", "region", "role", "shared", "west".
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalconditionsdeterminedigitalindependentmaintenanceneedsothersproblemproposedroleshowingspecificwork
SHARED TOKENS (15): "already", "approval", "conditions", "determine", "digital", "independent", "maintenance", "needs", "others", "problem", "proposed", "role", "showing", "specific", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentralcomesdesigndriverenvironmentintegrationintersectionsneedotherspermittedreducedrequireresearchresultingroadrulessafetysignificant
SHARED TOKENS (24): "associated", "become", "central", "comes", "design", "driver", "environment", "integration", "intersections", "need", "others", "permitted", "reduced", "require", "research", "resulting", "road", "rules", "safety", "significant"....
0.300
actamericanapplicationarticleauthoritycivildifferentdiscriminationemploymentenforcehistoryhousejunelaborlaterlawlawsnationalprohibitsproposed
SHARED TOKENS (27): "act", "american", "application", "article", "authority", "civil", "different", "discrimination", "employment", "enforce", "history", "house", "june", "labor", "later", "law", "laws", "national", "prohibits", "proposed"....
0.300
accordingcreatingdemanddisabilityformfunctionsmedicalmobileneedsnetworkolderpeopleprivateprogramsprovidepublicratherrelevantrouteroutes
SHARED TOKENS (25): "according", "creating", "demand", "disability", "form", "functions", "medical", "mobile", "needs", "network", "older", "people", "private", "programs", "provide", "public", "rather", "relevant", "route", "routes"....
0.300
activityamongapproximatelyauthoritybecomebodycentralcommissioncommunitieseasternespeciallyestablishedformergovernedgrouphistoryinstitutionsjurisdictionallocalmaintains
SHARED TOKENS (34): "activity", "among", "approximately", "authority", "become", "body", "central", "commission", "communities", "eastern", "especially", "established", "former", "governed", "group", "history", "institutions", "jurisdictional", "local", "maintains"....
0.300
Ecumenism ↗ Q156112 KW CROSS HIGH
adoptedallianceamongcentralcommunitydifferenteasternespeciallyestablishfoundedhistoricallyjurisdictionslargerlivinglocalmajornationalofficialotherspresent
SHARED TOKENS (31): "adopted", "alliance", "among", "central", "community", "different", "eastern", "especially", "establish", "founded", "historically", "jurisdictions", "larger", "living", "local", "major", "national", "official", "others", "present"....
0.300
actagainstamericanarticleassociationauthoritativeboardbuildingeducationestablishedfreefunctiongardengovernmentinstitutionsintendeditselfjanuarylacklaw
SHARED TOKENS (33): "act", "against", "american", "article", "association", "authoritative", "board", "building", "education", "established", "free", "function", "garden", "government", "institutions", "intended", "itself", "january", "lack", "law"....
0.300
accordingadultsagainstamericansamongbeyondcenterconnectioneducationengageestablishedforcesgrowthhighhistoricalidentifyinstituteinstitutionslacklegal
SHARED TOKENS (31): "according", "adults", "against", "americans", "among", "beyond", "center", "connection", "education", "engage", "established", "forces", "growth", "high", "historical", "identify", "institute", "institutions", "lack", "legal"....
0.300
accordingactivitycertaincommunitiesdecemberdifferentdistincteasternfreegenerallivingnameofficeoncepermitrulessharedspecifictitlewomen
SHARED TOKENS (20): "according", "activity", "certain", "communities", "december", "different", "distinct", "eastern", "free", "general", "living", "name", "office", "once", "permit", "rules", "shared", "specific", "title", "women".
0.300
americanbuiltbusinessescenterscentraldevelopmentdriveexpansionformationgrowinggrowthmodelpatternspopulationpopulationsprocessresidentsruralurban
SHARED TOKENS (19): "american", "built", "businesses", "centers", "central", "development", "drive", "expansion", "formation", "growing", "growth", "model", "patterns", "population", "populations", "process", "residents", "rural", "urban".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcommunitiesdifferentdistrictshourinsidemetropolitanmultipleoperateoperatespricingprimarilyrailregionalsystemstransporturban
SHARED TOKENS (18): "business", "central", "communities", "different", "districts", "hour", "inside", "metropolitan", "multiple", "operate", "operates", "pricing", "primarily", "rail", "regional", "systems", "transport", "urban".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
classescontroldriverenforcementeventhealthidentifiedoccupationalpracticesproduceprovidingpublicremainroadruralsafesafetyspecificstandardssystem
SHARED TOKENS (24): "classes", "control", "driver", "enforcement", "event", "health", "identified", "occupational", "practices", "produce", "providing", "public", "remain", "road", "rural", "safe", "safety", "specific", "standards", "system"....
0.300
accordingadoptedapplicationcannotexpresslyfederalforcesformfreegovernmentinterpretationinvolvinglaterlawlawslimitspracticepracticesprohibitsprovide
SHARED TOKENS (29): "according", "adopted", "application", "cannot", "expressly", "federal", "forces", "form", "free", "government", "interpretation", "involving", "later", "law", "laws", "limits", "practice", "practices", "prohibits", "provide"....
0.300
buildingbusinesscentercentraldedicateddensedesigneddevelopmentformgrowthintegratedlandlightnetworkplanningprivateproblempublicrailrelationship
SHARED TOKENS (26): "building", "business", "center", "central", "dedicated", "dense", "designed", "development", "form", "growth", "integrated", "land", "light", "network", "planning", "private", "problem", "public", "rail", "relationship"....
0.300
Evangelicalism ↗ Q194253 KW CROSS HIGH
allianceamongauthoritybodiescentralcommunitydescribedespeciallyfreegeneralgrouphistoricallymakingmattersnewsplacespopulationpracticepracticesscope
SHARED TOKENS (22): "alliance", "among", "authority", "bodies", "central", "community", "described", "especially", "free", "general", "group", "historically", "making", "matters", "news", "places", "population", "practice", "practices", "scope"....
0.300
associationcollegeconnectionsexpandedidentifiesindependentinternationallocalmaintainingmaintainsnetworkoperatespracticesprogramsremainsstations
SHARED TOKENS (16): "association", "college", "connections", "expanded", "identifies", "independent", "international", "local", "maintaining", "maintains", "network", "operates", "practices", "programs", "remains", "stations".
0.300
accessibleadministrationageagencyamericananotherbuildingcenterscommercialconstructiondepartmentdistributiondivisiondrivedrivereconomyeducationfederalgoverninggoverns
SHARED TOKENS (47): "accessible", "administration", "age", "agency", "american", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "drive", "driver", "economy", "education", "federal", "governing", "governs"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycertaincreatedcrossdifferentestatefacilitygovernmentlandlegallocaloperateownershippeoplephysicalprivaterealrightsroadroute
SHARED TOKENS (25): "authority", "certain", "created", "cross", "different", "estate", "facility", "government", "land", "legal", "local", "operate", "ownership", "people", "physical", "private", "real", "rights", "road", "route"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomecommunitiescreatecreatescurrentdescribesdevelopeddevelopmenteducationessentialgeographygrowthhealthinstitutionalinternationallacklandlarger
SHARED TOKENS (46): "approximately", "architecture", "become", "communities", "create", "creates", "current", "describes", "developed", "development", "education", "essential", "geography", "growth", "health", "institutional", "international", "lack", "land", "larger"....
0.300
accordingadultsamericanamericansamongapproximatelycategorycentercommunitiesdifferenteasternestimatesformgeneralidentifiedidentifyidentifyinginstituteitselflandscape
SHARED TOKENS (32): "according", "adults", "american", "americans", "among", "approximately", "category", "center", "communities", "different", "eastern", "estimates", "form", "general", "identified", "identify", "identifying", "institute", "itself", "landscape"....
0.300
anotherarticlebecomecapacitydemanddensitydepartmentsengagehighintersectionsmodeledplanningpublicresultingroadroutetimestraffictransporttransportation
SHARED TOKENS (21): "another", "article", "become", "capacity", "demand", "density", "departments", "engage", "high", "intersections", "modeled", "planning", "public", "resulting", "road", "route", "times", "traffic", "transport", "transportation"....
0.300
americancapacitycapitalconventionaldedicateddesigndesignedintersectionslightnetworkpublicrailsinglesystemsystemstraffictransportation
SHARED TOKENS (17): "american", "capacity", "capital", "conventional", "dedicated", "design", "designed", "intersections", "light", "network", "public", "rail", "single", "system", "systems", "traffic", "transportation".
0.300
americanbodycivilcommissioncontinuouscontrolessentialhistoryindependentinterpretationlocalmembershipmissionsorganizationparticipationpracticepresentpublicreportedrequirement
SHARED TOKENS (25): "american", "body", "civil", "commission", "continuous", "control", "essential", "history", "independent", "interpretation", "local", "membership", "missions", "organization", "participation", "practice", "present", "public", "reported", "requirement"....
0.300
adoptedadvancedapplicationcapacityconditionsdifferentemergencyenforceinformationinfrastructurelawsmanagementprovideroadsafetysystemsystemstechnologytimestraffic
SHARED TOKENS (23): "adopted", "advanced", "application", "capacity", "conditions", "different", "emergency", "enforce", "information", "infrastructure", "laws", "management", "provide", "road", "safety", "system", "systems", "technology", "times", "traffic"....
0.300
aggregateconflictscreatingdepartmentdesignateddesigneddifferentevenpathwaypermitprimaryproviderailroutesharedtransporturbanusers
SHARED TOKENS (18): "aggregate", "conflicts", "creating", "department", "designated", "designed", "different", "even", "pathway", "permit", "primary", "provide", "rail", "route", "shared", "transport", "urban", "users".
0.300
accordingactadditionalagainstagencyamericanapproximatelyassistancebodycarecivilcodecollectingcreateddepartmentenforcementfederalfundfundinggovernment
SHARED TOKENS (44): "according", "act", "additional", "against", "agency", "american", "approximately", "assistance", "body", "care", "civil", "code", "collecting", "created", "department", "enforcement", "federal", "fund", "funding", "government"....
0.300
americanassistancecombinedcreatedcrossdesignateddriverespeciallyevenfacilitiesintersectionsjurisdictionslargelawsplaceroadrulessafetyschoolseparate
SHARED TOKENS (24): "american", "assistance", "combined", "created", "cross", "designated", "driver", "especially", "even", "facilities", "intersections", "jurisdictions", "large", "laws", "place", "road", "rules", "safety", "school", "separate"....
0.300
appliesapprovalassociationcontextdefinesdevelopmentdocumentationgovernedidentifyingindividualsinternationallightmajormakingmanagementparticipationpoliciespolicyprocessprogram
SHARED TOKENS (30): "applies", "approval", "association", "context", "defines", "development", "documentation", "governed", "identifying", "individuals", "international", "light", "major", "making", "management", "participation", "policies", "policy", "process", "program"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcertaincombinedcommissionconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentities
SHARED TOKENS (43): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "certain", "combined", "commission", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities"....
0.300
accessadvancedamericanbuiltcapacitycentralconflictsconnectconnectedconstructedcontainingdesignedevenfreeimpliesintersectionslimitslongnetworkopened
SHARED TOKENS (35): "access", "advanced", "american", "built", "capacity", "central", "conflicts", "connect", "connected", "constructed", "containing", "designed", "even", "free", "implies", "intersections", "limits", "long", "network", "opened"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasterngeneralidahomajornationalnearnorthwestofficialoregonriverroadrouterulesthroughoutwest
SHARED TOKENS (16): "caldwell", "eastern", "general", "idaho", "major", "national", "near", "northwest", "official", "oregon", "river", "road", "route", "rules", "throughout", "west".
0.300
agencydecemberdepartmenteducationenforcementestablishingfederalfederallyfinancialgovernmentgovernmentshouseindependentinformationjanuarylawslegallocalmaintainingmatters
SHARED TOKENS (30): "agency", "december", "department", "education", "enforcement", "establishing", "federal", "federally", "financial", "government", "governments", "house", "independent", "information", "january", "laws", "legal", "local", "maintaining", "matters"....
0.300
administrationagencyamericanassistancecentersdepartmentdisabilityeducationemergencyestablishedexpandedfacilitiesfederalgovernmenthealthcarehomeinsurancejuneliabilitymedical
SHARED TOKENS (28): "administration", "agency", "american", "assistance", "centers", "department", "disability", "education", "emergency", "established", "expanded", "facilities", "federal", "government", "healthcare", "home", "insurance", "june", "liability", "medical"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancingfoundedgovernmenthomehousehousinglawspoliciesprogramreportssocietyurban
SHARED TOKENS (19): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "founded", "government", "home", "house", "housing", "laws", "policies", "program", "reports", "society", "urban".
0.300
adoptedagainstagenciesappliesarticleassociationcivildecemberexpandedfinancefoundersfreefrequentlygovernmentinformationlawsmakingmedianearplace
SHARED TOKENS (29): "adopted", "against", "agencies", "applies", "article", "association", "civil", "december", "expanded", "finance", "founders", "free", "frequently", "government", "information", "laws", "making", "media", "near", "place"....
0.300
actamericanapplicableappliescivilcodeconcerningdevelopmentdifferentdisabilitiesdiscriminationenforcementexpandedfederalfinancingfundinghousinglawnationalpeople
SHARED TOKENS (28): "act", "american", "applicable", "applies", "civil", "code", "concerning", "development", "different", "disabilities", "discrimination", "enforcement", "expanded", "federal", "financing", "funding", "housing", "law", "national", "people"....
0.300
additionalallianceamericanarmyassistanceassociationbecomecivilcommunitiesconcentratedfinancialformerfoundedgeneralgovernmentgrowthhistoryhospitalsidentifiesincorporated
SHARED TOKENS (40): "additional", "alliance", "american", "army", "assistance", "association", "become", "civil", "communities", "concentrated", "financial", "former", "founded", "general", "government", "growth", "history", "hospitals", "identifies", "incorporated"....
0.300
combinedconnectscurrentdeliverydirectdirectlydistinctdistributioneasternelectricalevenformhandlinghistoricallyindustrylocallongmajormarketnetwork
SHARED TOKENS (25): "combined", "connects", "current", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electrical", "even", "form", "handling", "historically", "industry", "local", "long", "major", "market", "network"....
0.300
accessibilityactadaagainstamericansbusinesscivilcoalitiondisabilitiesdisabilitydiscriminationemployershouseindividualsjanuarylaterlawnationalprohibitsprotections
SHARED TOKENS (26): "accessibility", "act", "ada", "against", "americans", "business", "civil", "coalition", "disabilities", "disability", "discrimination", "employers", "house", "individuals", "january", "later", "law", "national", "prohibits", "protections"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontroldecemberinformationintersectionslawslightlocalnationalneedroadsystemsystemstechnologytrafficusers
SHARED TOKENS (17): "advanced", "capacity", "control", "december", "information", "intersections", "laws", "light", "local", "national", "need", "road", "system", "systems", "technology", "traffic", "users".
0.300
buildingcertainconditionscontainingcreatesenvironmentevenhealthmaterialspeoplepersonnelphysicalpropertypublicregulationsriskssafetyspecificsystemthem
SHARED TOKENS (22): "building", "certain", "conditions", "containing", "creates", "environment", "even", "health", "materials", "people", "personnel", "physical", "property", "public", "regulations", "risks", "safety", "specific", "system", "them"....
0.300
announcedcentercorporationcreatedenverfoundeditselflaternetworkoperatesoperatingprincipalprojectrailreachreportingroadrouteroutessystem
SHARED TOKENS (22): "announced", "center", "corporation", "create", "denver", "founded", "itself", "later", "network", "operates", "operating", "principal", "project", "rail", "reach", "reporting", "road", "route", "routes", "system"....
0.300
accessactadditionaladministrationadoptedapproximatelybuiltcompleteconstructioncreatingdensedesigndesigneddevelopedestablishedexpandextendsfederalfundfunding
SHARED TOKENS (47): "access", "act", "additional", "administration", "adopted", "approximately", "built", "complete", "construction", "creating", "dense", "design", "designed", "developed", "established", "expand", "extends", "federal", "fund", "funding"....
0.300
accordingactactiveadoptedageamericanamericansamongbecomecentralcollegecommunitydevelopedformerhistoricallyinfluencelocalnationalnearlypolicies
SHARED TOKENS (27): "according", "act", "active", "adopted", "age", "american", "americans", "among", "become", "central", "college", "community", "developed", "former", "historically", "influence", "local", "national", "nearly", "policies"....
0.300
accordingamericanamongarchitecturecentralcommunitiescomplexdevelopeddifferentestimatesgovernmentshistoricallyidentifyindividualsirrigationknowledgeminingneedsofficialorganization
SHARED TOKENS (33): "according", "american", "among", "architecture", "central", "communities", "complex", "developed", "different", "estimates", "governments", "historically", "identify", "individuals", "irrigation", "knowledge", "mining", "needs", "official", "organization"....
0.300
actadministeragainstageagencycannotcivilcommissiondisabilitydiscriminationemployersemploymentenforceestablishedfederalgovernmentinformationinvestigateslawsnational
SHARED TOKENS (22): "act", "administer", "against", "age", "agency", "cannot", "civil", "commission", "disability", "discrimination", "employers", "employment", "enforce", "established", "federal", "government", "information", "investigates", "laws", "national"....
0.300
accordingactivityanalysisboundariesdesigndocumentationenvironmentestablishedgeneralgovernmentjurisdictionslegallicenselicensedlicensurelocalmaintenancepracticepractitionersprocess
SHARED TOKENS (37): "according", "activity", "analysis", "boundaries", "design", "documentation", "environment", "established", "general", "government", "jurisdictions", "legal", "license", "licensed", "licensure", "local", "maintenance", "practice", "practitioners", "process"....
0.300
academiccollegecommunitydifferenteducationformhighinstitutionsopenpolicyprogramsschoolsecondarystudentstransferuniversityworkforce
SHARED TOKENS (17): "academic", "college", "community", "different", "education", "form", "high", "institutions", "open", "policy", "programs", "school", "secondary", "students", "transfer", "university", "workforce".
0.300
americanamericansassistancebuildingcareeducationevenformfoundersfreegovernmenthistoryissuelaterlawlimitedlivingmajormedicalmilitary
SHARED TOKENS (34): "american", "americans", "assistance", "building", "care", "education", "even", "form", "founders", "free", "government", "history", "issue", "later", "law", "limited", "living", "major", "medical", "military"....
0.300
associatedcomplexdemandemergencygovernmenthomehousingindexlocalmarketsnationalothersownershipresponsesupply
SHARED TOKENS (15): "associated", "complex", "demand", "emergency", "government", "home", "housing", "index", "local", "markets", "national", "others", "ownership", "response", "supply".
0.300
actactiveadministeredagenciesapproximatelyarmyauthorityauthorizedbuildingbusinesscapacitycivilcombinedconstructioncontroldepartmentdesigndirectdirectlyeconomy
SHARED TOKENS (63): "act", "active", "administered", "agencies", "approximately", "army", "authority", "authorized", "building", "business", "capacity", "civil", "combined", "construction", "control", "department", "design", "direct", "directly", "economy"....
0.300
civilinvolvingnetworktraffictransportation
SHARED TOKENS (5): "civil", "involving", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
actalreadyarticlebeyondcreatedestablishedexistenceexistingfederalgovernmentincorporatedjunelandmechanismnorthwestoperationsordinancepeoplepopulationprocess
SHARED TOKENS (23): "act", "already", "article", "beyond", "created", "established", "existence", "existing", "federal", "government", "incorporated", "june", "land", "mechanism", "northwest", "operations", "ordinance", "people", "population", "process"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedbuildingsconnectdevelopmentevenexpandedfeefunctionsgovernmentjurisdictionslandlaterlegalonceownersownershipprivate
SHARED TOKENS (28): "acquisition", "another", "application", "authorized", "buildings", "connect", "development", "even", "expanded", "fee", "functions", "government", "jurisdictions", "land", "later", "legal", "once", "owners", "ownership", "private"....
0.300
Cemetery ↗ Q39614 KW CROSS HIGH
accordinganotherdesignatedgardenimplieslandlongpeopleplacepracticespreviouslyprimarilyprincipalremainsspace
SHARED TOKENS (15): "according", "another", "designated", "garden", "implies", "land", "long", "people", "place", "practices", "previously", "primarily", "principal", "remains", "space".
0.300
additionaladvancedagenciesbusinessescarecertaincontactdepartmentdriveemergencyfacilitieshistoricallyhospitalmedicalmodeloperateotherspatientpersonnelplaces
SHARED TOKENS (40): "additional", "advanced", "agencies", "businesses", "care", "certain", "contact", "department", "drive", "emergency", "facilities", "historically", "hospital", "medical", "model", "operate", "others", "patient", "personnel", "places"....
0.300
administrationagenciesamongcommunitiescompliancecontrolcurrentdecemberdefinesdepartmentdesigndesigneddevelopeddocumentfederallawlocalnationalopenparking
SHARED TOKENS (31): "administration", "agencies", "among", "communities", "compliance", "control", "current", "december", "defines", "department", "design", "designed", "developed", "document", "federal", "law", "local", "national", "open", "parking"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotcombinedconnectdesigndesignedeveninfrastructureinsidelargemunicipalparkingpropertypublicreceiverequireresidentialsewersmall
SHARED TOKENS (23): "bodies", "buildings", "cannot", "combined", "connect", "design", "designed", "even", "infrastructure", "inside", "large", "municipal", "parking", "property", "public", "receive", "require", "residential", "sewer", "small"....
0.300
businesscommunitycontributionsentitiesentityfinancefoundershospitalslawslocalmissionnonprofitoperatedoperatesoperationsorganizationorganizationsownersprivateprogram
SHARED TOKENS (26): "business", "community", "contributions", "entities", "entity", "finance", "founders", "hospitals", "laws", "local", "mission", "nonprofit", "operated", "operates", "operations", "organization", "organizations", "owners", "private", "program"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapacityconditionsdefinitionsdifferentformlightlongmultipleoperateoperatesoperatingoperationsprimarilyrailstreetssystemsystemstechnologytogether
SHARED TOKENS (23): "broader", "capacity", "conditions", "definitions", "different", "form", "light", "long", "multiple", "operate", "operates", "operating", "operations", "primarily", "rail", "streets", "system", "systems", "technology", "together"....
0.300
additionalamericancommunitiesespeciallyestablishedexpandedhistoryidentifylandlatermajororganizationsotherspeoplepracticespractitionersrepresented
SHARED TOKENS (17): "additional", "american", "communities", "especially", "established", "expanded", "history", "identify", "land", "later", "major", "organizations", "others", "people", "practices", "practitioners", "represented".
0.300
Faith healing ↗ Q1420463 KW CROSS HIGH
accordingadultsamericanamericansamongbodycaredisabilityespeciallyevenevidencehealthhistorymedicalmultiplepercentphysicalpracticerelationshipsociety
SHARED TOKENS (23): "according", "adults", "american", "americans", "among", "body", "care", "disability", "especially", "even", "evidence", "health", "history", "medical", "multiple", "percent", "physical", "practice", "relationship", "society"....
0.300
accesscommunitycompletedesigndesignedhealthhomelivingoperatedpolicypractitionerspublicrequiressafesafetystreetstraffictransportationurbanusers
SHARED TOKENS (20): "access", "community", "complete", "design", "designed", "health", "home", "living", "operated", "policy", "practitioners", "public", "requires", "safe", "safety", "streets", "traffic", "transportation", "urban", "users".
0.300
addressesaddressingamericanamongannualassociationbodiesbuiltcommunitiescommunityconsolidatedcontributionscountiesdecemberdedicateddirectestablishedestablishinghouseincorporated
SHARED TOKENS (29): "addresses", "addressing", "american", "among", "annual", "association", "bodies", "built", "communities", "community", "consolidated", "contributions", "counties", "december", "dedicated", "direct", "established", "establishing", "house", "incorporated"....
0.300
boisecrossdesignatedhomeidahomajormetropolitannearnorthwestoregonprimarilyriverrouteroutesserves
SHARED TOKENS (15): "boise", "cross", "designated", "home", "idaho", "major", "metropolitan", "near", "northwest", "oregon", "primarily", "river", "route", "routes", "serves".
🫐 BERRY43 edges
0.280
agenciesannouncedfoundedinternationallocalmembershipnamenationalnetworkofficeorganizationorganizationsthroughoutuniversity
SHARED TOKENS (14): "agencies", "announced", "founded", "international", "local", "membership", "name", "national", "network", "office", "organization", "organizations", "throughout", "university".
0.280
alreadybodycentercreateddevelopmentestablishedevenfunctionintegratedlocalnetworkprocessrelationshipseparate
SHARED TOKENS (14): "already", "body", "center", "created", "development", "established", "even", "function", "integrated", "local", "network", "process", "relationship", "separate".
0.280
americanidahojanuaryremains
SHARED TOKENS (4): "american", "idaho", "january", "remains". | EXACT TITLE in faith_religious: "Moses Alexander".
0.280
americandepartmentdepartmentsdirectlyeconomyfederalgovernmentmissionpeoplereportssafeservingsystemtransportation
SHARED TOKENS (14): "american", "department", "departments", "directly", "economy", "federal", "government", "mission", "people", "reports", "safe", "serving", "system", "transportation".
0.280
academicapplicationdesignfacilitiesmanagementoccupationaloperationpeopleplanningprovidesafetechnologytransporttransportation
SHARED TOKENS (14): "academic", "application", "design", "facilities", "management", "occupational", "operation", "people", "planning", "provide", "safe", "technology", "transport", "transportation".
0.280
civilconstructiondesignintersectionsmaintenancematerialsoperationplanningprofessionalstandardsstreetsstructuraltraffictransportation
SHARED TOKENS (14): "civil", "construction", "design", "intersections", "maintenance", "materials", "operation", "planning", "professional", "standards", "streets", "structural", "traffic", "transportation".
0.280
additionalallowingapplicationbecomecoverageeventsmedianearpeopleplatformsprofessionalrealsitesusers
SHARED TOKENS (14): "additional", "allowing", "application", "become", "coverage", "events", "media", "near", "people", "platforms", "professional", "real", "sites", "users".
0.260
businesscarehome
SHARED TOKENS (3): "business", "care", "home". | EXACT TITLE in faith_religious: "Funeral home".
0.260
anotherdifferentformhistoricalopenpolicypublicschoolsinglesocietysourcesupportingsystems
SHARED TOKENS (13): "another", "different", "form", "historical", "open", "policy", "public", "school", "single", "society", "source", "supporting", "systems".
0.260
associatedassociationcertaincommunitiesestablishedexpansionfoundedgovernedindependentmediaothersrestorationspecific
SHARED TOKENS (13): "associated", "association", "certain", "communities", "established", "expansion", "founded", "governed", "independent", "media", "others", "restoration", "specific".
0.260
Volunteering ↗ Q188844 KW CROSS HIGH
actcommunityeducationemergencygrouplaborothersproviderescueresponsespecializedtrainingwork
SHARED TOKENS (13): "act", "community", "education", "emergency", "group", "labor", "others", "provide", "rescue", "response", "specialized", "training", "work".
0.260
Megachurch ↗ Q781549 KW CROSS HIGH
activearchitecturebuildingespeciallyestablishedevenexpandedformergrowinglargemembershiporganizationpeople
SHARED TOKENS (13): "active", "architecture", "building", "especially", "established", "even", "expanded", "former", "growing", "large", "membership", "organization", "people".
0.260
addressingamongcommunityestablishedfoundedinternationallocalmaterialneedsorganizationorganizationsprogramssociety
SHARED TOKENS (13): "addressing", "among", "community", "established", "founded", "international", "local", "material", "needs", "organization", "organizations", "programs", "society".
0.260
accessdesignedformerjurisdictionslocalmajorprovideresidentialroadservesstreetstrafficwider
SHARED TOKENS (13): "access", "designed", "former", "jurisdictions", "local", "major", "provide", "residential", "road", "serves", "streets", "traffic", "wider".
0.260
operationsprimarilyschool
SHARED TOKENS (3): "operations", "primarily", "school". | EXACT TITLE in faith_religious: "Religious school".
0.260
Missionary ↗ Q219477 KW CROSS HIGH
actcaredevelopmenteducationgrouphealthmissionmissionsnamepeopleprovidesocietythem
SHARED TOKENS (13): "act", "care", "development", "education", "group", "health", "mission", "missions", "name", "people", "provide", "society", "them".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
connectionslargelightmetropolitanparkingpeoplepublicrailroadsystemtransfertransport
SHARED TOKENS (12): "connections", "large", "light", "metropolitan", "parking", "people", "public", "rail", "road", "system", "transfer", "transport".
0.240
americanassociatedbecomeeventsexpansiongeographyhistoricalhistorymedianationalregionwest
SHARED TOKENS (12): "american", "associated", "become", "events", "expansion", "geography", "historical", "history", "media", "national", "region", "west".
0.220
currenteastern
SHARED TOKENS (2): "current", "eastern". | EXACT TITLE in faith_religious: "Greek Orthodox Archdiocese of America".
0.220
createuses
SHARED TOKENS (2): "create", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.220
becomedesignespeciallygrowingphysicalroadrulesafetytrafficurbanuses
SHARED TOKENS (11): "become", "design", "especially", "growing", "physical", "road", "rule", "safety", "traffic", "urban", "uses".
0.220
Oversize load ↗ Q680421 KW CROSS HIGH
constructionindustrialinfrastructurelargelegallimitsordinaryroadstandardtransporttransportation
SHARED TOKENS (11): "construction", "industrial", "infrastructure", "large", "legal", "limits", "ordinary", "road", "standard", "transport", "transportation".
0.200
activeadultscountgeneralmembershipofficialpagerecordrecordssurveys
SHARED TOKENS (10): "active", "adults", "count", "general", "membership", "official", "page", "record", "records", "surveys".
0.200
americancommercialenvironmentinternationallandlogisticsmilitaryphysicalprocesstransport
SHARED TOKENS (10): "american", "commercial", "environment", "international", "land", "logistics", "military", "physical", "process", "transport".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyoneasternidahometropolitanmiddletonnampapopulationrural
SHARED TOKENS (10): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "middleton", "nampa", "population", "rural".
0.200
alignedcouncilmillionmovement
EXACT TITLE in faith_religious: "Church of the Nazarene".
0.180
americanassociationbeyondconsolidationcurrenteducationgroupidentifyinternational
SHARED TOKENS (9): "american", "association", "beyond", "consolidation", "current", "education", "group", "identify", "international".
0.180
accordingbecomecertainhomeindividualsintegrationlocalpeoplethem
SHARED TOKENS (9): "according", "become", "certain", "home", "individuals", "integration", "local", "people", "them".
0.180
handlingitselfmultiplerailreducedroadsecuritytransporttransportation
SHARED TOKENS (9): "handling", "itself", "multiple", "rail", "reduced", "road", "security", "transport", "transportation".
0.160
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
easternidaholimitedlongoregonroutesystemwest
SHARED TOKENS (8): "eastern", "idaho", "limited", "long", "oregon", "route", "system", "west".
0.160
activityassociatedhistoryidahonearnorthwestoregonwest
SHARED TOKENS (8): "activity", "associated", "history", "idaho", "near", "northwest", "oregon", "west".
0.160
bodycorporationcountiesgoverninglegallimitedlocalmunicipal
SHARED TOKENS (8): "body", "corporation", "counties", "governing", "legal", "limited", "local", "municipal".
0.160
canyoneagleidaholongmeridiannamparivervalley
SHARED TOKENS (8): "canyon", "eagle", "idaho", "long", "meridian", "nampa", "river", "valley".
0.140
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationruralsmall
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "population", "rural", "small".
0.140
applicabledistrictlandordinancepermituseszoning
SHARED TOKENS (7): "applicable", "district", "land", "ordinance", "permit", "uses", "zoning".
0.140
amongbuildingbuildingsbuiltconstructiondesignedexisting
SHARED TOKENS (7): "among", "building", "buildings", "built", "construction", "designed", "existing".
0.120
commercialdriverlargelicensematerialsoperate
SHARED TOKENS (6): "commercial", "driver", "large", "license", "materials", "operate".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
Bike lane ↗ Q1378400 KW CROSS HIGH
businessespermittedresearchroadsafetytraffic
SHARED TOKENS (6): "businesses", "permitted", "research", "road", "safety", "traffic".
0.100
gardenidahoroutetreasurevalley
SHARED TOKENS (5): "garden", "idaho", "route", "treasure", "valley".
0.100
adacountiesidahoroutestar
SHARED TOKENS (5): "ada", "counties", "idaho", "route", "star".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Faith Religious — Treasure Valley
HAIKU · HIGH GATE
How do zoning regulations in Ada County affect the placement of religious facilities along transportation corridors?
Ada County's land-use planning ordinances designate specific zones where religious institutions can locate relative to major roads and highways serving Boise, Meridian, and Garden City. Transportation infrastructure routing decisions in Ada County often require coordination with zoning administrators to ensure religious buildings maintain appropriate setbacks from Snake River access points and primary arterials.
What role do Snake River crossing points play in connecting faith communities across the Treasure Valley?
The Snake River divides Boise and Ada County from Canyon County jurisdictions, requiring bridge infrastructure that religious organizations use for inter-community gatherings and shared ministry work in Nampa, Caldwell, and Star. Transportation planners in both Ada County and Canyon County coordinate bridge maintenance schedules that affect attendance patterns at religious events spanning both sides of the river.
How have Boise State University's campus transportation plans influenced nearby religious institutional development?
Boise State University's transit corridors and parking policies in central Boise create traffic patterns that religious organizations in adjacent neighborhoods must accommodate for services and events. Several faith communities near the campus have adjusted facility access and parking based on the university's bicycle and bus infrastructure expansion projects.
How do transportation networks connecting Nampa and Caldwell in Canyon County serve the region's faith communities?
Canyon County highways linking Nampa and Caldwell enable religious organizations to share clergy, youth groups, and worship resources across the metropolitan area's western communities. Transportation accessibility between these two cities determines whether Canyon County faith institutions can maintain joint programming and consolidated administrative services.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Faith Religious 17 QID bridges 243 edges 6,655 ext links 2026-07-17 23:40:33 UTC 45385f0f507ffe84
Transportation Infrastructure corridor ↗ Faith Religious corridor ↗ Faith Religious × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals