—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Cleaning Services

23 Wikipedia bridge articles confirmed in both vertical ledgers. 258 deterministic cross-vertical edges. 7,053 external source links harvested. Every edge provenance-stamped. Every claim auditable.

23 QID Bridge Articles
258 Cross Edges
7,053 External Sources
293 Wikipedia Articles
26 🌲 Evergreen
189 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Cleaning Services
QID Bridge Articles
23
confirmed Wikipedia overlap
Total Cross Edges
258
External Sources Harvested
7,053
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Construction
score: 1.0000  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (20)
ConstructionIdahoZoningApprenticeshipLogisticsBoise AirportClean Water ActWarehouseCollege of Western IdahoTreasure ValleyNampa, IdahoUnited States Environmental Protection AgencyAmericans with Disabilities Act of 1990Boise, IdahoGarden City, IdahoStar, IdahoAda County, IdahoMeridian, IdahoKuna, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadametropolitancanyonwesternnamecapitalnationalnorthwestlocalpublicnampasecondbuildingbuildingsindustrialplanningproducts
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:39:29 UTC
Content Hash
9675b9354695faad
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
23 BRIDGES
Construction
Q3875186 EXACT TITLE 1.000
QID OVERLAP: Q3875186 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (18): "building", "buildings", "built", "construction", "design", "economic", "facilities", "hazardous", "improve", "industrial", "industry", "infrastructure", "maintenance", "percent", "planning", "process", "products", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in cleaning_services: "Construction".
buildingbuildingsbuiltconstructiondesigneconomicfacilitieshazardousimproveindustrialindustryinfrastructuremaintenancepercentplanningprocessproductswork
Construction is the process involved in delivering buildings, infrastructure, industrial facilities, and associated activities through to the end of their life. It typically starts with planning, financing, and design that continues until the asset is built and ready for use. Construction also covers repairs and maintenance work, any work to expand, extend, and improve the asset, and its eventual demolition, dismantling, or decommissioning. The construction industry contributes significantly to many countries' gross domestic products (GDP). Global expenditure on construction activities was about $4 trillion in 2012. In 2022, expenditure on the construction industry exceeded $11 trillion a year, equivalent to about 13 percent of global GDP. This spending was forecasted to rise to around $14.8 trillion in 2030. The construction industry promotes economic development and brings many non-monetary benefits to many countries, but it is one of the most hazardous industries.
. Etymology "Construction" stems from the Latin word constructio (which comes from com- "together" and struere "to pile up") as well as Old French construction. "To construct" is a verb: the act of building. The noun is "construction": how something is built or the nature of its structure. History The first huts and shelters were constructed by hand or with simple tools. As cities grew during the Bronze Age, a class of professional craftsmen, like bricklayers and carpenters, appeared. Occasionally, slaves were used for construction work. In the Middle Ages, the artisan craftsmen were organized into craft guilds. In the 19th century, steam-powered machinery appeared, and later, diesel- and electric-powered vehicles such as cranes, excavators and bulldozers. Fast-track construction has been increasingly popular in the 21st century.
The first huts and shelters were constructed by hand or with simple tools. As cities grew during the Bronze Age, a class of professional craftsmen, like bricklayers and carpenters, appeared. Occasionally, slaves were used for construction work. In the Middle Ages, the artisan craftsmen were organized into craft guilds. In the 19th century, steam-powered machinery appeared, and later, diesel- and electric-powered vehicles such as cranes, excavators and bulldozers. Fast-track construction has been increasingly popular in the 21st century. Some estimates suggest that 40% of construction projects are now fast-track construction. Construction industry sectors Broadly, there are three sectors of construction: buildings, infrastructure and industrial: Building construction is usually further divided into residential and non-residential. Infrastructure, also called 'heavy civil' or 'heavy engineering', includes large public works, dams, bridges, highways, railways, water or wastewater and utility distribution. Industrial construction includes offshore construction (mainly of energy installations), mining and quarrying, refineries, chemical processing, mills and manufacturing plants. The industry can also be classified into sectors or markets. For example, Engineering News-Record (ENR), a US-based construction trade magazine, has compiled and reported data about the size of design and construction contractors. In 2014, it split the data into nine market segments: transportation, petroleum, buildings, power, industrial, water, manufacturing, sewage/waste, telecom, hazardous waste, and a tenth category for other projects. ENR used data on transportation, sewage, hazardous waste and water to rank firms as heavy contractors. The Standard Industrial Classification and the newer North American Industry Classification System classify companies that perform or engage in construction into three subsectors: building construction, heavy and civil engineering construction, and specialty trade contractors.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (23): "agriculture", "boise", "capital", "distinct", "divided", "early", "economy", "idaho", "land", "manufacturing", "methods", "national", "northwest", "official", "population", "products", "separate", "small", "supplies", "technology".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in cleaning_services: "Idaho".
agricultureboisecapitaldistinctdividedearlyeconomyidaholandmanufacturingmethodsnationalnorthwestofficialpopulationproductsseparatesmallsuppliestechnologyterritoryuseswestern
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
In 2025, the gross state product (state GDP) for Idaho was $135.5 billion and the state's per capita personal income was $64,846. Idaho had the 39th highest GDP per capita in the United States of America in 2025. In 2025, small businesses made up 99.2% and employed 56.0% of the state's work force. As of May 2025, the state's unemployment rate was 3.6%. Total employment in Idaho in 2024 was 965,824. Idaho is the top potato producing state in the United States and almost one-third of the nation's potatoes are grown in the Snake River Plain, a belt of low-lying land that extends across southern Idaho. Important industries in Idaho are food processing, lumber and wood products, machinery, chemical products, paper products, electronics manufacturing, silver and other mining, and tourism. The world's largest factory for barrel cheese, the raw product for processed cheese, is in Gooding, Idaho. It has a capacity of 120,000 metric tons per year of barrel cheese and belongs to the Glanbia group. As Idaho neared statehood, mining and other extractive industries played a significant role in its economy. Although the state's reliance on mining has diminished over time, Idaho remains renowned as "The Gem State" due to its production of seventy-two varieties of precious and semi-precious stones. Idaho is a leading national producer of potatoes, trout, Austrian winter peas, and lentils. The state's primary industries include manufacturing, agriculture, food processing, timber, and mining. Tourism is another way that Idaho capitalizes on its natural resources.
gton and Oregon to the west; the state shares a small portion of the Canada–United States border to the north with the Canadian province of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (33): "allowing", "building", "buildings", "certain", "density", "determine", "developed", "different", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "method", "places", "planning", "policy".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in cleaning_services: "Zoning".
allowingbuildingbuildingscertaindensitydeterminedevelopeddifferentformgoverngovernmentgrowthindustriallandland-uselocalmethodplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscaleshapesinglesizesystems+3
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (18): "apprenticeship", "boundaries", "certification", "competence", "employer", "field", "formal", "labor", "level", "license", "period", "practitioners", "professional", "reach", "regulated", "system", "training", "vary". | EXACT TITLE in transportation_infrastructure: "Apprenticeship". | EXACT TITLE in cleaning_services: "Apprenticeship".
apprenticeshipboundariescertificationcompetenceemployerfieldformallaborlevellicenseperiodpractitionersprofessionalreachregulatedsystemtrainingvary
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Logistics
Q177777 EXACT TITLE 1.000
QID OVERLAP: Q177777 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (26): "another", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "logistics", "management", "material", "materials", "model", "needs", "operational", "physical", "planning", "problems", "production", "products".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in cleaning_services: "Logistics".
anothercustomersdedicatedequipmentfacilityfieldfoodinformationlogisticsmanagementmaterialmaterialsmodelneedsoperationalphysicalplanningproblemsproductionproductsprofessionalpublicresourcesupplytogethertransportation
garbage collection, mail deliveries, public utilities, and after-sales services, logistical problems must be addressed. Logistics deals with the movement of materials or products from one facility to another; it does not include material flow within production or assembly plants, such as production planning or single-machine scheduling. Logistics accounts for a significant amount of the operational costs of an organisation or country. Dedicated simulation software can model, analyse, visualise, and optimize logistic complexities.
Logistical activities can be divided into three main areas: order processing, inventory management, and freight transportation. Modern freight transportation relies heavily on fleet management to improve efficiency and safety. Traditionally, order processing was a time-consuming activity, but with new technologies such as bar code scanning and computers, the availability of stocks can be checked in real time. The purpose of having an inventory is to reduce the overall logistical cost while improving service to customers. Having a stockpile of finished goods beforehand can reduce the frequency of transportation and cope with the randomness of customer demands. However, maintaining an inventory requires capital investment and maintaining a warehouse. Freight transportation is a central part of logistics and allows access to broad markets. Transportation policies and warehouse management are closely intertwined. The rise of e-commerce has led to the development of "e-logistics". Compared to traditional logistics, e-logistics handles parcels valued at less than a hundred US dollars and delivers them to customers scattered across various destinations worldwide. In e-logistics, customer demand tends to come in waves, unlike in traditional logistics, where demand is more consistent. E-commerce logistics infrastructure was developed significantly in 2024-2025 to meet the needs imposed on operations by the increase in international digital trade. Business-to-business e-commerce is expected to reach an estimated USD 32.8 trillion in 2025, and the cross-border sales constitute the market at about 44 per cent of the business-to-business e-commerce market . This level of international trading created logistical needs that were non-traditional, such as those patterns described previously in this article, namely, e-logistics manages packages that are usually valued at less than USD 100 and are sent to customers that are located in various parts of the world, with demand being delivered in bursts instead of the steady flows associated with the business-to-business bulk shipping patterns. Digital channels reacted by incorporating full-fleet logistics solutions, including warehousing, fulfilment, and last-mile delivery. Large B2B e-commerce platforms such as Alibaba, Amazon Business, and other local marketplaces created services that allowed small and medium enterprises to enjoy access to international markets without owner-managed logistic systems of their own . This model was demonstrated on Alibaba, which serves 48 million SMEs in 190 countries and provides logistics integration as its marketplace services. Similar platforms were found in the region, such as cross-border platform Nocnoc based in Latin America, which linked 1,200 foreign sellers to 16 marketplaces in 2023, with cross-border revenues in the region increasing 44 per cent in 2022 to USD 382 billion market valuation . Integration of technology was globalised to include physical logistics and financial infrastructure. The projections made by the industry analysis forecast that virtual card usage in B2B cross-border transactions would increase more than 250 per cent in 2028, as more and more digital payment instruments are incorporated into logistics tracking . B2B customers with complex payment requirements based on the international shipment schedules became related to buy-now-pay-later services and bank transfers. Another innovation was the automation of fulfilment, where warehouse robots and algorithm-driven inventory location minimised the order processing time and allowed same-day delivery of cross-border shipments. These combined logistics frameworks resolved the obstacles that previously restricted the international trade of the SMEs. Logistics used in the traditional set-up involved distinct ties to freight forwarders, customs brokers, warehouses, and last-mile carriers – connections that could be cost-efficient only when a large business had dedicated trade units. Digital platforms bundled these capabilities together as a single service, allowing small businesses to perform cross-border business. Previously, only multinational companies had a well-established logistics network. Inbound logistics is one of the primary logistics processes, focusing on the purchasing and arrangement of the inbound movement of materials, parts, or unfinished inventory from suppliers to manufacturing or assembly plants, warehouses, or retail stores. Outbound logistics is the process related to the storage and movement of the final product.
Factories where products are manufactured or assembled A depot or deposit, a standard type of warehouse for storing merchandise (high level of inventory) Distribution centers for order processing and order fulfillment (lower level of inventory) and also for receiving returning items from clients. Typically, distribution centers are way stations for products to be disbursed further down the supply chain. They usually do not ship inventory directly to customers, whereas fulfillment centers do. Transit points for cross-docking activities, which consist of reassembling cargo units based on deliveries scheduled (only moving merchandise) Traditional "mom-and-pop" retail stores, modern supermarkets, hypermarkets, discount stores or also voluntary chains, consumers' co-operatives, groups of consumers with collective buying power. Note that subsidiaries will be mostly owned by another company and franchisers, although using other company brands, actually own the point of sale. Logistic families and metrics A logistic family is a set of products that share a common characteristic: weight and volumetric characteristics, physical storing needs (temperature, radiation, etc.), handling needs, order frequency, package size, etc.
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (22): "ada", "air", "base", "boise", "center", "commercial", "commission", "department", "facility", "falls", "field", "functions", "general", "idaho", "international", "national", "operates", "receive", "requiring", "support".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
adaairbaseboisecentercommercialcommissiondepartmentfacilityfallsfieldfunctionsgeneralidahointernationalnationaloperatesreceiverequiringsupportuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (26): "act", "addressing", "changes", "clean", "control", "coordination", "directly", "environmental", "epa", "federal", "form", "governing", "law", "major", "name", "owned", "physical", "providing", "provisions", "quality".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
actaddressingchangescleancontrolcoordinationdirectlyenvironmentalepafederalformgoverninglawmajornameownedphysicalprovidingprovisionsqualityrecoveryregulationsresourcethoughtreatmentwater
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Warehouse
Q181623 EXACT TITLE 1.000
QID OVERLAP: Q181623 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (20): "agriculture", "building", "buildings", "businesses", "cities", "components", "directly", "facility", "function", "industrial", "large", "loading", "manufacturing", "materials", "production", "standard", "transport", "trucks", "warehouse", "warehouses". | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in cleaning_services: "Warehouse".
agriculturebuildingbuildingsbusinessescitiescomponentsdirectlyfacilityfunctionindustriallargeloadingmanufacturingmaterialsproductionstandardtransporttruckswarehousewarehouses
are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
A warehouse is a building for storing goods. Warehouses are used by manufacturers, importers, exporters, wholesalers, transport businesses, customs, etc. For a warehouse to function efficiently, the facility must be properly slotted. They are usually large plain buildings, often in industrial parks on the outskirts of cities, towns, or villages. Warehouses usually have loading docks to load and unload goods from trucks. Sometimes warehouses are designed for the loading and unloading of goods directly from railways, airports, or seaports. They often have cranes and forklifts for moving goods, which are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown.
Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (23): "academic", "ada", "board", "boise", "canyon", "classes", "college", "counties", "education", "idaho", "large", "nampa", "population", "programs", "public", "reported", "served", "technical", "throughout", "treasure".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in cleaning_services: "College of Western Idaho".
academicadaboardboisecanyonclassescollegecountieseducationidaholargenampapopulationprogramspublicreportedservedtechnicalthroughouttreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.960
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (13): "association", "boise", "chambers", "commerce", "idaho", "land", "local", "metropolitan", "name", "region", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in cleaning_services: "Treasure Valley".
associationboisechamberscommerceidaholandlocalmetropolitannameregiontreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "comes", "home", "idaho", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "second", "university", "western".
boisecanyoncollegecomeshomeidahomeridianmetropolitannamenampanorthwestpopulationseconduniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (30): "department", "education", "employee", "energy", "enforcement", "environmental", "epa", "federal", "financial", "government", "house", "independent", "information", "january", "legal", "level", "local", "matters", "measures", "monitoring"....
departmenteducationemployeeenergyenforcementenvironmentalepafederalfinancialgovernmenthouseindependentinformationjanuarylegallevellocalmattersmeasuresmonitoringnationaloperationpermittingprogramsproposedpublicregionalresearchspecialistsstandards
use and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.800
QID OVERLAP: Q1111004 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (16): "act", "ada", "against", "broad", "business", "changes", "covered", "employers", "house", "january", "law", "national", "prohibits", "public", "requirements", "requires".
actadaagainstbroadbusinesschangescoveredemployershousejanuarylawnationalprohibitspublicrequirementsrequires
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (16): "ada", "boise", "capital", "counties", "employers", "home", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "population", "technology", "treasure", "valley".
adaboisecapitalcountiesemployershomeidaholevellocallymajormanufacturingmetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
QID OVERLAP 0.760
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "nearly", "population", "second", "separate", "street".
adaboisegardengovernmentidahometropolitanmunicipalnamenearlypopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Star, Idaho
Q1516815 QID OVERLAP 0.760
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (13): "ada", "boise", "canyon", "house", "idaho", "metropolitan", "middleton", "name", "population", "school", "schools", "shared", "star".
adaboisecanyonhouseidahometropolitanmiddletonnamepopulationschoolschoolssharedstar
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private", "second".
adaboisecapitalhomeidahojurisdictionlocalmetropolitannorthwestpopulationprivatesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.680
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (9): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "nearly", "percent", "population".
adaadditionalboiseidahokunametropolitannearlypercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in transportation_infrastructure (tier:branch) and cleaning_services (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
boisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Middleton, Idaho
Q1517595 QID OVERLAP 0.640
QID OVERLAP: Q1517595 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
boisecanyonidahometropolitanmiddletonnampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
235 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP235 edges
🌲 EVERGREEN3 edges
0.650
acquisitionboardbroadcommercecommissionconstructioncreatedeconomicfederalgovernmentindependentindustryjurisdictionmattersrateregulationregulatoryservedservessubject
SHARED TOKENS (24): "acquisition", "board", "broad", "commerce", "commission", "construction", "created", "economic", "federal", "government", "independent", "industry", "jurisdiction", "matters", "rate", "regulation", "regulatory", "served", "serves", "subject".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationamericancommercialfederalgeneralimprovelandlightingpercentplanningprogrampublicrevenuesafetysizetaxtaxestrust
SHARED TOKENS (19): "acquisition", "administration", "american", "commercial", "federal", "general", "improve", "land", "lighting", "percent", "planning", "program", "public", "revenue", "safety", "size", "tax", "taxes", "trust". | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesairamonganotherauthoritiesauthorityautomobilebaseboisecanyoncapacitycapitalcentercitiesconventionaldemandeagleearly
SHARED TOKENS (75): "ada", "additional", "agencies", "air", "among", "another", "authorities", "authority", "automobile", "base", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "demand", "eagle", "early".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH189 edges
0.530
createdcreatingdepartmentenforcementidaholawmunicipalpublicstatewide
SHARED TOKENS (9): "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesignlandlocalplaceprivatepublicroadroutesidewalksstreettrafficurbanwhose
SHARED TOKENS (15): "access", "another", "design", "land", "local", "place", "private", "public", "road", "route", "sidewalks", "street", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in cleaning_services: "Road".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingdrainageembeddedfrequentlyitselfmaterialneedperformanceplacingprocessrequirementsroadselectionshapestructuresurfacetrafficvehiclewater
SHARED TOKENS (19): "allowing", "drainage", "embedded", "frequently", "itself", "material", "need", "performance", "placing", "process", "requirements", "road", "selection", "shape", "structure", "surface", "traffic", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
applicationbuildingbuildingscodecodescurrentdepartmenteveneventfacilitieslawlocalmeasuresoperatorsownerspersonnelproductionresearchstructuressystems
SHARED TOKENS (20): "application", "building", "buildings", "code", "codes", "current", "department", "even", "event", "facilities", "law", "local", "measures", "operators", "owners", "personnel", "production", "research", "structures", "systems". | EXACT TITLE in cleaning_services: "Fire protection".
0.500
americanassociationavoidbecomebusinessbusinessescodeconsumerscustomerevenfoundedincorporatedindustryinternationallocalmarketingmaterialsnearlyoperatingorganizations
SHARED TOKENS (32): "american", "association", "avoid", "become", "business", "businesses", "code", "consumers", "customer", "even", "founded", "incorporated", "industry", "international", "local", "marketing", "materials", "nearly", "operating", "organizations".... | EXACT TITLE in cleaning_services: "Better Business Bureau".
0.500
aircanyonconstructionemergencygeneralhomeidahoindustrialintegratedmunicipalnampanationalplanprivatepublicsystemstraining
SHARED TOKENS (17): "air", "canyon", "construction", "emergency", "general", "home", "idaho", "industrial", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
activityadditionalaircenterscitiescommercialcontrolledcreateddevelopeddifferenteconomicelectricityembeddedenergyenvironmentenvironmentalexistingfoodhealthindustrial
SHARED TOKENS (50): "activity", "additional", "air", "centers", "cities", "commercial", "controlled", "created", "developed", "different", "economic", "electricity", "embedded", "energy", "environment", "environmental", "existing", "food", "health", "industrial".... | EXACT TITLE in transportation_infrastructure: "Waste management". | EXACT TITLE in cleaning_services: "Waste management".
0.500
abilityaffectairaloneamericanarchitectureavoidbeyondbuildingbuildingsclearcodecodesconditionscontroldemanddependdesigndirectdirectly
SHARED TOKENS (50): "ability", "affect", "air", "alone", "american", "architecture", "avoid", "beyond", "building", "buildings", "clear", "code", "codes", "conditions", "control", "demand", "depend", "design", "direct", "directly".... | EXACT TITLE in cleaning_services: "Ventilation (architecture)".
0.500
airapplicablebuildingcentercenterscommercialconsumersdedicateddemanddirectlydistributionequipmentfacilityfirmsfunctionhandlinginventorylaborlargelogistics
SHARED TOKENS (41): "air", "applicable", "building", "center", "centers", "commercial", "consumers", "dedicated", "demand", "directly", "distribution", "equipment", "facility", "firms", "function", "handling", "inventory", "labor", "large", "logistics".... | EXACT TITLE in transportation_infrastructure: "Distribution center". | EXACT TITLE in cleaning_services: "Distribution center".
0.500
Corporation ↗ Q167037 EXACT TITLE
abilityactagainstauthoritiesboardbusinesscapacitycertainchartercontrolcorporatedifferentdistinguishesdividedearlyentitiesentityestablishedincorporatedinvestment
SHARED TOKENS (44): "ability", "act", "against", "authorities", "board", "business", "capacity", "certain", "charter", "control", "corporate", "different", "distinguishes", "divided", "early", "entities", "entity", "established", "incorporated", "investment".... | EXACT TITLE in transportation_infrastructure: "Corporation". | EXACT TITLE in cleaning_services: "Corporation".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessacquisitionamericanamongbecomebeyondbusinesscapitalconnectionscreatedesignemployersexpandedfirmshandlinginformationlistnetworkopenplatform
SHARED TOKENS (31): "access", "acquisition", "american", "among", "become", "beyond", "business", "capital", "connections", "create", "design", "employers", "expanded", "firms", "handling", "information", "list", "network", "open", "platform".... | EXACT TITLE in cleaning_services: "LinkedIn".
0.500
Angi ↗ Q85741689 EXACT TITLE
americancontractorsdevelopeddirectoryfoundedhomeincorporatedjanuarylistlocalmodelownedplansreviewsseconduserswork
SHARED TOKENS (17): "american", "contractors", "developed", "directory", "founded", "home", "incorporated", "january", "list", "local", "model", "owned", "plans", "reviews", "second", "users", "work". | EXACT TITLE in cleaning_services: "Angi".
0.500
accessactauthoritiescreatedexistingfederalformationgovernmentlawlocalmetropolitanplanningplanspopulationprocessprogramspublicregionalservedstatewide
SHARED TOKENS (21): "access", "act", "authorities", "created", "existing", "federal", "formation", "government", "law", "local", "metropolitan", "planning", "plans", "population", "process", "programs", "public", "regional", "served", "statewide".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Laundry ↗ Q852100 EXACT TITLE
americanapartmentbuildingbusinesscarecommercialdifferentfacilityfunctionhistoryhomeindustrialitselfmethodsneedplacesharedutilitywork
SHARED TOKENS (19): "american", "apartment", "building", "business", "care", "commercial", "different", "facility", "function", "history", "home", "industrial", "itself", "methods", "need", "place", "shared", "utility", "work". | EXACT TITLE in cleaning_services: "Laundry".
0.500
againstbeyondcertainclassescontactdevelopeddirectlyfunctionfurthergrowthmediaresponsesurfacesthoughtissue
SHARED TOKENS (15): "against", "beyond", "certain", "classes", "contact", "developed", "directly", "function", "further", "growth", "media", "response", "surfaces", "though", "tissue". | EXACT TITLE in cleaning_services: "Antimicrobial".
0.500
broadercertaincitiescoveringeconomicenvironmentalgrowthindustrialinfrastructurelandland-uselevelmanagemanagementnationalneedsnetworkplanningplanspractices
SHARED TOKENS (34): "broader", "certain", "cities", "covering", "economic", "environmental", "growth", "industrial", "infrastructure", "land", "land-use", "level", "manage", "management", "national", "needs", "network", "planning", "plans", "practices".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
accessagenciescomponentsconditionscreateddifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentenvironmentalfacilitiesfirmsfocusedfrequentlyfunctiongeneral
SHARED TOKENS (48): "access", "agencies", "components", "conditions", "created", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "facilities", "firms", "focused", "frequently", "function", "general".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in cleaning_services: "Infrastructure".
0.500
Fire ↗ Q3196 EXACT TITLE
agricultureanotherbecomedependdirectlyformgrowthhazardsheavyhistoryhomelandmajormanagematerialphysicalprocessproduceproducesproducts
SHARED TOKENS (31): "agriculture", "another", "become", "depend", "directly", "form", "growth", "hazards", "heavy", "history", "home", "land", "major", "manage", "material", "physical", "process", "produce", "produces", "products".... | EXACT TITLE in cleaning_services: "Fire".
0.500
additionalbroaderbusinesscommercialfocusedhealthhospitalhospitalshouseindustrialinstitutionalinstitutionslargemaintenancemanagemanagementoccupationalphysicalprivateproviding
SHARED TOKENS (26): "additional", "broader", "business", "commercial", "focused", "health", "hospital", "hospitals", "house", "industrial", "institutional", "institutions", "large", "maintenance", "manage", "management", "occupational", "physical", "private", "providing".... | EXACT TITLE in cleaning_services: "Housekeeping".
0.500
Hepatitis B ↗ Q6853 EXACT TITLE
againstanotherbecomecannotcarecontactdevelopedestimatesexposurefullfurtherhealthhealthcarehighmethodsnationalpopulationpracticesprogramspublic
SHARED TOKENS (28): "against", "another", "become", "cannot", "care", "contact", "developed", "estimates", "exposure", "full", "further", "health", "healthcare", "high", "methods", "national", "population", "practices", "programs", "public".... | EXACT TITLE in cleaning_services: "Hepatitis B".
0.500
alongsideconcentrateddevelopeddirectdriverenvironmentenvironmentalestimatesfocusedgrowthhighimpactimproveinternationallimitedmedicalpolicypopulationprocessrate
SHARED TOKENS (23): "alongside", "concentrated", "developed", "direct", "driver", "environment", "environmental", "estimates", "focused", "growth", "high", "impact", "improve", "international", "limited", "medical", "policy", "population", "process", "rate".... | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomebodiescitiescreatedemanddevelopeddirectlyfallsheavylandlargemajorpopulationresourcesnowsurfacetermstreatmenturbanwater
SHARED TOKENS (20): "become", "bodies", "cities", "create", "demand", "developed", "directly", "falls", "heavy", "land", "large", "major", "population", "resource", "snow", "surface", "terms", "treatment", "urban", "water". | EXACT TITLE in cleaning_services: "Stormwater".
0.500
airconnectingentryequipmenthazardshealthlimitedmaintenanceoccupancyoccupationalplanqualitysafetyspacespacesstoragetrainingworkers
SHARED TOKENS (18): "air", "connecting", "entry", "equipment", "hazards", "health", "limited", "maintenance", "occupancy", "occupational", "plan", "quality", "safety", "space", "spaces", "storage", "training", "workers". | EXACT TITLE in cleaning_services: "Confined space".
0.500
abilityadditionalappliescannotconditionscontrolcontrolscreatedesignelectricalemployeeengineeringenvironmentequipmentexposureframeworkhazardhazardshealthmeasures
SHARED TOKENS (35): "ability", "additional", "applies", "cannot", "conditions", "control", "controls", "create", "design", "electrical", "employee", "engineering", "environment", "equipment", "exposure", "framework", "hazard", "hazards", "health", "measures".... | EXACT TITLE in cleaning_services: "Personal protective equipment".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
buildingcleanconcentratedcontactdifferentformfrequentlyhospitalsmedicalmethodsphysicalprocesssimultaneouslysurfacesurfacestissuetreatmentwastework
SHARED TOKENS (19): "building", "clean", "concentrated", "contact", "different", "form", "frequently", "hospitals", "medical", "methods", "physical", "process", "simultaneously", "surface", "surfaces", "tissue", "treatment", "waste", "work". | EXACT TITLE in cleaning_services: "Disinfectant".
0.500
activitybecomecomponentsconnectedconsumerscustomersdesigndistributedeconomyengineeringequipmentfieldindustrialintegratinglaborlargemanufacturingmaterialsprocessproducing
SHARED TOKENS (28): "activity", "become", "components", "connected", "consumers", "customers", "design", "distributed", "economy", "engineering", "equipment", "field", "industrial", "integrating", "labor", "large", "manufacturing", "materials", "process", "producing".... | EXACT TITLE in transportation_infrastructure: "Manufacturing". | EXACT TITLE in cleaning_services: "Manufacturing".
0.500
describeseconomiceconomicsfocusedfrequentlygrowthimproveincreasesinfrastructurelocalmarketpoliciespolicyprocessqualityregionterms
SHARED TOKENS (17): "describes", "economic", "economics", "focused", "frequently", "growth", "improve", "increases", "infrastructure", "local", "market", "policies", "policy", "process", "quality", "region", "terms". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
airclassificationconstructiondefinesdesignfurthergeneralhaulingindustrialindustrylegalmaterialmobilemoveplatformpowerratherregulationspecializedstandard
SHARED TOKENS (26): "air", "classification", "construction", "defines", "design", "further", "general", "hauling", "industrial", "industry", "legal", "material", "mobile", "move", "platform", "power", "rather", "regulation", "specialized", "standard".... | EXACT TITLE in cleaning_services: "Powered industrial truck".
0.500
consumerconsumerscreatingcustomersdirectdirectlydistributionfacilitiesindependentlogisticsmanagementmaterialsnetworkproductproductsstructuresupplierssupplysystemsystems
SHARED TOKENS (21): "consumer", "consumers", "creating", "customers", "direct", "directly", "distribution", "facilities", "independent", "logistics", "management", "materials", "network", "product", "products", "structure", "suppliers", "supply", "system", "systems".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationairassetsauthoritycertificationcommercialcontrolcreateddepartmentfederalgovernmentinternationalpersonnelregulatesspacestandardssurroundingtraffictransportationvehicles
SHARED TOKENS (20): "administration", "air", "assets", "authority", "certification", "commercial", "control", "created", "department", "federal", "government", "international", "personnel", "regulates", "space", "standards", "surrounding", "traffic", "transportation", "vehicles". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
aircleancreateemployeeepaexposureformindustrialmediamethodmethodsproductsrequiresecondarysurfacesurfacesuseswaste
SHARED TOKENS (18): "air", "clean", "create", "employee", "epa", "exposure", "form", "industrial", "media", "method", "methods", "products", "require", "secondary", "surface", "surfaces", "uses", "waste". | EXACT TITLE in cleaning_services: "Dry-ice blasting".
0.500
additionalairbrandextendsformformationhistoryindependentinternationalmajornetworkoperatesoperatingregionalroutestarthroughout
SHARED TOKENS (17): "additional", "air", "brand", "extends", "form", "formation", "history", "independent", "international", "major", "network", "operates", "operating", "regional", "route", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
actadditionalagainstamericanbudgetcarecodecreateddecadesdepartmentenforcementfederalfurthergovernmenthandlinghighhistoryincreaseslargelaw
SHARED TOKENS (34): "act", "additional", "against", "american", "budget", "care", "code", "created", "decades", "department", "enforcement", "federal", "further", "government", "handling", "high", "history", "increases", "large", "law".... | EXACT TITLE in cleaning_services: "Internal Revenue Service".
0.500
Cleaner ↗ Q1760141 EXACT TITLE
buildingcleanfacilityindustrialmaintenancemanagersoccupyoperatorotherwiseplacespublicschoolssecuritysitespacewhosework
SHARED TOKENS (17): "building", "clean", "facility", "industrial", "maintenance", "managers", "occupy", "operator", "otherwise", "places", "public", "schools", "security", "site", "space", "whose", "work". | EXACT TITLE in cleaning_services: "Cleaner".
0.500
agenciesamericanavoidbroadbudgetbusinessesconditionscoordinationcurrentdatadepartmenteconomiceconomicsfederalfieldgovernmenthighlaborlocalmajor
SHARED TOKENS (34): "agencies", "american", "avoid", "broad", "budget", "businesses", "conditions", "coordination", "current", "data", "department", "economic", "economics", "federal", "field", "government", "high", "labor", "local", "major".... | EXACT TITLE in cleaning_services: "Bureau of Labor Statistics".
0.500
administrationairauthoritybudgetcertainconnectingcreateddatadepartmentdevelopsenforcementfacilitiesfederalgovernmentidentificationimprovelawlocalpersonnelpolicies
SHARED TOKENS (34): "administration", "air", "authority", "budget", "certain", "connecting", "created", "data", "department", "develops", "enforcement", "facilities", "federal", "government", "identification", "improve", "law", "local", "personnel", "policies".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
administrationagenciesdepartmentexistingfederalfinancialfunctionsgovernmentimprovelocalofficeoperateoperatorsprogramsprovidersprovidingpublicregionalrequirementssystems
SHARED TOKENS (24): "administration", "agencies", "department", "existing", "federal", "financial", "functions", "government", "improve", "local", "office", "operate", "operators", "programs", "providers", "providing", "public", "regional", "requirements", "systems".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbroadbroaderbuildingscapitalcategoryconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthealthhospitalsinfrastructuremunicipaloperatorphysical
SHARED TOKENS (32): "assets", "broad", "broader", "buildings", "capital", "category", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "health", "hospitals", "infrastructure", "municipal", "operator", "physical".... | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionalarrangementboardbuiltbusinesscenterclasscontaindepartmentdepartmentsdirectearlyeconomyenvironmentequipmenteventfacilitiesfacilityfood
SHARED TOKENS (49): "access", "additional", "arrangement", "board", "built", "business", "center", "class", "contain", "department", "departments", "direct", "early", "economy", "environment", "equipment", "event", "facilities", "facility", "food".... | EXACT TITLE in cleaning_services: "Hotel".
0.500
agriculturechangesclassificationclassificationsdifferentenvironmentalfoodformhomeimpactindustrialmakingmethodsneedsotherwisephysicalproductproductssecondarysecurity
SHARED TOKENS (21): "agriculture", "changes", "classification", "classifications", "different", "environmental", "food", "form", "home", "impact", "industrial", "making", "methods", "needs", "otherwise", "physical", "product", "products", "secondary", "security".... | EXACT TITLE in transportation_infrastructure: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionapartmentbuildingsbusinesscomescommercialdifferententityestategeneralgovernmenthousinglandlawlegalmeansownedownershipprivateproperty
SHARED TOKENS (27): "acquisition", "apartment", "buildings", "business", "comes", "commercial", "different", "entity", "estate", "general", "government", "housing", "land", "law", "legal", "means", "owned", "ownership", "private", "property".... | EXACT TITLE in transportation_infrastructure: "Real estate". | EXACT TITLE in cleaning_services: "Real estate".
0.500
accessairallowingarrangementsassociationauthoritiescompetitivecoordinationeconomicestatefinancialfrequentlygeneralgovernmentindustryinfrastructureintegratedinternationalinvestmentlocal
SHARED TOKENS (49): "access", "air", "allowing", "arrangements", "association", "authorities", "competitive", "coordination", "economic", "estate", "financial", "frequently", "general", "government", "industry", "infrastructure", "integrated", "international", "investment", "local".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
constructioncontrolequipmentfrequentlyfunctionsheavyimplementindustrialinformationlaborlargemachinerymobileoperationsotherwisepowerstructuresystemsusesvehicles
SHARED TOKENS (21): "construction", "control", "equipment", "frequently", "functions", "heavy", "implement", "industrial", "information", "labor", "large", "machinery", "mobile", "operations", "otherwise", "power", "structure", "systems", "uses", "vehicles".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment". | EXACT TITLE in cleaning_services: "Heavy equipment".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstanothercertainconditionscoveragecoveredentityestablishedeventfeefinancialformhealthinsuranceinsurerlargemanagementmeansownershippolicy
SHARED TOKENS (24): "against", "another", "certain", "conditions", "coverage", "covered", "entity", "established", "event", "fee", "financial", "form", "health", "insurance", "insurer", "large", "management", "means", "ownership", "policy".... | EXACT TITLE in transportation_infrastructure: "Insurance". | EXACT TITLE in cleaning_services: "Insurance".
0.500
departmentfacilitiesfederalidentifiedlocalmajormetropolitannationalnetworkorganizationspipelineplanningsafetyservingsystemtransporttransportationtruck
SHARED TOKENS (18): "department", "facilities", "federal", "identified", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "system", "transport", "transportation", "truck". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
businessbusinessescapacitycommercialcompeteconnectionscustomerexpandedhighhomehouselackofficeoperateoperatesregulationsresidentialsecondsignssmall
SHARED TOKENS (25): "business", "businesses", "capacity", "commercial", "compete", "connections", "customer", "expanded", "high", "home", "house", "lack", "office", "operate", "operates", "regulations", "residential", "second", "signs", "small".... | EXACT TITLE in cleaning_services: "Home business".
0.500
americanauthorityboundariescertaincitiesconcentratedcountiesdifferentdistrictsdividedentitiesexistingformfurthergovernmentindependentlawlevellocallocally
SHARED TOKENS (31): "american", "authority", "boundaries", "certain", "cities", "concentrated", "counties", "different", "districts", "divided", "entities", "existing", "form", "further", "government", "independent", "law", "level", "local", "locally".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in cleaning_services: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescomponentsconstructionengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalmapsownershipplanningpointsprofessionalpropertyresearch
SHARED TOKENS (26): "analysis", "boundaries", "components", "construction", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "points", "professional", "property", "research".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
Contract ↗ Q93288 EXACT TITLE
applyboundarybusinesscategorycertaincodecommercialcontractsdifferentdistinctdocumentenforcementeventfieldframeworkgeneralindependentinternationallawlegal
SHARED TOKENS (30): "apply", "boundary", "business", "category", "certain", "code", "commercial", "contracts", "different", "distinct", "document", "enforcement", "event", "field", "framework", "general", "independent", "international", "law", "legal".... | EXACT TITLE in transportation_infrastructure: "Contract". | EXACT TITLE in cleaning_services: "Contract".
0.500
Indeed ↗ Q1045367 EXACT TITLE
additionalallowingamericanapplybecomecentralcomdirectlyemployersemploymentfirmsindependentrevenuesinglesitestoragevertical
SHARED TOKENS (17): "additional", "allowing", "american", "apply", "become", "central", "com", "directly", "employers", "employment", "firms", "independent", "revenue", "single", "site", "storage", "vertical". | EXACT TITLE in cleaning_services: "Indeed".
0.500
activityamongboisebusinesscollegecompetedivisioneconomicseducationengineeringfoundedhealthhighidahoindependentprogramprogramspublicreportedresearch
SHARED TOKENS (22): "activity", "among", "boise", "business", "college", "compete", "division", "economics", "education", "engineering", "founded", "health", "high", "idaho", "independent", "program", "programs", "public", "reported", "research".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in cleaning_services: "Boise State University".
0.500
actadministrationagenciescreateddepartmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramspublicregulationsresearchsafetysupporttransportation
SHARED TOKENS (19): "act", "administration", "agencies", "created", "department", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "public", "regulations", "research", "safety", "support", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbuiltconnectingconnectionconstructioncreatedesignearlyengineeringenvironmentfrequentlyheavyindustriallocalmajormethodnetworkphysicalproductproviding
SHARED TOKENS (31): "allowing", "built", "connecting", "connection", "construction", "create", "design", "early", "engineering", "environment", "frequently", "heavy", "industrial", "local", "major", "method", "network", "physical", "product", "providing".... | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
buildingscannotcleanconsumercreatesdifferentformindustrialjetpowerpressureproduceratesinglespecializedsurfacesurfacessystemstermsvehicles
SHARED TOKENS (21): "buildings", "cannot", "clean", "consumer", "creates", "different", "form", "industrial", "jet", "power", "pressure", "produce", "rate", "single", "specialized", "surface", "surfaces", "systems", "terms", "vehicles".... | EXACT TITLE in cleaning_services: "Pressure washing".
0.500
Hepatitis C ↗ Q154869 EXACT TITLE
accessagainstamongcontactearlyequipmentfoodhealthcaremedicalperiodrequirescreeningsidetreatmentwater
SHARED TOKENS (15): "access", "against", "among", "contact", "early", "equipment", "food", "healthcare", "medical", "period", "require", "screening", "side", "treatment", "water". | EXACT TITLE in cleaning_services: "Hepatitis C".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributeddistributiondownstreamdrainageenvironmentalfieldformfull
SHARED TOKENS (47): "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distributed", "distribution", "downstream", "drainage", "environmental", "field", "form", "full".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
abilityauthoritybusinessescapablecertainconstructioncontractsdirecteconomiceconomygovernmentgrowthinternationallocalorganizationspracticesprivateprocessprocurementproduce
SHARED TOKENS (31): "ability", "authority", "businesses", "capable", "certain", "construction", "contracts", "direct", "economic", "economy", "government", "growth", "international", "local", "organizations", "practices", "private", "process", "procurement", "produce".... | EXACT TITLE in cleaning_services: "Government procurement".
0.500
becomecreatesdevelopeddocumentsemployeeemployerenvironmentequipmentexistingfieldformgrowthinstructionsknowledgemachinerymanagemanagementmaterialsmethodperformance
SHARED TOKENS (27): "become", "creates", "developed", "documents", "employee", "employer", "environment", "equipment", "existing", "field", "form", "growth", "instructions", "knowledge", "machinery", "manage", "management", "materials", "method", "performance".... | EXACT TITLE in cleaning_services: "On-the-job training".
0.500
carecontactcontrolequipmenthandlinghealthlatestmeansmedicalpatientpracticesrulesstandardthemthereforetreated
SHARED TOKENS (16): "care", "contact", "control", "equipment", "handling", "health", "latest", "means", "medical", "patient", "practices", "rules", "standard", "them", "therefore", "treated". | EXACT TITLE in cleaning_services: "Universal precautions".
0.500
accessallowingdatadecadesdividedearlyelectricalformfurtherindependentinformationmeansmediaphysicalpowersignalssingletechnologyusers
SHARED TOKENS (19): "access", "allowing", "data", "decades", "divided", "early", "electrical", "form", "further", "independent", "information", "means", "media", "physical", "power", "signals", "single", "technology", "users". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
Agriculture ↗ Q11451 EXACT TITLE
agriculturebroaderbusinessescitiesclassescreateddirecteconomicsenvironmentalfoodfurtherindustriallandlargelevelmajormaterialsnearlypracticesproduce
SHARED TOKENS (30): "agriculture", "broader", "businesses", "cities", "classes", "created", "direct", "economics", "environmental", "food", "further", "industrial", "land", "large", "level", "major", "materials", "nearly", "practices", "produce".... | EXACT TITLE in transportation_infrastructure: "Agriculture". | EXACT TITLE in cleaning_services: "Agriculture".
0.500
acquisitionadministrationapplicantsassetsbuildingbusinesscapitalcollectcommercialcontrolequipmentestatefinancialhomeindustrialinformationinspectionlandmaintenancemanage
SHARED TOKENS (34): "acquisition", "administration", "applicants", "assets", "building", "business", "capital", "collect", "commercial", "control", "equipment", "estate", "financial", "home", "industrial", "information", "inspection", "land", "maintenance", "manage".... | EXACT TITLE in cleaning_services: "Property management".
0.500
Mold ↗ Q159341 EXACT TITLE
certainconnectedfoodformformationgrowthlargemakingmaterialsnamenetworkproductionpropertysecondaryshapesinglespecificstructurestructuressurface
SHARED TOKENS (21): "certain", "connected", "food", "form", "formation", "growth", "large", "making", "materials", "name", "network", "production", "property", "secondary", "shape", "single", "specific", "structure", "structures", "surface".... | EXACT TITLE in cleaning_services: "Mold".
0.500
activebusinesscapitalcategorychangescontrolexpansionfinancefinancialfirmsgeneralinvestmentlimitedmanagementoperationalotherwiseownershippartnershipsprivateproduct
SHARED TOKENS (27): "active", "business", "capital", "category", "changes", "control", "expansion", "finance", "financial", "firms", "general", "investment", "limited", "management", "operational", "otherwise", "ownership", "partnerships", "private", "product".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
agenciesbuildingsbuiltcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalplace
SHARED TOKENS (25): "agencies", "buildings", "built", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "place".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanboardbusinessdailydirectlyfederalfoundedlimitedmetropolitannationalnearlynetworkoperateoperatesoperatorownedreportingrevenueroutes
SHARED TOKENS (25): "additional", "american", "board", "business", "daily", "directly", "federal", "founded", "limited", "metropolitan", "national", "nearly", "network", "operate", "operates", "operator", "owned", "reporting", "revenue", "routes".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
Hospital ↗ Q16917 EXACT TITLE
additionalcarecentercentersdepartmentdepartmentsdirectemergencyequipmentestablishedfacilitiesfacilityfoundedfunctionsgeneralgovernmenthealthhealthcarehomehospital
SHARED TOKENS (47): "additional", "care", "center", "centers", "department", "departments", "direct", "emergency", "equipment", "established", "facilities", "facility", "founded", "functions", "general", "government", "health", "healthcare", "home", "hospital".... | EXACT TITLE in transportation_infrastructure: "Hospital". | EXACT TITLE in cleaning_services: "Hospital".
0.500
agenciesapplybusinessesdesignfacilitiesgovernmentmoveneedsplanningpoliciesprivateprocesspublicsystemtransporttransportation
SHARED TOKENS (16): "agencies", "apply", "businesses", "design", "facilities", "government", "move", "needs", "planning", "policies", "private", "process", "public", "system", "transport", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
anotherapplicableauthoritybuildingbuiltchangescodescommercialcomplianceconstructiondepartmentdocumentevidencegovernmenthouseindustrialjurisdictionlawlocaloccupancy
SHARED TOKENS (31): "another", "applicable", "authority", "building", "built", "changes", "codes", "commercial", "compliance", "construction", "department", "document", "evidence", "government", "house", "industrial", "jurisdiction", "law", "local", "occupancy".... | EXACT TITLE in cleaning_services: "Certificate of occupancy".
0.500
Asbestos ↗ Q104085 EXACT TITLE
buildingbuildingsconditionsconstructioncontaincreatedecadeselectricalevidenceexposurehazardhealthmaterialperiodphysicalproducingsafety
SHARED TOKENS (17): "building", "buildings", "conditions", "construction", "contain", "create", "decades", "electrical", "evidence", "exposure", "hazard", "health", "material", "period", "physical", "producing", "safety". | EXACT TITLE in cleaning_services: "Asbestos".
0.500
accessagenciesbeyondcitiescustomersdailydevelopeddischargeeconomicextendsformformalgovernmentlocalmetropolitanoperateoperatesoperatorsorganizationsprivate
SHARED TOKENS (35): "access", "agencies", "beyond", "cities", "customers", "daily", "developed", "discharge", "economic", "extends", "form", "formal", "government", "local", "metropolitan", "operate", "operates", "operators", "organizations", "private".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
activityagenciesauthorizationbusinessdepartmentsdeterminesgovernmentjurisdictionlicenselicenseslocalmunicipalitiesoperateoperatingpermitsphysicalrequiressinglevary
SHARED TOKENS (19): "activity", "agencies", "authorization", "business", "departments", "determines", "government", "jurisdiction", "license", "licenses", "local", "municipalities", "operate", "operating", "permits", "physical", "requires", "single", "vary". | EXACT TITLE in cleaning_services: "Business license".
0.500
Ergonomics ↗ Q1750812 EXACT TITLE
amongapplicationappliescurrentdatadesignengineeringequipmentfieldgeneratehealthindustrialknowledgemethodsperformanceproductsresearchsafetyspecificsystem
SHARED TOKENS (24): "among", "application", "applies", "current", "data", "design", "engineering", "equipment", "field", "generate", "health", "industrial", "knowledge", "methods", "performance", "products", "research", "safety", "specific", "system".... | EXACT TITLE in cleaning_services: "Ergonomics".
0.480
Pedestrian ↗ Q221488 EXACT TITLE
americancitiescreatingearlynetworkprofessionalsafetysidewalksspeedtraffictransporturbanvehicleswider
SHARED TOKENS (14): "american", "cities", "creating", "early", "network", "professional", "safety", "sidewalks", "speed", "traffic", "transport", "urban", "vehicles", "wider". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.480
Fungicide ↗ Q193237 EXACT TITLE
activeagriculturecontactcontrolformhighlocallymethodsmovequalityresultingretailsurfacetissue
SHARED TOKENS (14): "active", "agriculture", "contact", "control", "form", "high", "locally", "methods", "move", "quality", "resulting", "retail", "surface", "tissue". | EXACT TITLE in cleaning_services: "Fungicide".
0.460
conditionseducationemergencyenforcementengineeringenvironmentknowledgemeasuresmethodspracticesresponsesurroundingthem
SHARED TOKENS (13): "conditions", "education", "emergency", "enforcement", "engineering", "environment", "knowledge", "measures", "methods", "practices", "response", "surrounding", "them". | EXACT TITLE in cleaning_services: "Fire prevention".
0.460
Upholstery ↗ Q1123578 EXACT TITLE
applicableautomobilebuildingcomescoveringdesignlayermakesmaterialsprovidingthoughuseswork
SHARED TOKENS (13): "applicable", "automobile", "building", "comes", "covering", "design", "layer", "makes", "materials", "providing", "though", "uses", "work". | EXACT TITLE in cleaning_services: "Upholstery".
0.460
associationcreatedenvironmentalfrequentlyindustriallandlandscapeserveservessurfaceurbanusersutility
SHARED TOKENS (13): "association", "created", "environmental", "frequently", "industrial", "land", "landscape", "serve", "serves", "surface", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.460
americanfieldintersectionpermitroadroutesstandardsurfacesystemthoughtraffictransportuses
SHARED TOKENS (13): "american", "field", "intersection", "permit", "road", "routes", "standard", "surface", "system", "though", "traffic", "transport", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.460
alonearrangementbusinessentitylegalnameownedownersprocessseparatespecificsubjectwork
SHARED TOKENS (13): "alone", "arrangement", "business", "entity", "legal", "name", "owned", "owners", "process", "separate", "specific", "subject", "work". | EXACT TITLE in cleaning_services: "Sole proprietorship".
0.460
Snowplow ↗ Q14976 EXACT TITLE
clearfrequentlylargereceiveservingsnowspecificsurfacestransportationtrucksvehiclevehicleswinter
SHARED TOKENS (13): "clear", "frequently", "large", "receive", "serving", "snow", "specific", "surfaces", "transportation", "trucks", "vehicle", "vehicles", "winter". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.460
amongapplieseducationemployeremploymenthistoryidentificationmethodsplaceprocessreferencesecurityvary
SHARED TOKENS (13): "among", "applies", "education", "employer", "employment", "history", "identification", "methods", "place", "process", "reference", "security", "vary". | EXACT TITLE in cleaning_services: "Background check".
0.440
Dairy ↗ Q637776 EXACT TITLE
buildingcomesconstitutededicateddescribesfoodindustryplaceproducesproductionproductsworkers
SHARED TOKENS (12): "building", "comes", "constitute", "dedicated", "describes", "food", "industry", "place", "produces", "production", "products", "workers". | EXACT TITLE in cleaning_services: "Dairy".
0.440
Broadband ↗ Q194163 EXACT TITLE
accessdatadifferenthighintegratedlevelnetworkrequirementssignalsspeedtechnologyuses
SHARED TOKENS (12): "access", "data", "different", "high", "integrated", "level", "network", "requirements", "signals", "speed", "technology", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.440
controlsdesigndifferentintersectionmajorotherwiseroadseparatespecifiedtrafficusesvehicles
SHARED TOKENS (12): "controls", "design", "different", "intersection", "major", "otherwise", "road", "separate", "specified", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in cleaning_services: "Intersection (road)".
0.420
administrationdepartmentdivisionfederalmajorofficeprogramprogramspublicroadtransportation
SHARED TOKENS (11): "administration", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.400
environmenthazardoushealthinternationallocalmaterialsnationalproducesregulatedwaste
SHARED TOKENS (10): "environment", "hazardous", "health", "international", "local", "materials", "national", "produces", "regulated", "waste". | EXACT TITLE in cleaning_services: "Hazardous waste".
0.400
Floodplain ↗ Q193110 EXACT TITLE
basecontroldevelopeddischargefrequentlyhighlandurbanvalleywater
SHARED TOKENS (10): "base", "control", "developed", "discharge", "frequently", "high", "land", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.380
Wastewater ↗ Q336191 EXACT TITLE
anotherapplicationscommercialindustrialmunicipalsewersurfacewastewater
SHARED TOKENS (9): "another", "applications", "commercial", "industrial", "municipal", "sewer", "surface", "waste", "water". | EXACT TITLE in cleaning_services: "Wastewater".
0.380
Glassdoor ↗ Q15954148 EXACT TITLE
americancurrentemployersemploymentindependentmobileoperateratingsreviews
SHARED TOKENS (9): "american", "current", "employers", "employment", "independent", "mobile", "operate", "ratings", "reviews". | EXACT TITLE in cleaning_services: "Glassdoor".
0.380
Sidewalk ↗ Q177749 EXACT TITLE
americanbuildingslandprivateroadsidesidewalksstreetvehicle
SHARED TOKENS (9): "american", "buildings", "land", "private", "road", "side", "sidewalks", "street", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk". | EXACT TITLE in cleaning_services: "Sidewalk".
0.380
Cleaning ↗ EXACT TITLE
activitydifferentenvironmentenvironmentalmethodsoccupationsprocesssafetyuses
SHARED TOKENS (9): "activity", "different", "environment", "environmental", "methods", "occupations", "process", "safety", "uses". | EXACT TITLE in cleaning_services: "Cleaning".
0.360
Utility ↗ Q466707 EXACT TITLE
amongcertaindevelopeddistincteconomicsfunctionfunctionsutility
SHARED TOKENS (8): "among", "certain", "developed", "distinct", "economics", "function", "functions", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in cleaning_services: "Utility".
0.360
boiseexpansionidahooperatingrestorationrouteservethough
SHARED TOKENS (8): "boise", "expansion", "idaho", "operating", "restoration", "route", "serve", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.360
airdesignmethodplanningpressurequalitysupplysystem
SHARED TOKENS (8): "air", "design", "method", "planning", "pressure", "quality", "supply", "system". | EXACT TITLE in transportation_infrastructure: "Duct (flow)". | EXACT TITLE in cleaning_services: "Duct (flow)".
0.360
Smoke ↗ Q130768 EXACT TITLE
aircontrolmaterialotherwiseproduceproductssignalstogether
SHARED TOKENS (8): "air", "control", "material", "otherwise", "produce", "products", "signals", "together". | EXACT TITLE in cleaning_services: "Smoke".
0.360
Restaurant ↗ Q11707 EXACT TITLE
businesscustomersfoodmodelsservedservessinglevary
SHARED TOKENS (8): "business", "customers", "food", "models", "served", "serves", "single", "vary". | EXACT TITLE in cleaning_services: "Restaurant".
0.360
Maid ↗ Q833860 EXACT TITLE
alongsidecategorydevelopedemploymentremainurbanwesternwork
SHARED TOKENS (8): "alongside", "category", "developed", "employment", "remain", "urban", "western", "work". | EXACT TITLE in cleaning_services: "Maid".
0.340
Detergent ↗ Q334637 EXACT TITLE
applicationcomponentsfurtherimproveproductthemwater
SHARED TOKENS (7): "application", "components", "further", "improve", "product", "them", "water". | EXACT TITLE in cleaning_services: "Detergent".
0.340
airamericanhomeofficeproductsrestorationwater
SHARED TOKENS (7): "air", "american", "home", "office", "products", "restoration", "water". | EXACT TITLE in cleaning_services: "Stanley Steemer".
0.340
HIV ↗ Q15787 EXACT TITLE
contactdirectexposurelevelresearchsystemtreatment
SHARED TOKENS (7): "contact", "direct", "exposure", "level", "research", "system", "treatment". | EXACT TITLE in transportation_infrastructure: "HIV". | EXACT TITLE in cleaning_services: "HIV".
0.340
controlsfallshazardsmakingpersonnelsurfacestraining
SHARED TOKENS (7): "controls", "falls", "hazards", "making", "personnel", "surfaces", "training". | EXACT TITLE in cleaning_services: "Fall protection".
0.320
Virucide ↗ Q3560867 EXACT TITLE
activitycategorydifferentlistphysicalsurface
SHARED TOKENS (6): "activity", "category", "different", "list", "physical", "surface". | EXACT TITLE in cleaning_services: "Virucide".
0.320
Bactericide ↗ Q804539 EXACT TITLE
materialphysicalsolelystructuresurfacesurfaces
SHARED TOKENS (6): "material", "physical", "solely", "structure", "surface", "surfaces". | EXACT TITLE in cleaning_services: "Bactericide".
0.320
aircontrolleddesigngaspowersystem
SHARED TOKENS (6): "air", "controlled", "design", "gas", "power", "system". | EXACT TITLE in cleaning_services: "Exhaust system".
0.320
Odor ↗ Q485537 EXACT TITLE
americanfoodfrequentlyindustrysystemterms
SHARED TOKENS (6): "american", "food", "frequently", "industry", "system", "terms". | EXACT TITLE in cleaning_services: "Odor".
0.300
anotherapplicationconditionsconstructioncontainedcreatedependenvironmentalfieldhazardoushealthimpactindustrylandmaterialmaterialsmediamunicipalphysicalpressure
SHARED TOKENS (30): "another", "application", "conditions", "construction", "contained", "create", "depend", "environmental", "field", "hazardous", "health", "impact", "industry", "land", "material", "materials", "media", "municipal", "physical", "pressure"....
0.300
accessdirecteconomicsgeneralinternationalitselflogisticsmaterialoperatingpracticesregionspecializedtransporttransportationvary
SHARED TOKENS (15): "access", "direct", "economics", "general", "international", "itself", "logistics", "material", "operating", "practices", "region", "specialized", "transport", "transportation", "vary".
0.300
associationconsumerdecadesdesigngrowthindustryintegratedlawlicensedmakingmarketmaterialmethodpowerproducingproductionreachresearchrevenuesales
SHARED TOKENS (26): "association", "consumer", "decades", "design", "growth", "industry", "integrated", "law", "licensed", "making", "market", "material", "method", "power", "producing", "production", "reach", "research", "revenue", "sales"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
automobilebecomebuildingcitiescommercialdensityenvironmentenvironmentalexistingexpansionformgrowthhousingindustrialinfrastructurelacklandlargeplanningpopulation
SHARED TOKENS (35): "automobile", "become", "building", "cities", "commercial", "density", "environment", "environmental", "existing", "expansion", "form", "growth", "housing", "industrial", "infrastructure", "lack", "land", "large", "planning", "population"....
0.300
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingbuildingscodesconstructiondepartmentdivisioneventhazardhazardsimpactincreasesmeasurespracticessafetyschoolsstructures
SHARED TOKENS (16): "building", "buildings", "codes", "construction", "department", "division", "event", "hazard", "hazards", "impact", "increases", "measures", "practices", "safety", "schools", "structures".
0.300
Facility management ↗ KW CROSS HIGH
buildingbuildingsdefineselectricalfacilitiesfacilityfieldinternationalmaintenancemanagementoperationsplanningrequirementssecuritysitesspacestandardstandardssupportsystem
SHARED TOKENS (22): "building", "buildings", "defines", "electrical", "facilities", "facility", "field", "international", "maintenance", "management", "operations", "planning", "requirements", "security", "sites", "space", "standard", "standards", "support", "system"....
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activecapableconditionscontactcontaincontrolequipmentfoodgashealthindustrialmakingmaterialsnameplacesprocessproductproductsreleasesthem
SHARED TOKENS (22): "active", "capable", "conditions", "contact", "contain", "control", "equipment", "food", "gas", "health", "industrial", "making", "materials", "name", "places", "process", "product", "products", "releases", "them"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
autoautomobilebrandconditionscustomersdetermineindependentinspectionmaintenanceneedsproposedrepairshowingsignsspecifictechnicianvehiclework
SHARED TOKENS (18): "auto", "automobile", "brand", "conditions", "customers", "determine", "independent", "inspection", "maintenance", "needs", "proposed", "repair", "showing", "signs", "specific", "technician", "vehicle", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
becomecentralcomesdesigndriverenvironmentfullintegrationintersectionmakesneedrequireresearchresultingroadrulessafetysignalssignsspeed
SHARED TOKENS (25): "become", "central", "comes", "design", "driver", "environment", "full", "integration", "intersection", "makes", "need", "require", "research", "resulting", "road", "rules", "safety", "signals", "signs", "speed"....
0.300
creatingdemandformfunctionsmedicalmobileneedsnetworkprivateprogramspublicratherrouteroutessharedtechnologytransportusersvehicles
SHARED TOKENS (19): "creating", "demand", "form", "functions", "medical", "mobile", "needs", "network", "private", "programs", "public", "rather", "route", "routes", "shared", "technology", "transport", "users", "vehicles".
0.300
adaboisecanyoncitiescountieshomeidahomeridianmetropolitannampanearlynorthwestpercentpopulationsectiontreasurevalleywider
SHARED TOKENS (18): "ada", "boise", "canyon", "cities", "counties", "home", "idaho", "meridian", "metropolitan", "nampa", "nearly", "northwest", "percent", "population", "section", "treasure", "valley", "wider".
0.300
americanbusinessbusinessescommercecommunitiescontaincurrentdatadepartmentdepartmentseconomiceconomyfederalgovernmenthospitalshouseinformationinfrastructurelocalmaking
SHARED TOKENS (27): "american", "business", "businesses", "commerce", "communities", "contain", "current", "data", "department", "departments", "economic", "economy", "federal", "government", "hospitals", "house", "information", "infrastructure", "local", "making"....
0.300
americanbuiltbusinessescenterscentralchangescitieseconomicenvironmentalexpansionformationgrowthmodelpopulationprocessshifturban
SHARED TOKENS (17): "american", "built", "businesses", "centers", "central", "changes", "cities", "economic", "environmental", "expansion", "formation", "growth", "model", "population", "process", "shift", "urban".
0.300
amongcontactcontaincontroldeterminedirectlyevenhealthidentifiedmeansmedicalratherstandardthoughworkers
SHARED TOKENS (15): "among", "contact", "contain", "control", "determine", "directly", "even", "health", "identified", "means", "medical", "rather", "standard", "though", "workers".
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcitiescommunitiesconnectingdifferentdistrictshourmetropolitanoperateoperatespricingregionalsystemstransporturban
SHARED TOKENS (16): "business", "central", "cities", "communities", "connecting", "different", "districts", "hour", "metropolitan", "operate", "operates", "pricing", "regional", "systems", "transport", "urban".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
classesclassificationscontroldriverenforcementeventhealthidentifiedimpactimprovelevelmeasuresmethodsoccupationalpracticesproduceprovidingpublicremainrequiring
SHARED TOKENS (35): "classes", "classifications", "control", "driver", "enforcement", "event", "health", "identified", "impact", "improve", "level", "measures", "methods", "occupational", "practices", "produce", "providing", "public", "remain", "requiring"....
0.300
actadministrationappliesapplyenvironmentalepafederalfoodimplementlawprivateprovidingpublicqualityregulatedservedstandardssupplierssystemsystems
SHARED TOKENS (21): "act", "administration", "applies", "apply", "environmental", "epa", "federal", "food", "implement", "law", "private", "providing", "public", "quality", "regulated", "served", "standards", "suppliers", "system", "systems"....
0.300
buildingbusinesscentercentraldedicatedformgrowthintegratedlandnetworkplanningprivatepublicresidentialscaleservingspacetransporturban
SHARED TOKENS (19): "building", "business", "center", "central", "dedicated", "form", "growth", "integrated", "land", "network", "planning", "private", "public", "residential", "scale", "serving", "space", "transport", "urban".
0.300
certainchangesprocessshapewater
SHARED TOKENS (5): "certain", "changes", "process", "shape", "water". | EXACT TITLE in cleaning_services: "Dry cleaning".
0.300
brandconsumerdatadifferentdocumentenvironmentalgeneralhazardhazardshealthinformationinstructionslistsmaterialnamenationaloccupationalproceduresproductproducts
SHARED TOKENS (25): "brand", "consumer", "data", "different", "document", "environmental", "general", "hazard", "hazards", "health", "information", "instructions", "lists", "material", "name", "national", "occupational", "procedures", "product", "products"....
0.300
becomechangesdesignengineeringimprovemeasuresphysicalroadrulesafetysignsspeedsurfacetrafficurbanuses
SHARED TOKENS (16): "become", "changes", "design", "engineering", "improve", "measures", "physical", "road", "rule", "safety", "signs", "speed", "surface", "traffic", "urban", "uses".
0.300
administrationairamericananotherbuildingcenterscommercialconstructiondepartmentdistributiondivisiondrivereconomyeducationenvironmentalfederalgoverninggovernshandlinghealth
SHARED TOKENS (53): "administration", "air", "american", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "driver", "economy", "education", "environmental", "federal", "governing", "governs", "handling", "health"....
0.300
Health care ↗ Q31207 KW CROSS HIGH
abilityaccessadditionalaffectbasecarecommunitiesconditionsconstitutecoverageeconomiceconomyestablishedfacilitiesfinancialgeneralhealthhealthcarehistoryinformation
SHARED TOKENS (47): "ability", "access", "additional", "affect", "base", "care", "communities", "conditions", "constitute", "coverage", "economic", "economy", "established", "facilities", "financial", "general", "health", "healthcare", "history", "information"....
0.300
actagainstagenciesauthoritycomplianceconsumerscontrolenvironmentenvironmentalepaexpandedfederalframeworkgoverninghealthlawprocessproductsregistrationregulated
SHARED TOKENS (24): "act", "against", "agencies", "authority", "compliance", "consumers", "control", "environment", "environmental", "epa", "expanded", "federal", "framework", "governing", "health", "law", "process", "products", "registration", "regulated"....
0.300
collegeeconomiceducationformalfurthergeneralknowledgelevelmethodsoccupationsplaceschoolschoolsspecializedspecifictechnicaltechnologytraining
SHARED TOKENS (18): "college", "economic", "education", "formal", "further", "general", "knowledge", "level", "methods", "occupations", "place", "school", "schools", "specialized", "specific", "technical", "technology", "training".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecertaincreateddifferentestatefacilityfullgovernmentlandlegallocaloperateotherwiseownershipphysicalprivaterealroadroute
SHARED TOKENS (29): "authority", "capable", "certain", "created", "different", "estate", "facility", "full", "government", "land", "legal", "local", "operate", "otherwise", "ownership", "physical", "private", "real", "road", "route"....
0.300
actamericanapplicableassociationauthoritycentralchangescitiescommunitiesconditionscreatingdependdependsdesigndistrictseconomicenvironmentalexposurefacilitiesfounded
SHARED TOKENS (46): "act", "american", "applicable", "association", "authority", "central", "changes", "cities", "communities", "conditions", "creating", "depend", "depends", "design", "districts", "economic", "environmental", "exposure", "facilities", "founded"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
architecturebecomecitiescommunitiescompetitivecreatecreatescurrentdecadesdescribesdevelopedeconomiceconomicseducationenvironmentalgenerategeographygrowthhealthimpact
SHARED TOKENS (48): "architecture", "become", "cities", "communities", "competitive", "create", "creates", "current", "decades", "describes", "developed", "economic", "economics", "education", "environmental", "generate", "geography", "growth", "health", "impact"....
0.300
anotherautomobilebecomecapacitydemanddensitydepartmentshighplanningpublicresultingroadroutespeedtraffictransporttransportationurbanvehicles
SHARED TOKENS (19): "another", "automobile", "become", "capacity", "demand", "density", "departments", "high", "planning", "public", "resulting", "road", "route", "speed", "traffic", "transport", "transportation", "urban", "vehicles".
0.300
actadministrationcodeconditionscreatedemployersenvironmentexposurefederalgoverninggovernmenthazardshealthinstitutelaborlawnationaloccupationalprivatesafety
SHARED TOKENS (20): "act", "administration", "code", "conditions", "created", "employers", "environment", "exposure", "federal", "governing", "government", "hazards", "health", "institute", "labor", "law", "national", "occupational", "private", "safety".
0.300
associationavailabilitybusinessbusinessescertaincorporatedifferentdistinctdocumententityformincorporatedlegalliabilitylicenselimitedmedicaloperatingoperationsowners
SHARED TOKENS (33): "association", "availability", "business", "businesses", "certain", "corporate", "different", "distinct", "document", "entity", "form", "incorporated", "legal", "liability", "license", "limited", "medical", "operating", "operations", "owners"....
0.300
alongsideamericancapacitycapitalcitiesconnectingconventionaldailydedicateddesignnetworkpublicqualitysinglespeedsystemsystemstraffictransportation
SHARED TOKENS (19): "alongside", "american", "capacity", "capital", "cities", "connecting", "conventional", "daily", "dedicated", "design", "network", "public", "quality", "single", "speed", "system", "systems", "traffic", "transportation".
0.300
accessactadministrationbusinessbusinessescapitalcenterscertaincommunitiesconnectcontractsdirectoryeconomiceconomyfederalfranchisegovernmentindependentjanuarymaking
SHARED TOKENS (29): "access", "act", "administration", "business", "businesses", "capital", "centers", "certain", "communities", "connect", "contracts", "directory", "economic", "economy", "federal", "franchise", "government", "independent", "january", "making"....
0.300
advancedapplicationcapacitychangesconditionsdifferentemergencyfieldimproveinformationinfrastructuremanagementroadsafetysignsspeedsystemsystemstechnologytraffic
SHARED TOKENS (24): "advanced", "application", "capacity", "changes", "conditions", "different", "emergency", "field", "improve", "information", "infrastructure", "management", "road", "safety", "signs", "speed", "system", "systems", "technology", "traffic"....
0.300
anticipatedcreatingdepartmentdifferentdividedevenpathwaypermitroutesharedsidewalkssurfacetransporttravelurbanusers
SHARED TOKENS (16): "anticipated", "creating", "department", "different", "divided", "even", "pathway", "permit", "route", "shared", "sidewalks", "surface", "transport", "travel", "urban", "users".
0.300
americancreateddriverevenfacilitiesgovernintersectionlargeotherwiseplacepointsroadrulessafetyschoolseparatesignalssignsspeedstreet
SHARED TOKENS (26): "american", "created", "driver", "even", "facilities", "govern", "intersection", "large", "otherwise", "place", "points", "road", "rules", "safety", "school", "separate", "signals", "signs", "speed", "street"....
0.300
Dentistry ↗ Q12128 KW CROSS HIGH
affectarrangementavoidcarecertainconditionsevidencefocusedhistoryhospitalsinstitutionsmanagementmedicalpracticespractitionerprivatereconstructionrequireresearchsecondary
SHARED TOKENS (25): "affect", "arrangement", "avoid", "care", "certain", "conditions", "evidence", "focused", "history", "hospitals", "institutions", "management", "medical", "practices", "practitioner", "private", "reconstruction", "require", "research", "secondary"....
0.300
appliesassociationdefinesdocumentationenvironmentalidentifyingimpactinternationaljustifymajormakingmanagementmoveplanplanspoliciespolicyprocessprogramproject
SHARED TOKENS (27): "applies", "association", "defines", "documentation", "environmental", "identifying", "impact", "international", "justify", "major", "making", "management", "move", "plan", "plans", "policies", "policy", "process", "program", "project"....
0.300
accessadvancedamericanautomobilebuiltcapacitycentralchangescitiesclassconnectconnectedconnectingdecadesevennetworkplanspropertyproposedreach
SHARED TOKENS (35): "access", "advanced", "american", "automobile", "built", "capacity", "central", "changes", "cities", "class", "connect", "connected", "connecting", "decades", "even", "network", "plans", "property", "proposed", "reach"....
0.300
affectanotherbodieschangesconditionscontrolformimpactindustrialinfrastructuremanagementplanspowerproblemsproductsrequiresresourcesurfacetechnologytreatment
SHARED TOKENS (23): "affect", "another", "bodies", "changes", "conditions", "control", "form", "impact", "industrial", "infrastructure", "management", "plans", "power", "problems", "products", "requires", "resource", "surface", "technology", "treatment"....
0.300
affectagainstarrangementcoveragecoveredcreateddedicatedevenexpresslygeneralinsurancelegalliabilityotherwisepoliciespolicyratherrisksrulespecific
SHARED TOKENS (23): "affect", "against", "arrangement", "coverage", "covered", "created", "dedicated", "even", "expressly", "general", "insurance", "legal", "liability", "otherwise", "policies", "policy", "rather", "risks", "rule", "specific"....
0.300
amongcoveragecreatedeconomicemployeeemployeremployersemploymentformgeneralhealthhighinsurancelackliabilitylimitedmedicalplaceplansproblems
SHARED TOKENS (25): "among", "coverage", "created", "economic", "employee", "employer", "employers", "employment", "form", "general", "health", "high", "insurance", "lack", "liability", "limited", "medical", "place", "plans", "problems"....
0.300
Child care ↗ Q1455871 KW CROSS HIGH
accessadvancedanotherbroadcarecenterscommunitiesdailyearlyeconomiceducationfacilityfocusedformhousinginstitutionslaborlicensedorganizationsprofessional
SHARED TOKENS (30): "access", "advanced", "another", "broad", "care", "centers", "communities", "daily", "early", "economic", "education", "facility", "focused", "form", "housing", "institutions", "labor", "licensed", "organizations", "professional"....
0.300
Ammonia ↗ Q4087 KW CROSS HIGH
agriculturebuildingdirectlyenergyevenformgashazardousindustrialneedspressureprocessproductionprovidingroadservingsystemswastewater
SHARED TOKENS (19): "agriculture", "building", "directly", "energy", "even", "form", "gas", "hazardous", "industrial", "needs", "pressure", "process", "production", "providing", "road", "serving", "systems", "waste", "water".
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciesamericancanyoncentralcommercialconstructioncontrolcoveredcreateddecadesdevelopeddownstreamdrainsfallsfurtherhighhistoryidahoinlandlarge
SHARED TOKENS (37): "agencies", "american", "canyon", "central", "commercial", "construction", "control", "covered", "created", "decades", "developed", "downstream", "drains", "falls", "further", "high", "history", "idaho", "inland", "large"....
0.300
accessactclassificationcreatedcurrentdataemployeeemployersenforcementfederalfullhandlinghazardhazardoushazardshealthmakingprocessproductproducts
SHARED TOKENS (30): "access", "act", "classification", "created", "current", "data", "employee", "employers", "enforcement", "federal", "full", "handling", "hazard", "hazardous", "hazards", "health", "making", "process", "product", "products"....
0.300
capablecarecontactcontaineddistinctemergencyenvironmentenvironmentalfacilitiesgeneralgeneratehazardoushealthhealthcarehomehospitalhospitalsindustrialmaterialmaterials
SHARED TOKENS (29): "capable", "care", "contact", "contained", "distinct", "emergency", "environment", "environmental", "facilities", "general", "generate", "hazardous", "health", "healthcare", "home", "hospital", "hospitals", "industrial", "material", "materials"....
0.300
affectagricultureanalysisapplicationboundarydifferentedgehazardshealthlandmakingmanagementmeansmethodsmodelmodelsmonitoringproducespublicquality
SHARED TOKENS (31): "affect", "agriculture", "analysis", "application", "boundary", "different", "edge", "hazards", "health", "land", "making", "management", "means", "methods", "model", "models", "monitoring", "produces", "public", "quality"....
0.300
connectsconsumerscurrentcustomersdirectdirectlydistinctdistributionelectricalelectricityenergyevenformhandlingindustrylevellocalmajormarketnetwork
SHARED TOKENS (27): "connects", "consumers", "current", "customers", "direct", "directly", "distinct", "distribution", "electrical", "electricity", "energy", "even", "form", "handling", "industry", "level", "local", "major", "market", "network"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycontrolelectricityinformationintersectionlevellocalnationalneedroadsignalssystemsystemstechnologytrafficusers
SHARED TOKENS (17): "advanced", "capacity", "control", "electricity", "information", "intersection", "level", "local", "national", "need", "road", "signals", "system", "systems", "technology", "traffic", "users".
0.300
airbuildingcertainconditionscreatesenvironmentevengashazardhazardoushealthidentificationmaterialspersonnelphysicalpropertypublicregulationsriskssafety
SHARED TOKENS (27): "air", "building", "certain", "conditions", "creates", "environment", "even", "gas", "hazard", "hazardous", "health", "identification", "materials", "personnel", "physical", "property", "public", "regulations", "risks", "safety"....
0.300
centerclasscreatefoundeditselfnetworkoperatesoperatingplansprojectreachreportingroadrouteroutessystemtransportationwestern
SHARED TOKENS (18): "center", "class", "create", "founded", "itself", "network", "operates", "operating", "plans", "project", "reach", "reporting", "road", "route", "routes", "system", "transportation", "western".
0.300
accessactadditionaladministrationavoidbuiltconstructioncontrolledcreatingdecadesdesigndevelopedestablishedextendsfederalgeneralgovernmentitselfnationalnationally
SHARED TOKENS (43): "access", "act", "additional", "administration", "avoid", "built", "construction", "controlled", "creating", "decades", "design", "developed", "established", "extends", "federal", "general", "government", "itself", "national", "nationally"....
0.300
actadministrationairamongbuildingcarecentercenterscontrolcreateddepartmentdistinctdivisionemergingengineeringexposurefederalfieldfoundedfunctions
SHARED TOKENS (47): "act", "administration", "air", "among", "building", "care", "center", "centers", "control", "created", "department", "distinct", "division", "emerging", "engineering", "exposure", "federal", "field", "founded", "functions"....
0.300
academicamongcareconnectscontroldepartmentexpandedhealthhealthcarehospitalinfrastructurelocalmeasuresmedicalmonitoringpublicrathersafetyselectionsystem
SHARED TOKENS (21): "academic", "among", "care", "connects", "control", "department", "expanded", "health", "healthcare", "hospital", "infrastructure", "local", "measures", "medical", "monitoring", "public", "rather", "safety", "selection", "system"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationairanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescodescommunitiescreatingdesigndifferentdistributionearlyeconomic
SHARED TOKENS (62): "administration", "air", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "codes", "communities", "creating", "design", "different", "distribution", "early", "economic"....
0.300
activityanalysisboundariesdesigndocumentationengineeringenvironmentestablishedgeneralgovernmentlegallicenselicensedlocalmaintenanceplanspractitionersprocessproductproducts
SHARED TOKENS (32): "activity", "analysis", "boundaries", "design", "documentation", "engineering", "environment", "established", "general", "government", "legal", "license", "licensed", "local", "maintenance", "plans", "practitioners", "process", "product", "products"....
0.300
academiccollegedifferenteducationformhighinstitutionsopenpolicyprogramsschoolsecondarysenioruniversityworkforce
SHARED TOKENS (15): "academic", "college", "different", "education", "form", "high", "institutions", "open", "policy", "programs", "school", "secondary", "senior", "university", "workforce".
0.300
administersagriculturebudgetcommercialcommunitiescurrentdepartmentdirectlyfederalfoodgovernmentnationalneedsproductionprogramprogramsreportssafetyservedtogether
SHARED TOKENS (20): "administers", "agriculture", "budget", "commercial", "communities", "current", "department", "directly", "federal", "food", "government", "national", "needs", "production", "program", "programs", "reports", "safety", "served", "together".
0.300
advancedapplicationavailabilitybusinessescentralizedcitiesconnectedconstructiondemanddesigndevelopeddifferentdischargedrainageenergyenvironmentevenfieldindustrialland
SHARED TOKENS (44): "advanced", "application", "availability", "businesses", "centralized", "cities", "connected", "construction", "demand", "design", "developed", "different", "discharge", "drainage", "energy", "environment", "even", "field", "industrial", "land"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactadditionaladministrationagenciesauthoritiesauthorizesbusinesscannotcleancontrolscreateddepartmentdetermineearlyenvironmentenvironmentalepaestablishedexposure
SHARED TOKENS (60): "acquisition", "act", "additional", "administration", "agencies", "authorities", "authorizes", "business", "cannot", "clean", "controls", "created", "department", "determine", "early", "environment", "environmental", "epa", "established", "exposure"....
0.300
airbuildingbuildingscontroldesignelectricalenergyenvironmentalimpactmaintenanceoperatingperformancequalityregulatesystemstechnologyvehicleswater
SHARED TOKENS (18): "air", "building", "buildings", "control", "design", "electrical", "energy", "environmental", "impact", "maintenance", "operating", "performance", "quality", "regulate", "systems", "technology", "vehicles", "water".
0.300
avoidbuildingscommercialdirectlydrainsindustrialinfrastructuremunicipalitiesseparateservedservingsewersurfacesystemsystemstransporttreatmenturban
SHARED TOKENS (18): "avoid", "buildings", "commercial", "directly", "drains", "industrial", "infrastructure", "municipalities", "separate", "served", "serving", "sewer", "surface", "system", "systems", "transport", "treatment", "urban".
0.300
Nursing home ↗ Q837142 KW CROSS HIGH
americanassociationcarecovereddailydifferentemergencyfacilitiesfacilityhomehospitalinstitutionsinsurancemedicalnearlyneedneedsoccupationalphysicalprivate
SHARED TOKENS (25): "american", "association", "care", "covered", "daily", "different", "emergency", "facilities", "facility", "home", "hospital", "institutions", "insurance", "medical", "nearly", "need", "needs", "occupational", "physical", "private"....
0.300
actactiveagenciesairauthoritybudgetbuildingbusinesscapacitycleancomponentsconstituteconstructioncontroldepartmentdesigndirectdirectlyeconomyenergy
SHARED TOKENS (59): "act", "active", "agencies", "air", "authority", "budget", "building", "business", "capacity", "clean", "components", "constitute", "construction", "control", "department", "design", "direct", "directly", "economy", "energy"....
0.300
engineeringfieldnetworktraffictransportation
SHARED TOKENS (5): "engineering", "field", "network", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
actadministrationapplyassetsauthoritiesauthorizationbusinessbusinessescertificationgovernmenthomeindustryinspectionlargelicensemeasuresmedicalmethodsnetoperate
SHARED TOKENS (39): "act", "administration", "apply", "assets", "authorities", "authorization", "business", "businesses", "certification", "government", "home", "industry", "inspection", "large", "license", "measures", "medical", "methods", "net", "operate"....
0.300
appliesdescribesdischargeenvironmentfacilitiesfoodgasgenerateheavyhighindustrialindustrymanufacturingmaterialsmunicipalpowerpreservingprocessproduceproduction
SHARED TOKENS (28): "applies", "describes", "discharge", "environment", "facilities", "food", "gas", "generate", "heavy", "high", "industrial", "industry", "manufacturing", "materials", "municipal", "power", "preserving", "process", "produce", "production"....
0.300
actadministrationconditionsdepartmenteducationemploymentestablishedfederalhealthlaborlawoccupationalprovidingratingsregulationsregulatorysafetysalesstandardstraining
SHARED TOKENS (20): "act", "administration", "conditions", "department", "education", "employment", "established", "federal", "health", "labor", "law", "occupational", "providing", "ratings", "regulations", "regulatory", "safety", "sales", "standards", "training".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherarrangementbrandbusinesscapitalcertaincompeteconditionscorporatedirecteconomicentityexpansionexplicitlyfinancialfranchisegrowthinvestmentlargelegal
SHARED TOKENS (38): "another", "arrangement", "brand", "business", "capital", "certain", "compete", "conditions", "corporate", "direct", "economic", "entity", "expansion", "explicitly", "financial", "franchise", "growth", "investment", "large", "legal"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbuildingsconnectevenexpandedfeefullfunctionsgovernmentimpactlandlegalmunicipalitiesownersownershippowerprivateproperty
SHARED TOKENS (27): "acquisition", "another", "application", "buildings", "connect", "even", "expanded", "fee", "full", "functions", "government", "impact", "land", "legal", "municipalities", "owners", "ownership", "power", "private", "property"....
0.300
Pesticide ↗ Q131656 EXACT TITLE
controlgeneralotherwiseproductsproperty
SHARED TOKENS (5): "control", "general", "otherwise", "products", "property". | EXACT TITLE in cleaning_services: "Pesticide".
0.300
Domestic worker ↗ Q54128 KW CROSS HIGH
appliescarecategorydevelopedemployeremploymenthomelargelimitedmaintenancemanagementoccupationalperiodplaceprovidingregulatedsubjectsystemthoughwhose
SHARED TOKENS (22): "applies", "care", "category", "developed", "employer", "employment", "home", "large", "limited", "maintenance", "management", "occupational", "period", "place", "providing", "regulated", "subject", "system", "though", "whose"....
0.300
additionaladvancedagenciesauthoritiesbusinessescarecertaincontactdepartmentdispatchemergencyfacilitieshospitalmedicalmodeloperatepatientpersonnelplacesproviding
SHARED TOKENS (35): "additional", "advanced", "agencies", "authorities", "businesses", "care", "certain", "contact", "department", "dispatch", "emergency", "facilities", "hospital", "medical", "model", "operate", "patient", "personnel", "places", "providing"....
0.300
administrationagenciesamongchangescommunitiescompliancecontrolcurrentdefinesdepartmentdesigndevelopeddocumentfederallawlocalnationalopenownedpublic
SHARED TOKENS (32): "administration", "agencies", "among", "changes", "communities", "compliance", "control", "current", "defines", "department", "design", "developed", "document", "federal", "law", "local", "national", "open", "owned", "public"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotconnectdesigndrainagedrainsevenfallshazardousheavyinfrastructurelargemanagemunicipalpropertypublicreceiverequireresidential
SHARED TOKENS (29): "bodies", "buildings", "cannot", "connect", "design", "drainage", "drains", "even", "falls", "hazardous", "heavy", "infrastructure", "large", "manage", "municipal", "property", "public", "receive", "require", "residential"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdifferentformheavyoperateoperatesoperatingoperationssectionspeedstocksystemsystemstechnologytogethertrafficurban
SHARED TOKENS (21): "broader", "capability", "capacity", "conditions", "different", "form", "heavy", "operate", "operates", "operating", "operations", "section", "speed", "stock", "system", "systems", "technology", "together", "traffic", "urban"....
0.300
Boise River ↗ Q891080 EXACT TITLE
boisedrainsidahourbanwestern
SHARED TOKENS (5): "boise", "drains", "idaho", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.300
administersadministrationbuildingconditionsdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgoverninggovernmenthealthhistoryhourimplementimprovelaboroccupational
SHARED TOKENS (27): "administers", "administration", "building", "conditions", "department", "departments", "directly", "economic", "employers", "employment", "federal", "governing", "government", "health", "history", "hour", "implement", "improve", "labor", "occupational"....
0.300
accessdesigneconomicenvironmentalhealthhomepolicypractitionerspublicrequiressafetytraffictransportationtravelurbanusers
SHARED TOKENS (16): "access", "design", "economic", "environmental", "health", "home", "policy", "practitioners", "public", "requires", "safety", "traffic", "transportation", "travel", "urban", "users".
0.300
Oversize load ↗ Q680421 KW CROSS HIGH
airconstructionequipmentheavyindustrialinfrastructurelargelegalordinaryroadsizespecifiedstandardtransporttransportationtruckwater
SHARED TOKENS (17): "air", "construction", "equipment", "heavy", "industrial", "infrastructure", "large", "legal", "ordinary", "road", "size", "specified", "standard", "transport", "transportation", "truck", "water".
0.300
processpropertyrestorationstructuralwater
SHARED TOKENS (5): "process", "property", "restoration", "structural", "water". | EXACT TITLE in cleaning_services: "Disaster restoration".
0.300
adaamericanarchitectureboisebuildingcapitalconstructiondepartmentdesignfederalformationgovernmenthomeidaholistsmaterialsnationalplacesregisterserved
SHARED TOKENS (23): "ada", "american", "architecture", "boise", "building", "capital", "construction", "department", "design", "federal", "formation", "government", "home", "idaho", "lists", "materials", "national", "places", "register", "served"....
🫐 BERRY43 edges
0.290
industrialmaterialsregulatedrequiretransporttreatmentwaste
SHARED TOKENS (7): "industrial", "materials", "regulated", "require", "transport", "treatment", "waste". | URL->B (1): https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030.
0.280
Hoarding ↗ Q1343347 EXACT TITLE
acquisitionactotherwisespace
SHARED TOKENS (4): "acquisition", "act", "otherwise", "space". | EXACT TITLE in cleaning_services: "Hoarding".
0.280
aircreategasuses
SHARED TOKENS (4): "air", "create", "gas", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.280
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralidahointersectionmajornationalnorthwestofficialparallelroadrouterulesthroughoutwestern
SHARED TOKENS (14): "caldwell", "general", "idaho", "intersection", "major", "national", "northwest", "official", "parallel", "road", "route", "rules", "throughout", "western".
0.280
applicationsindustrialjetuses
SHARED TOKENS (4): "applications", "industrial", "jet", "uses". | EXACT TITLE in cleaning_services: "Steam cleaning".
0.280
contactdirectenergyequipmenthazardousidentifyinglawmaintenancemethodpowerrepairrequiressafetywork
SHARED TOKENS (14): "contact", "direct", "energy", "equipment", "hazardous", "identifying", "law", "maintenance", "method", "power", "repair", "requires", "safety", "work".
0.280
actappliescommercecoveragecreatesemployeremploymentlaborlawproductionprohibitsstandardswagework
SHARED TOKENS (14): "act", "applies", "commerce", "coverage", "creates", "employer", "employment", "labor", "law", "production", "prohibits", "standards", "wage", "work".
0.280
amongcertaincontactequipmentexposurehazardhazardoushazardshealthhighmaterialsoccupationalpressureseparately
SHARED TOKENS (14): "among", "certain", "contact", "equipment", "exposure", "hazard", "hazardous", "hazards", "health", "high", "materials", "occupational", "pressure", "separately".
0.260
methodsprocesswater
SHARED TOKENS (3): "methods", "process", "water". | EXACT TITLE in cleaning_services: "Carpet cleaning".
0.260
academicapplicationdesignengineeringfacilitiesfieldmanagementoccupationaloperationplanningtechnologytransporttransportation
SHARED TOKENS (13): "academic", "application", "design", "engineering", "facilities", "field", "management", "occupational", "operation", "planning", "technology", "transport", "transportation".
0.240
Idaho Legislature ↗ KW CROSS HIGH
boisechambersdatadistrictsdividedevengovernmenthouseidahopopulationsinglesubsequent
SHARED TOKENS (12): "boise", "chambers", "data", "districts", "divided", "even", "government", "house", "idaho", "population", "single", "subsequent".
0.240
accesscommercialequipmentformallicensinglightingnationallyregulationsstructuraltechnologyvarywork
SHARED TOKENS (12): "access", "commercial", "equipment", "formal", "licensing", "lighting", "nationally", "regulations", "structural", "technology", "vary", "work".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemarketingmetropolitanpublicroadsignssystemtransportvehiclevehicles
SHARED TOKENS (12): "cities", "connections", "large", "marketing", "metropolitan", "public", "road", "signs", "system", "transport", "vehicle", "vehicles".
0.240
commercialdriverhazardousheavylargelicensematerialsoperatesizetrucksvehiclevehicles
SHARED TOKENS (12): "commercial", "driver", "hazardous", "heavy", "large", "license", "materials", "operate", "size", "trucks", "vehicle", "vehicles".
0.240
americandepartmentdepartmentsdirectlyeconomyfederalgovernmentplanreportsservingsystemtransportation
SHARED TOKENS (12): "american", "department", "departments", "directly", "economy", "federal", "government", "plan", "reports", "serving", "system", "transportation".
0.240
constructiondesignengineeringmaintenancematerialsoperationplanningprofessionalstandardsstructuraltraffictransportation
SHARED TOKENS (12): "construction", "design", "engineering", "maintenance", "materials", "operation", "planning", "professional", "standards", "structural", "traffic", "transportation".
0.220
airamericancommercialenvironmentinternationallandlogisticsphysicalprocessproductstransport
SHARED TOKENS (11): "air", "american", "commercial", "environment", "international", "land", "logistics", "physical", "process", "products", "transport".
0.220
comhousing
SHARED TOKENS (2): "com", "housing". | EXACT TITLE in cleaning_services: "Short-term rental".
0.220
boisecenterfoundedhealthhealthcarehospitalhospitalsidahomedicalregionalsystem
SHARED TOKENS (11): "boise", "center", "founded", "health", "healthcare", "hospital", "hospitals", "idaho", "medical", "regional", "system".
0.220
airelectricalenergyengineeringfacilityfoundedlandscapelightingmanagementprovidertransportation
SHARED TOKENS (11): "air", "electrical", "energy", "engineering", "facility", "founded", "landscape", "lighting", "management", "provider", "transportation".
0.220
boisecitiesfallshomeidahomajormetropolitannorthwestrouteroutesserves
SHARED TOKENS (11): "boise", "cities", "falls", "home", "idaho", "major", "metropolitan", "northwest", "route", "routes", "serves".
0.200
accessconnectinglocalmajormoveresidentialroadservestrafficwider
SHARED TOKENS (10): "access", "connecting", "local", "major", "move", "residential", "road", "serves", "traffic", "wider".
0.200
handlingitselfmethodroadsecuritytransporttransportationtrucktruckingvehicle
SHARED TOKENS (10): "handling", "itself", "method", "road", "security", "transport", "transportation", "truck", "trucking", "vehicle".
0.200
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentryimproveresearchroadsafetyshowstrafficvehicles
SHARED TOKENS (10): "businesses", "economic", "entry", "improve", "research", "road", "safety", "shows", "traffic", "vehicles".
0.180
chartercitiescountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (9): "charter", "cities", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.180
broadcategoryestateeventfoodindustryplanningrealtravel
SHARED TOKENS (9): "broad", "category", "estate", "event", "food", "industry", "planning", "real", "travel".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "western".
0.160
affectdevelopedhazardhealthmaterialmaterialsproductsrisks
SHARED TOKENS (8): "affect", "developed", "hazard", "health", "material", "materials", "products", "risks".
0.160
actfederalgoverninghazardouslawrecoveryresourcewaste
SHARED TOKENS (8): "act", "federal", "governing", "hazardous", "law", "recovery", "resource", "waste".
0.160
Waste collection ↗ KW CROSS HIGH
facilitymanagementmaterialsmunicipalprocessprogramtreatmentwaste
SHARED TOKENS (8): "facility", "management", "materials", "municipal", "process", "program", "treatment", "waste".
0.160
canyonconnectingeagleidahomarsingmeridiannampavalley
SHARED TOKENS (8): "canyon", "connecting", "eagle", "idaho", "marsing", "meridian", "nampa", "valley".
0.140
codefoodmunicipalmunicipalitiespublicseparatelywaste
SHARED TOKENS (7): "code", "food", "municipal", "municipalities", "public", "separately", "waste".
0.120
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
idahointersectionlimitedroutesystemwestern
SHARED TOKENS (6): "idaho", "intersection", "limited", "route", "system", "western".
0.120
adaconnectingcountiesidahoroutestar
SHARED TOKENS (6): "ada", "connecting", "counties", "idaho", "route", "star".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "small".
0.120
Mildew ↗ Q1220207 KW CROSS HIGH
airdistinctformgrowthproducesurfaces
SHARED TOKENS (6): "air", "distinct", "form", "growth", "produce", "surfaces".
0.120
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahomelbametropolitanpopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "melba", "metropolitan", "population".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
canyonestablishedgreenleafidahometropolitanpopulation
SHARED TOKENS (6): "canyon", "established", "greenleaf", "idaho", "metropolitan", "population".
0.100
gardenidahoroutetreasurevalley
SHARED TOKENS (5): "garden", "idaho", "route", "treasure", "valley".
0.100
citiesidaholandmajornorthwest
SHARED TOKENS (5): "cities", "idaho", "land", "major", "northwest".
0.100
Kitchen hood ↗ Q1164342 KW CROSS HIGH
aircommercialhomeproductssystem
SHARED TOKENS (5): "air", "commercial", "home", "products", "system".
0.100
actlandmethodsitewaste
SHARED TOKENS (5): "act", "land", "method", "site", "waste".
◈ Frequently Asked Questions
Transportation Infrastructure × Cleaning Services — Treasure Valley
HAIKU · HIGH GATE
How do warehouse logistics in Nampa, Idaho require specialized cleaning services due to transportation routes?
Warehouses along Nampa's primary transportation corridors accumulate dust and debris from heavy truck traffic, necessitating professional cleaning services that meet Clean Water Act discharge standards. The Americans with Disabilities Act of 1990 requires these facilities to maintain accessible, sanitized spaces for both employees and public access points.
What role does Boise Airport's ground transportation infrastructure play in cleaning service demand?
Boise Airport's ground transportation systems—including rental car facilities, shuttle routes, and cargo handling areas—generate significant cleaning requirements under EPA environmental compliance guidelines. Garden City and surrounding areas provide cleaning contractors who service these airport facilities while adhering to hazardous material disposal protocols established by the United States Environmental Protection Agency.
How do construction zoning regulations in the Treasure Valley affect cleaning service operations near new transportation projects?
Construction zones in Boise and Nampa require licensed cleaning services to manage sediment and debris according to zoning ordinances and Clean Water Act stormwater runoff provisions. The College of Western Idaho trains apprentices through registered programs in environmental cleaning practices specific to transportation construction sites across the metropolitan area.
Why do public transportation facilities in Boise need ongoing professional cleaning under ADA compliance standards?
Boise's public transportation hubs must maintain accessible, sanitary conditions per the Americans with Disabilities Act of 1990, requiring certified cleaning services for vehicle interiors and station facilities. Professional cleaners in the Treasure Valley specialize in high-traffic public transportation environments where local health regulations and accessibility standards apply simultaneously.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Cleaning Services 23 QID bridges 258 edges 7,053 ext links 2026-07-17 23:39:29 UTC d3b0828cb9e39c8c
Transportation Infrastructure corridor ↗ Cleaning Services corridor ↗ Cleaning Services × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals