—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Cleaning Services page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 158 edges
Information Vertical · Treasure Valley

Cleaning Services

0 Research Entities
158 Wikipedia Articles
158 Semantic Edges
0 Sections

Cleaning services in the Treasure Valley constitute a fragmented, labor-intensive facilities-support market spanning recurring residential housekeeping, commercial janitorial service, office cleaning, medical-environment cleaning, school and government custodial work, hotel housekeeping, apartment-turn and move-out cleaning, post-construction cleanup, carpet and upholstery care, hard-floor maintenance, window washing, pressure washing, gutter cleaning, solar-panel cleaning, short-term-rental turnovers, industrial sanitation, disaster restoration, mold remediation, trauma and biohazard response, and specialty disinfection. Idaho’s official business-licensing guidance expressly identifies housecleaning as an activity that ordinarily does not require a special occupational license or permit; a conventional cleaning business instead registers its name and entity type with the Idaho Secretary of State, subject to any activity-specific, zoning, environmental, pesticide, construction, fire-code, or municipal requirements triggered by the work actually performed. https://business.idaho.gov/licenses/ Idaho further requires businesses, including home-based businesses, to register their name and legal form before operating, except for a sole proprietor operating under the proprietor’s full legal name. https://business.idaho.gov/register-a-business/ The practical result is a low formal barrier to entry for ordinary housekeeping and janitorial work, alongside substantially higher compliance burdens for cleaners who apply regulated antimicrobial pesticides, disturb asbestos-containing material, remediate structural damage, handle blood or potentially infectious material, transport regulated waste, or alter real property.

The market’s geographic operating unit is broader than Boise proper. Local firms routinely define their service territory as Boise, Meridian, Eagle, Garden City, Kuna, Star, Nampa, Caldwell, Middleton, and adjoining Ada and Canyon County communities. Idaho Maintenance & Cleaning states that it has supplied scheduled commercial cleaning to Treasure Valley offices, retail properties, restaurants, and facilities since 2003. https://imc.cleaning/ RCF Commercial Cleaning identifies Boise, Eagle, Meridian, Nampa, Caldwell, Star, Kuna, and Garden City as its service area and describes nearly two decades of local commercial-cleaning experience. https://rcfcommercialcleaning.com/ Spotless Commercial Cleaning identifies itself as a family-owned Boise janitorial company serving Boise, Garden City, Eagle, and Meridian. https://spotlesscommercialcleaning.com/ Dream Clean markets residential and office cleaning in Boise, Meridian, Eagle, Nampa, and surrounding communities and reports more than nine years in the home-cleaning business. https://dreamcleanidaho.com/ Clear Choice Window Cleaning states that it has served Treasure Valley homes and businesses since 2003 and offers window cleaning, pressure washing, gutter cleaning, hard-water removal, solar-panel cleaning, screen repair, and seasonal lighting. https://windowcleaningboiseid.com/ Treasure Valley Shine names Boise, Caldwell, Eagle, Garden City, Kuna, Meridian, Middleton, Nampa, and Star as its operating footprint. https://www.treasurevalleyshine.com/ These overlapping service maps demonstrate that the cleaning economy follows the metropolitan housing, office, retail, medical, educational, hospitality, and industrial footprint rather than municipal boundaries.

The commercial segment includes independent local firms, regional operators, national facility-services companies, and franchise systems. ABM maintains a Boise commercial-cleaning location and markets integrated building-cleaning services backed by more than forty years of organizational experience. https://locations.abm.com/id/boise/cleaning-boise-id-1093.html Anago Cleaning Systems operates through the Boise market and advertises customized commercial janitorial programs in Meridian. https://anagocleaning.com/boise/meridian-id/ Vanguard Cleaning Systems of Inland Northwest connects Boise-area customers with independently owned janitorial franchise businesses serving offices, schools, medical facilities, and other commercial buildings. https://www.vanguardcleaning.com/cleaning/idaho-boise/ Business Cleaning Solutions positions itself as a commercial-cleaning management provider offering customized facility programs. https://businesscleaningsolutions.com/ J&J Cleaning Services advertises commercial cleaning throughout Boise, Meridian, Nampa, and Caldwell. https://www.j-j-cleaningservices.com/ Noble Clean identifies Meridian offices, medical clinics, automobile dealerships, retail facilities, churches, financial institutions, and professional buildings as customer categories. https://www.noblecleanco.com/meridian-cleaning RCF’s service architecture extends beyond routine janitorial work into industrial pressure washing for warehouses, manufacturing plants, distribution centers, loading docks, sidewalks, and industrial exteriors. https://rcfcommercialcleaning.com/commercial-cleaning-services/industrial-pressure-washing

Exterior cleaning forms a distinct but connected operator class because it requires vehicles, ladders, water access, runoff controls, fall protection, surface-specific chemical knowledge, and specialized pressure equipment. Clear Choice’s service portfolio joins traditional hand-washed windows with pressure washing, gutters, mineral-deposit removal, screens, and solar panels. https://windowcleaningboiseid.com/ Sol Pressure Washing markets surface-specific residential and commercial pressure washing across Boise and the Treasure Valley. https://solpressurewash.com/ Treasure Valley Exterior Cleaning advertises window cleaning, pressure washing, house washing, gutter cleaning, and exterior cleaning in Boise, Meridian, Eagle, Star, Nampa, Kuna, and surrounding areas. https://treasurevalleyexteriorcleaning.store/ The Better Business Bureau’s Boise-area pressure-washing directory identifies a large field that includes Supreme Clean, Treasure Valley Bin Cleaning, Blue Gander Window Cleaning, Trigger Happy Pro Wash, All-Pro Commercial Cleaning, Advanced Window Cleaning, Power Wash Idaho, and other operators serving combinations of Ada County, Canyon County, Boise, Meridian, Nampa, Eagle, Kuna, Star, Garden City, Caldwell, and Emmett. https://www.bbb.org/us/id/boise/category/pressure-washing The category therefore intersects residential property maintenance, commercial facilities management, solar-energy maintenance, roofing and gutters, fleet and equipment washing, municipal stormwater control, and real-estate presentation.

Restoration and biohazard work occupy the high-risk edge of the vertical. The Meridian Chamber of Commerce cleaning-services directory identifies Resto Clean Restoration as a Treasure Valley operator providing water, fire, mold, trauma, biohazard, and reconstruction services and also lists SERVPRO operations serving Boise, Meridian, Star, Eagle, and surrounding communities. https://business.meridianchamber.org/list/ql/cleaning-services-31 This work crosses from cleaning into emergency response, insurance claims, demolition, drying, structural repair, indoor-air quality, hazardous-material management, and healthcare-grade contamination control. Ordinary cleaning removes soil; sanitizing reduces microorganisms to a specified level; disinfecting uses products regulated as pesticides when they claim to destroy or inactivate disease-causing microorganisms. Idaho’s pesticide-applicator training manual states that applicators, dealers, and consultants seeking pesticide credentials must know the material tested by the Idaho State Department of Agriculture. https://agri.idaho.gov/main/wp-content/uploads/2017/12/Idaho-Pesticide-Applicator-Training-Manual.pdf A cleaning contractor making antimicrobial pesticide applications outside ordinary consumer use must therefore determine whether the product, site, method, and compensation arrangement trigger licensing, certification, recordkeeping, label, or supervision requirements.

Federal occupational-safety law governs cleaning employers even where Idaho imposes no general housecleaner license. OSHA’s cleaning-industry hazard inventory identifies bloodborne pathogens, cleaning chemicals, toxic substances, carbon monoxide, asbestos, mold, confined spaces, lockout/tagout, electricity, ergonomics, falls, personal protective equipment, and powered industrial trucks as recurring hazards. https://www.osha.gov/cleaning-industry/hazards-solutions The hazard profile changes by customer site: an office cleaner encounters chemical, ergonomic, slip, and repetitive-motion risks; a hospital housekeeper may encounter sharps and infectious materials; an industrial cleaner may encounter machinery, confined spaces, powered equipment, corrosives, and hazardous energy; an exterior cleaner may encounter falls, electrical conductors, pressure-injection injuries, traffic, and chemical runoff. OSHA’s bloodborne-pathogens materials specifically identify housekeeping personnel in some industries as workers potentially exposed to hepatitis B, hepatitis C, HIV, and other bloodborne hazards. https://www.osha.gov/bloodborne-pathogens OSHA’s regulatory standard requires handwashing after glove removal and after contact with blood or other potentially infectious material. https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030 OSHA’s quick-reference guidance identifies exposure-control plans, universal precautions, engineering controls, work-practice controls, personal protective equipment, housekeeping, hepatitis-B vaccination, post-exposure follow-up, hazard communication, training, and recordkeeping as core employer obligations where occupational exposure is reasonably anticipated. https://www.osha.gov/bloodborne-pathogens/quick-reference

Chemical selection creates a direct edge between cleaning services, public health, indoor-air quality, environmental protection, purchasing policy, and worker safety. EPA’s Safer Choice program evaluates cleaning and maintenance products against human-health and environmental criteria and provides a searchable inventory of certified products. https://www.epa.gov/saferchoice https://www.epa.gov/saferchoice/products A product’s inclusion in Safer Choice does not replace its label directions, safety-data sheet, required dwell time, dilution instructions, incompatibility warnings, ventilation requirements, personal protective equipment, or antimicrobial registration status. Cleaning companies serving schools, childcare centers, medical offices, gyms, food facilities, senior housing, and public buildings must distinguish physical soil removal from sanitizing and disinfecting and must avoid dangerous chemical combinations, undocumented decanting, unlabeled secondary containers, and applications inconsistent with product labeling. OSHA’s model materials explain that employers covered by the bloodborne-pathogens and hazard-communication standards need written programs, employee training, and protective measures. https://www.osha.gov/sites/default/files/publications/OSHA3186.pdf

Idaho does not impose a special statewide occupational license on a business performing ordinary housecleaning, but the business remains subject to entity registration, tax, employment, insurance, land-use, fire-code, and contract requirements. https://business.idaho.gov/licenses/ Idaho’s registration guidance requires LLCs and corporations to register through their entity filing and requires sole proprietorships and partnerships using trade names to file an assumed business name or other appropriate registration. https://business.idaho.gov/register-a-business/ Idaho’s assumed-business-name guidance states that a person must be at least eighteen to register a business and explains that a sole proprietorship registers the business name rather than creating a separate entity. https://business.idaho.gov/dba/ Businesses with employees or those transacting with corporations and government agencies commonly require an Employer Identification Number, and Idaho’s business portal directs applicants to the Internal Revenue Service process. https://business.idaho.gov/employer-issues/employer-id-number/ Local city clerks may regulate home occupations, occupancy, signs, fire hazards, and specially licensed activities even where janitorial work itself is not licensed. https://business.idaho.gov/assistance-resources/licenses/ Boise maintains city licensing and permitting systems, but its published general license categories do not create a blanket janitorial license. https://www.cityofboise.org/departments/city-clerk/licensing/ https://permits.cityofboise.org/

A cleaner operating from a residence or occupying a warehouse, laundry, chemical-storage space, or dispatch office must also address land-use and occupancy rules. Boise’s small-business guide directs business owners to verify whether an existing space has an appropriate certificate of occupancy and whether a proposed use changes the building’s occupancy classification. https://www.cityofboise.org/media/3862/pds-smallbusinessstartup-onlineguide.pdf Boise’s municipal guidance states that many businesses may operate from a home but that some require permits. https://www.cityofboise.org/programs/energize/energize-toolkit/guides/who-do-i-call-at-city-hall/ Storage of aerosols, compressed gases, flammable liquids, or dry-cleaning chemicals can trigger fire-code review or permits; Boise’s published fire-permit schedule separately identifies aerosol products, compressed gas, dry cleaning, and flammable or combustible liquids. https://www.cityofboise.org/departments/fire/fire-prevention/fire-permits-and-service-fees/ Cleaning operators must therefore classify their actual chemical inventory rather than assume that the absence of a general housecleaning license eliminates facility-level regulation.

Idaho’s sales-and-use-tax system treats cleaning operations differently depending on whether the transaction is a pure service, a taxable bundled transaction, a retail sale of goods, a lodging charge, or work that improves real property. Idaho’s general tax guide states that the sales- and use-tax rate is six percent and that sales tax applies to retail sales and enumerated taxable services. https://tax.idaho.gov/taxes/sales-use/online-guide/ Cleaning businesses remain end users of most vacuums, extractors, chemicals, mop systems, liners, cloths, personal protective equipment, and other supplies and ordinarily owe sales or use tax when purchasing those goods. Idaho’s production-exemption guidance expressly identifies maintenance and janitorial equipment and supplies as taxable nonproduction property. https://tax.idaho.gov/taxes/sales-use/exemptions/producers/general-info/general-taxable-items/ Idaho’s exemption certificate likewise identifies janitorial and cleaning equipment and supplies among items not qualifying under the production exemption. https://tax.idaho.gov/document-mngr/forms_efo00149/ Cleaning performed as part of lodging, extraordinary guest damage, property repair, installed flooring, construction, or restoration can create different tax treatment, requiring transaction-level classification instead of a single assumption for the entire industry.

Hospitality creates one of the vertical’s strongest cross-domain connections. Idaho requires lodging providers and short-term-rental marketplaces to collect and remit applicable sales, travel-and-convention, auditorium-district, and local taxes on taxable lodging arrangements. https://tax.idaho.gov/search-category/sales-tax/lodging/ Cleaning labor is consequently embedded in the economics of hotels, motels, vacation rentals, furnished corporate housing, and short-term rentals even when the cleaner is an independent contractor rather than a lodging employee. Idaho’s lodging guidance distinguishes consumable guest amenities from operational supplies: facial tissue, toilet tissue, disposable laundry bags, soap, shampoo, and certain other items included in the lodging charge can be purchased for resale under specified conditions, while cleaning supplies, garbage-can liners, towels, linens, bedding, glassware, furniture, and other durable operational goods are taxable to the lodging provider. https://tax.idaho.gov/taxes/sales-use/guides-for-certain-groups/lodging/buying-goods/ Current Treasure Valley job listings show direct demand for hotel room attendants, laundry attendants, short-term-rental cleaners, and Airbnb turnover workers, confirming that lodging demand supports both in-house housekeeping departments and outsourced cleaning contractors. https://www.indeed.com/q-cleaning-l-boise%2C-id-jobs.html https://www.glassdoor.com/Job/boise-part-time-cleaning-jobs-SRCH_IL.0%2C5_IC1127927_KO6%2C24.htm

Healthcare creates a second high-value connection. Boise and Nampa hospitals, clinics, dental offices, senior-living communities, laboratories, and outpatient facilities require environmental-services personnel who can follow infection-control, sharps, waste, isolation-room, chemical, and terminal-cleaning procedures. Current employment listings identify housekeeping and environmental-services positions at St. Luke’s Health System, Saint Alphonsus, Trinity Health, senior communities, dental facilities, and medical offices. https://www.linkedin.com/jobs/cleaner-jobs-boise-id https://www.glassdoor.com/Job/boise-part-time-cleaning-jobs-SRCH_IL.0%2C5_IC1127927_KO6%2C24.htm OSHA states that occupational exposure to human blood or other potentially infectious materials activates the bloodborne-pathogens framework and universal-precaution requirements. https://www.osha.gov/bloodborne-pathogens/worker-protections Medical cleaning is therefore not merely a cosmetic service; it is an operational component of infection prevention, employee safety, patient safety, accreditation, waste management, and healthcare continuity.

Real estate, construction, and property management generate recurring demand through apartment turns, tenant move-outs, residential listings, commercial tenant improvements, foreclosures, estate transitions, new construction, remodeling, and disaster recovery. When work consists only of removing debris and cleaning surfaces, it remains within custodial service; when the provider installs carpet, replaces drywall, reconstructs damaged areas, permanently applies coatings, or otherwise improves real property, Idaho contractor and tax rules may apply. Idaho defines contractors as persons who build, improve, repair, or alter real property and treats them as consumers of goods incorporated or used in the work. https://tax.idaho.gov/taxes/sales-use/guides-for-certain-groups/contractors/ Restoration firms offering both remediation and reconstruction therefore sit on both sides of the cleaning-construction boundary. Resto Clean’s advertised combination of water, fire, mold, trauma, biohazard, and full-rebuild services is a direct local example. https://business.meridianchamber.org/list/ql/cleaning-services-31

Government procurement is a major institutional demand channel. The City of Boise’s bid archive identifies awarded cleaning and laundry services and janitorial-services contracts, including awards to Courtney’s Comet Cleaners and American Cleaning. https://www.cityofboise.org/departments/finance/purchasing/bids/ Boise’s procurement and labor-standards policy identifies janitorial services among covered service-contract categories. https://www.cityofboise.org/media/20309/procurement-and-labor-standards-policies-and-procedures.pdf Boise budget documents describe contracted janitorial, elevator, door, HVAC, landscaping, snow-removal, and related facility-maintenance work as components of municipal building operations. https://www.cityofboise.org/media/17669/ada-boise-budget-adopted-fy24_amended.pdf The Idaho Division of Purchasing administers statewide solicitations and open contracts through the state procurement system. https://purchasing.idaho.gov/ Its statewide-contract page states that agencies may buy directly from awarded vendors under established terms and cites Idaho Code section 67-9230 concerning required use of open contracts. https://purchasing.idaho.gov/statewide-contracts/ Government cleaning contracts therefore connect local firms to vendor registration, competitive bidding, insurance, background screening, wage and labor provisions, quality-control documentation, security requirements, supply specifications, and measurable service-level obligations.

The workforce pipeline is predominantly employer-based rather than apprenticeship- or license-based. Idaho’s Next Steps career system classifies janitors and cleaners as workers who maintain buildings, clean floors, shampoo rugs, wash walls and glass, remove rubbish, perform routine maintenance, and report repair needs; it labels statewide demand “high” and reports a state average salary of $33,250. https://nextsteps.idaho.gov/browse-careers/37-2011.00 ONET uses the same core occupation, Standard Occupational Classification 37-2011, and designates it a Bright Outlook occupation in its 2026 update. https://www.onetonline.org/link/summary/37-2011.00 The Bureau of Labor Statistics maintains Boise City metropolitan estimates for janitors and cleaners and separate classifications for maids and housekeeping cleaners. https://www.bls.gov/oes/2023/may/oes_14260.htm https://www.bls.gov/oes/2023/may/oes372011.htm Current Boise-area listings commonly advertise entry-level work, on-the-job training, evening or overnight shifts, part-time schedules, background checks, valid driver’s licenses, reliable vehicles, physical stamina, and wages clustered in the mid-to-high teens per hour, although specialized floor care, industrial cleaning, fleet washing, restoration, supervision, and exterior work can command more. https://www.indeed.com/q-cleaning-l-boise%2C-id-jobs.html

The labor model creates structural dependence on transportation, scheduling software, keys and access credentials, background screening, chemical and equipment suppliers, commercial insurance, payroll systems, and customer-trust mechanisms. Residential cleaners frequently travel between dispersed homes carrying supplies in personal vehicles; commercial crews often work after normal business hours; hotel and healthcare cleaners work shifts; construction and restoration crews move heavy extraction, drying, pressure-washing, and containment equipment. Current postings repeatedly require a valid driver’s license, personal vehicle, auto insurance, background eligibility, or the ability to work nights and weekends. https://www.indeed.com/q-cleaning-l-boise%2C-id-jobs.html https://www.glassdoor.com/Job/boise-part-time-cleaning-jobs-SRCH_IL.0%2C5_IC1127927_KO6%2C24.htm Insurance requirements vary by customer and contract, but government, medical, property-management, and commercial clients commonly demand general liability, workers’ compensation where applicable, automobile coverage, bonding or fidelity protection, and proof of coverage. Idaho’s business portal maintains a dedicated insurance resource for employers and business owners. https://business.idaho.gov/insurance/

The modern Treasure Valley cleaning market developed through cumulative metropolitan expansion rather than a single institutional founding. Boise’s growth as Idaho’s capital, employment center, medical hub, university city, transportation node, and regional commercial center created the original concentration of offices, schools, hotels, public buildings, hospitals, retail centers, and multifamily housing requiring custodial labor. Subsequent suburban growth in Meridian, Eagle, Star, Kuna, Nampa, Caldwell, and Middleton expanded service routes westward and increased demand for recurring residential cleaning, apartment turns, construction cleanup, exterior washing, and decentralized commercial janitorial service. The 2020 Census identified a Boise City urban area population of 433,180. https://www2.census.gov/geo/docs/reference/ua/2020_Census_ua_list_all.xlsx Federal county population datasets document Ada County’s rapid expansion during the preceding decade. https://www2.census.gov/programs-surveys/popest/datasets/2010-2020/counties/totals/co-est2020.csv The appearance of several local firms founded or operating continuously since the early 2000s, including Idaho Maintenance & Cleaning and Clear Choice, aligns with the period in which the Valley’s suburban housing, healthcare, hospitality, education, and commercial inventory expanded substantially. https://imc.cleaning/ https://windowcleaningboiseid.com/

Education and institutional cleaning form another durable demand layer. Public-school districts, charter schools, Boise State University, the College of Western Idaho, private schools, childcare facilities, churches, libraries, recreation centers, and municipal buildings require daily custodial work, floor care, restroom sanitation, waste removal, event setup, snow and debris response, and summer deep-cleaning. Vanguard expressly includes schools among the facility types served by its Boise-area franchise network. https://www.vanguardcleaning.com/cleaning/idaho-boise/ Boise’s facility budgets place janitorial service alongside HVAC, doors, elevators, landscaping, snow removal, and other building systems, showing that cleaning is treated as a component of facilities management rather than an isolated consumer service. https://www.cityofboise.org/media/17669/ada-boise-budget-adopted-fy24_amended.pdf The same institutional buyers create advancement pathways from cleaner to lead, floor technician, day porter, route supervisor, quality-control inspector, account manager, facility coordinator, and facilities manager even though no formal cleaning apprenticeship is required.

Food production, restaurants, groceries, warehouses, and agriculture-linked businesses connect cleaning to sanitation, pest control, food safety, wastewater, and production continuity. Current Boise and Nampa listings include sanitation workers and supervisors in dairy and food-production environments. https://www.indeed.com/q-cleaning-l-boise%2C-id-jobs.html These jobs differ materially from office janitorial work because they can involve documented sanitation standard operating procedures, food-contact surfaces, allergen controls, chemical concentration verification, equipment lockout, environmental monitoring, production scheduling, and regulatory inspection. Idaho tax guidance confirms that ordinary maintenance and janitorial supplies remain taxable even for producers otherwise eligible for production exemptions. https://tax.idaho.gov/taxes/sales-use/exemptions/producers/general-info/general-taxable-items/ The cleaning vertical therefore supports the Valley’s dairy, food-processing, cold-storage, restaurant, grocery, warehousing, and logistics systems while also depending on them for stable shift-based employment.

The vertical’s representative bodies are diffuse because no Idaho board licenses ordinary cleaners as a profession. State-level institutional representation instead occurs through the Idaho Secretary of State and Business.Idaho.gov for entity formation, the Idaho State Tax Commission for tax administration, the Idaho Department of Labor for employment law and workforce information, the Idaho State Department of Agriculture for pesticide-related activity, the Idaho Division of Purchasing for state contracts, and municipal clerks, planning departments, fire departments, and purchasing offices for local requirements. https://business.idaho.gov/register-a-business/ https://tax.idaho.gov/taxes/sales-use/ https://www.labor.idaho.gov/businesses/labor-laws/labor-laws-faq/ https://agri.idaho.gov/main/wp-content/uploads/2017/12/Idaho-Pesticide-Applicator-Training-Manual.pdf https://purchasing.idaho.gov/ https://www.cityofboise.org/departments/city-clerk/licensing/ Practitioner visibility is supplied by local chambers and business directories, including the Meridian Chamber’s cleaning-services category. https://business.meridianchamber.org/list/ql/cleaning-services-31 National technical and trade representation comes principally from organizations such as ISSA and franchise or facility-services networks, while federal compliance authority remains concentrated in OSHA and EPA. https://www.osha.gov/cleaning-industry/hazards-solutions https://www.epa.gov/saferchoice

Treasure Valley-specific academic literature devoted solely to commercial cleaning businesses is limited; the authoritative research base is distributed across labor statistics, occupational taxonomies, public-health guidance, chemical-safety research, procurement records, tax administration, population data, and local operator evidence. The most locally precise institutional datasets are the Bureau of Labor Statistics Boise City occupational-employment tables at https://www.bls.gov/oes/2023/may/oes_14260.htm, Idaho’s career profile at https://nextsteps.idaho.gov/browse-careers/37-2011.00, federal Census urban and county datasets at https://www2.census.gov/geo/docs/reference/ua/2020_Census_ua_list_all.xlsx and https://www2.census.gov/programs-surveys/popest/datasets/2010-2020/counties/totals/co-est2020.csv, Boise procurement records at https://www.cityofboise.org/departments/finance/purchasing/bids/, and Idaho tax, licensing, and procurement guidance at https://business.idaho.gov/licenses/, https://tax.idaho.gov/taxes/sales-use/online-guide/, and https://purchasing.idaho.gov/. Together these sources define a market whose central economic function is preserving the usability, safety, appearance, occupancy readiness, and regulatory fitness of the Valley’s built environment.

https://business.idaho.gov/licenses/ — Idaho’s official statement that ordinary housecleaning does not require a special occupational license and that the business must register its name and entity type.

https://business.idaho.gov/register-a-business/ — Idaho’s official business-formation requirements for corporations, LLCs, partnerships, sole proprietorships, and assumed business names.

https://business.idaho.gov/dba/ — Idaho guidance for assumed business names and sole proprietorship registration.

https://business.idaho.gov/business-wizard/ — Idaho’s screening system for activity-specific licenses, permits, and taxes.

https://business.idaho.gov/assistance-resources/licenses/ — Idaho guidance on municipal licenses, home occupations, occupancy permits, and city-clerk jurisdiction.

https://business.idaho.gov/employer-issues/employer-id-number/ — Idaho guidance concerning federal Employer Identification Numbers.

https://business.idaho.gov/insurance/ — Idaho’s business-insurance resource.

https://www.cityofboise.org/departments/city-clerk/licensing/ — Boise’s municipal licensing portal.

https://permits.cityofboise.org/ — Boise’s online permitting and licensing system.

https://www.cityofboise.org/media/3862/pds-smallbusinessstartup-onlineguide.pdf — Boise’s small-business guide addressing occupancy, planning, building, and permitting considerations.

https://www.cityofboise.org/programs/energize/energize-toolkit/guides/who-do-i-call-at-city-hall/ — Boise guidance concerning home businesses and municipal contacts.

https://www.cityofboise.org/departments/fire/fire-prevention/fire-permits-and-service-fees/ — Boise fire permits for aerosols, compressed gases, dry cleaning, and flammable or combustible liquids.

https://tax.idaho.gov/taxes/sales-use/online-guide/ — Idaho’s official sales-and-use-tax overview.

https://tax.idaho.gov/taxes/sales-use/exemptions/producers/general-info/general-taxable-items/ — Idaho guidance identifying maintenance and janitorial supplies as taxable nonproduction property.

https://tax.idaho.gov/document-mngr/forms_efo00149/ — Idaho Form ST-101 and instructions concerning exemptions and taxable cleaning equipment and supplies.

https://tax.idaho.gov/taxes/sales-use/guides-for-certain-groups/contractors/ — Idaho tax guidance defining contractors and real-property improvements.

https://tax.idaho.gov/search-category/sales-tax/lodging/ — Idaho tax rules for hotels, short-term rentals, and lodging marketplaces.

https://tax.idaho.gov/taxes/sales-use/guides-for-certain-groups/lodging/buying-goods/ — Idaho guidance distinguishing lodging consumables from taxable cleaning supplies and durable property.

https://www.labor.idaho.gov/businesses/labor-laws/labor-laws-faq/ — Idaho Department of Labor guidance on minimum wage and employment law.

https://nextsteps.idaho.gov/browse-careers/37-2011.00 — Idaho’s career profile for janitors and cleaners.

https://www.onetonline.org/link/summary/37-2011.00 — Federal occupational definition and task profile for janitors and cleaners.

https://www.bls.gov/oes/2023/may/oes_14260.htm — Bureau of Labor Statistics occupational employment and wage data for the Boise City metropolitan area.

https://www.bls.gov/oes/2023/may/oes372011.htm — Bureau of Labor Statistics national occupational definition for janitors and cleaners.

https://www.osha.gov/cleaning-industry/hazards-solutions — OSHA’s cleaning-industry hazard and control resource.

https://www.osha.gov/bloodborne-pathogens — OSHA’s bloodborne-pathogens resource identifying housekeeping workers among potentially exposed occupations.

https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030 — The federal bloodborne-pathogens standard.

https://www.osha.gov/bloodborne-pathogens/quick-reference — OSHA’s summary of exposure plans, universal precautions, training, vaccination, recordkeeping, and personal protective equipment.

https://www.osha.gov/bloodborne-pathogens/worker-protections — OSHA guidance on occupational exposure to blood and other potentially infectious materials.

https://www.osha.gov/sites/default/files/publications/OSHA3186.pdf — OSHA model materials for bloodborne-pathogens and hazard-communication programs.

https://www.epa.gov/saferchoice — EPA’s Safer Choice program for cleaning and maintenance products.

https://www.epa.gov/saferchoice/products — EPA’s searchable list of Safer Choice-certified products.

https://agri.idaho.gov/main/wp-content/uploads/2017/12/Idaho-Pesticide-Applicator-Training-Manual.pdf — Idaho’s pesticide-applicator training and examination manual.

https://purchasing.idaho.gov/ — Idaho Division of Purchasing portal.

https://purchasing.idaho.gov/statewide-contracts/ — Idaho’s active statewide-contract system and open-contract requirements.

https://www.cityofboise.org/departments/finance/purchasing/bids/ — Boise’s archive of current, closed, and awarded bids, including cleaning and janitorial contracts.

https://www.cityofboise.org/media/20309/procurement-and-labor-standards-policies-and-procedures.pdf — Boise procurement and labor-standards policies covering janitorial and related service contracts.

https://www.cityofboise.org/media/17669/ada-boise-budget-adopted-fy24_amended.pdf — Boise budget documentation connecting janitorial contracts to municipal facility operations.

https://www2.census.gov/geo/docs/reference/ua/2020_Census_ua_list_all.xlsx — Official 2020 Census urban-area population data for Boise City.

https://www2.census.gov/programs-surveys/popest/datasets/2010-2020/counties/totals/co-est2020.csv — Official county population estimates documenting Ada County growth.

https://imc.cleaning/ — Idaho Maintenance & Cleaning’s Treasure Valley commercial-service profile and 2003 founding claim.

https://rcfcommercialcleaning.com/ — RCF Commercial Cleaning’s Boise-area service territory and operating history.

https://rcfcommercialcleaning.com/commercial-cleaning-services/janitorial-services — RCF’s recurring commercial-janitorial service description.

https://rcfcommercialcleaning.com/commercial-cleaning-services/industrial-pressure-washing — RCF’s industrial exterior-cleaning and pressure-washing services.

https://spotlesscommercialcleaning.com/ — Spotless Commercial Cleaning’s Boise, Garden City, Eagle, and Meridian service profile.

https://dreamcleanidaho.com/ — Dream Clean’s Treasure Valley residential and office-cleaning service profile.

https://www.j-j-cleaningservices.com/ — J&J Cleaning Services’ Boise, Meridian, Nampa, and Caldwell commercial-cleaning profile.

https://businesscleaningsolutions.com/ — Business Cleaning Solutions’ commercial-cleaning management profile.

https://locations.abm.com/id/boise/cleaning-boise-id-1093.html — ABM’s Boise commercial-cleaning operation.

https://anagocleaning.com/boise/meridian-id/ — Anago Cleaning Systems’ Meridian commercial-janitorial service page.

https://www.vanguardcleaning.com/cleaning/idaho-boise/ — Vanguard’s Boise-area commercial-cleaning franchise network.

https://www.noblecleanco.com/meridian-cleaning — Noble Clean’s Meridian commercial-cleaning customer and facility categories.

https://windowcleaningboiseid.com/ — Clear Choice’s Treasure Valley window, pressure, gutter, hard-water, solar-panel, and screen services.

https://solpressurewash.com/ — Sol Pressure Washing’s Boise and Treasure Valley exterior-cleaning profile.

https://treasurevalleyexteriorcleaning.store/ — Treasure Valley Exterior Cleaning’s regional service portfolio.

https://www.treasurevalleyshine.com/ — Treasure Valley Shine’s municipal service territory.

https://www.bbb.org/us/id/boise/category/pressure-washing — Better Business Bureau directory of Boise-area pressure-washing and exterior-cleaning operators.

https://business.meridianchamber.org/list/ql/cleaning-services-31 — Meridian Chamber directory covering cleaning, restoration, mold, trauma, biohazard, fire, and water-damage operators.

https://www.indeed.com/q-cleaning-l-boise%2C-id-jobs.html — Current Boise-area cleaning, sanitation, hotel, industrial, window, and janitorial employment listings.

https://www.linkedin.com/jobs/cleaner-jobs-boise-id — Boise-area cleaner and environmental-services employment listings.

https://www.glassdoor.com/Job/boise-part-time-cleaning-jobs-SRCH_IL.0%2C5_IC1127927_KO6%2C24.htm — Treasure Valley part-time cleaning, hotel, short-term-rental, medical, and commercial-job listings.

The specialty-cleaning market includes a biohazard and trauma-remediation layer that ordinary janitorial directories understate. Bio-One of Boise identifies Travis Nichols as its local owner and markets suicide, homicide, unattended-death, blood-spill, feces-and-urine, odor, hoarding, homeless-encampment, and animal-biohazard cleanup throughout the Boise area, placing the firm at the junction of property restoration, law enforcement support, public health, behavioral-health crises, landlord remediation, and insurance claims rather than routine housekeeping alone. https://www.biooneboise.com/ Steri-Clean Southern Idaho advertises round-the-clock crime-scene, trauma, hoarding, blood, death, and biohazard remediation across Idaho and states that its operating methods are aligned with Institute of Inspection, Cleaning and Restoration Certification practices. https://www.steri-clean.com/service-areas/idaho/ The Boise-specific Steri-Clean service page describes locally staffed specialists handling suicide scenes, blood contamination, and other biohazards for homeowners, renters, businesses, and public officials. https://crimecleaners.com/locations/idaho-crime-scene-clean-up/boise-crime-scene-cleanup-2/ SERVPRO of Boise separately markets residential, commercial, and industrial biohazard response through trained specialists available twenty-four hours a day. https://www.servpro.com/locations/id/servpro-of-boise/services/cleaning/specialty/biohazard-cleaning The simultaneous presence of locally owned firms, restoration franchises, and national response networks shows that biohazard cleaning is a contested specialty market in which dispatch speed, insurer familiarity, certification, discretion, documentation, and regulated-waste coordination create entry barriers absent from ordinary residential cleaning.

Hoarding remediation creates a direct graph edge from cleaning services to housing stability, senior services, mental-health intervention, code enforcement, estate administration, and property management. Bio-One’s Boise operation treats hoarding, animal accumulation, fecal contamination, odor, and distressed-property cleanup as related services rather than isolated cleaning tasks. https://www.biooneboise.com/ Steri-Clean’s Idaho operation similarly joins hoarding cleanup to trauma and biohazard response. https://www.steri-clean.com/service-areas/idaho/ The market implication is that providers serving severe-hoarding environments compete partly through compassionate case handling and coordination with families, landlords, social-service personnel, attorneys, insurers, and waste haulers, while ordinary maid-service firms generally lack the protective equipment, disposal procedures, labor intensity, and psychological training required for those scenes.

Commercial-kitchen exhaust cleaning forms another specialized submarket shaped by restaurant fire risk rather than appearance alone. Bare Metal Standard operates from Garden City and identifies the Treasure Valley and the rest of Idaho as its service territory for commercial exhaust-hood inspection and cleaning. https://www.baremetalstandard.com/idaho/ HOODZ of Treasure Valley advertises exhaust-system cleaning and commercial-kitchen services in Boise, Meridian, Nampa, and surrounding communities. https://www.hoodzinternational.com/treasure-valley/ The International Franchise Association reported in January 2026 that the HOODZ system entered Idaho through the Treasure Valley location, making the operation a recent franchise-market entrant rather than a long-established independent. https://www.franchise.org/2026/01/hoodz-comes-to-idaho-with-new-franchise-location-opening/ GreaseBusters Boise offers hood, duct, fan, kitchen-surface, sink, and mop-basin cleaning and states that it supplies before-and-after documentation and communicates cleaning records to local fire authorities. https://greasebusters.com/locations/boise-idaho/ Hood and Duct Cleaning Services markets after-hours commercial exhaust cleaning in Eagle and the broader Treasure Valley. https://hoodandduct.com/eagle-idaho/ These operators connect the cleaning vertical to restaurant licensing, fire inspection, commercial insurance, food production, grease management, ventilation engineering, and overnight labor scheduling; the fire-loss implications of grease accumulation allow specialized vendors to compete on inspection readiness and service documentation rather than price per labor hour alone.

HOODZ’s 2026 Treasure Valley opening also exposes the franchise mechanism by which national systems enter Boise-area niches. The operator receives a recognized brand, operating procedures, software, sales materials, training, and national-account credibility, while the local market receives an additional competitor with centralized standards and purchasing leverage. https://www.franchise.org/2026/01/hoodz-comes-to-idaho-with-new-franchise-location-opening/ Its local territory page explicitly covers Boise, Meridian, Nampa, and surrounding areas, showing that franchise territories are configured around the metropolitan service basin rather than a single city. https://www.hoodzinternational.com/treasure-valley/ That territorial model matters because a franchise can consolidate customer acquisition across several municipalities without acquiring local firms, producing functional consolidation through shared branding, technology, procedures, and supplier relationships even where ownership remains locally held.

Dry-ice blasting represents a still narrower industrial-cleaning layer. Sano Blast Restoration states that it provides dry-ice blasting in Idaho and surrounding areas for surface cleaning, restoration, automobile work, paint removal, and confined or difficult spaces. https://sanoblast.com/home/ Dry-ice blasting depends on compressed air and solid carbon dioxide rather than high volumes of liquid cleaning solution, allowing operators to target machinery, automotive components, fire residue, coatings, electrical assemblies, and sensitive production environments where water or abrasive media may be undesirable. Cold Jet’s contract-cleaning technical page identifies the blaster, compressor, hoses, applicator, and task-specific nozzle as the core equipment set for commercial dry-ice cleaning. https://www.coldjet.com/dry-ice-blasting/industries/contract-cleaning/ The connection between a Boise-area dry-ice operator and this equipment architecture places the niche at the intersection of cleaning, equipment rental, industrial maintenance, automotive restoration, manufacturing uptime, food-production sanitation, and carbon-dioxide supply.

Fleet and heavy-equipment washing connect cleaning services to construction, trucking, winter road maintenance, agriculture, equipment rental, waste hauling, and environmental compliance. Sol Pressure Washing’s dedicated fleet page advertises removal of mud, deicing brine, road film, and jobsite residue from heavy equipment and contractor fleets throughout the Treasure Valley. https://solpressurewash.com/heavy-equipment-fleet-pressure-washing/ The service is operationally different from residential pressure washing because contaminated wash water can contain petroleum residue, metals, soil, salts, detergents, and suspended solids, creating wastewater and stormwater obligations. Boise’s Stormwater Management and Discharge Control Ordinance prohibits and regulates discharges to the municipal storm-drain system and provides the local enforcement structure governing illicit connections and non-stormwater releases. https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-13449 The sourced connection means that a mobile fleet-washing contractor’s service method, containment system, disposal location, and customer-site drainage are legal market variables, not merely technical preferences.

Nampa’s municipal stormwater framework reinforces the same cross-domain edge. The city’s municipal separate storm sewer permit identifies automobile and truck washing, steam cleaning, and power washing among activities capable of introducing pollutants into stormwater and requires the city to deploy best-management practices that protect receiving waters. https://www.cityofnampa.us/DocumentCenter/View/13231/2021-MS4-Permit--City-of-Nampa?bidId= Nampa’s spill-response plan states that emergency spill abatement can require outside cleanup contractors and regulatory direction for containment, removal, and disposal. https://www.cityofnampa.us/DocumentCenter/View/19657/Nampa-Spill-Prevention-and-Respone-Plan-Final The originating side is the specialty cleaner providing washing or spill-removal capacity; the receiving side is Nampa’s stormwater and emergency-management system, which determines whether residues can enter drains, must be contained, or require specialized disposal.

Industrial cleaners that generate concentrated wash water also connect to Nampa’s wastewater utility. The city’s industrial-wastewater capacity policy requires industrial customers seeking discharge capacity to comply with applicable wastewater-discharge and pretreatment regulations. https://www.cityofnampa.us/DocumentCenter/View/13465/Industrial-Wastewater-Capacity-Policy-Final_August-3-2021 A food-plant sanitation contractor, equipment washer, grease-removal company, or restoration operator therefore cannot treat the sewer as an unlimited disposal endpoint; the composition, volume, pH, grease loading, solids, and hazardous characteristics of wastewater may shift the job from ordinary cleaning into pretreatment-controlled industrial discharge.

Dryer-vent and air-duct cleaning constitute a distinct residential and commercial safety niche. Dryer On Fire serves Boise, Eagle, Meridian, Nampa, Caldwell, Middleton, Star, Kuna, and surrounding communities with dryer-vent and air-duct services. https://dryeronfire.com/ Cody’s Appliance Repair integrates dryer-vent cleaning with appliance repair across the Treasure Valley, demonstrating that this category competes with both cleaning contractors and mechanical-service firms. https://codysappliancerepair.com/dryer-vent-cleaning-boise/ Kingsway Idaho markets dryer-vent service through a locally owned carpet-cleaning operation serving Nampa, Boise, Meridian, Kuna, Caldwell, and nearby cities. https://kingswayidaho.com/dryer-vent-cleaning/ These three models—specialist vent cleaner, appliance-repair cross-seller, and carpet-cleaning cross-seller—show that niche consolidation often occurs through service bundling rather than acquisition.

Carpet, upholstery, rug, tile, and air-system cleaning form a mature technical segment with both independent and national brands. System Kleen reports more than twenty-eight years of hands-on carpet-cleaning experience in Meridian and the Treasure Valley. https://www.systemkleen.com/carpet-cleaning-services Stanley Steemer’s Boise operation bundles carpet, upholstery, tile, rug, air-duct, and emergency water-restoration services, giving a national brand several customer-entry points within one household or commercial account. https://www.stanleysteemer.com/locations/ID/Boise/967 Superior Carpet and Air combines residential and commercial carpet cleaning with air-duct and dryer-vent service and promotes certified technicians and environmentally oriented processes. https://www.superiorcarpetandair.com/cleaning-tips-insights-for-boise-the-treasure-valley The segment’s market structure is therefore not cleanly divided by trade: carpet cleaners compete against restoration firms, HVAC-adjacent duct cleaners, appliance companies, national franchises, flooring-maintenance specialists, and general janitorial contractors.

The absence of a general Idaho cleaning license makes municipal land-use and business rules decisive for small operators running dispatch, storage, laundry, or administrative functions from homes. Meridian states that it does not require a general business license, although activity-specific licenses and permits remain necessary. https://meridiancity.org/city-clerk/license-and-permit-applications/ Meridian allows home occupations through an accessory-use process only when the activity remains low impact and preserves the residential character of the neighborhood. https://meridiancity.org/community-development/planning/general-information-faq/ Meridian’s published fee schedule assigns a specific charge to a home-occupation accessory-use application. https://apps.meridiancity.org/CITYFEEWEB/ A residential cleaner whose employees report to the house, whose vans occupy street or driveway space, or whose chemicals and equipment are stored onsite can therefore trigger a different local analysis from a sole operator who performs all work at customer premises.

Caldwell imposes a more explicit local business-permit regime. The city states that every person engaging in business within Caldwell must obtain a business license or permit before beginning operations. https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms/Business-License-Permit A cleaner based at a residence must separately obtain a home-occupation permit, and Caldwell’s code authorizes compliance inspections and revocation when the operation violates federal, state, or municipal requirements. https://codelibrary.amlegal.com/codes/caldwellid/latest/caldwell_id/0-0-0-61956 The city’s home-occupation application requires the resident and property owner to document the proposed activity under Caldwell’s land-use definition. https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/applications/home-occupation-application.pdf The implication is that two otherwise identical cleaning firms face different local startup procedures depending on whether their dispatch address lies in Meridian or Caldwell.

Idaho’s pesticide rules reach cleaning providers when they apply products whose legal function is pesticidal, including qualifying disinfectants, sanitizers, fungicides, virucides, bactericides, and mold-control products. IDAPA 02.03.03 governs pesticide use, applicator licensing, registration, storage, handling, transportation, and disposal under Idaho Code section 22-3421. https://adminrules.idaho.gov/rules/current/02/020303.pdf A cleaning company’s marketing language can therefore affect its regulatory exposure: claiming that an application kills, destroys, repels, mitigates, or controls a regulated organism can place the activity within pesticide law even when the operator describes the service commercially as “deep cleaning” or “disinfection.” The rule’s relevance is strongest for healthcare cleaning, school disinfection, mold treatment, odor-control chemistry, post-illness service, and commercial antimicrobial fogging.

Waste classification determines whether a specialty cleaner remains within ordinary solid-waste handling or enters hazardous-waste management. Idaho’s current Solid Waste Management Rules implement the state’s open-dumping prohibition and establish authorization and operating requirements for solid-waste facilities. https://adminrules.idaho.gov/rules/current/58/580106.pdf Idaho’s hazardous-waste rules incorporate federal standards governing waste identification, accumulation, storage, transportation, treatment, and disposal under the Idaho Hazardous Waste Management Act. https://adminrules.idaho.gov/rules/current/58/580105.pdf The regulatory graph is consequential for trauma cleanup, chemical-spill response, contaminated-soil removal, industrial degreasing, solvent cleanup, and post-fire debris: the same physical cleanup activity can produce ordinary municipal waste, regulated medical-type material, hazardous waste, asbestos-containing material, or wastewater depending on what is collected and how it is characterized.

Idaho’s wastewater rules apply to entities planning, constructing, or operating facilities that treat domestic or industrial wastewater before land application or surface-water discharge. https://adminrules.idaho.gov/rules/current/58/580116.pdf Most cleaning companies do not operate wastewater-treatment facilities, but the rule defines the downstream infrastructure on which carpet extractors, food-sanitation crews, pressure washers, laundry operations, restoration companies, and industrial cleaners depend. This creates a receiving-side constraint: municipal wastewater systems and pretreatment programs determine which liquids may be discharged, while the cleaner controls chemical selection, dilution, solids capture, grease removal, and transport.

Professional formation in this market is certification-driven and employer-driven rather than college-degree-driven. The Institute of Inspection, Cleaning and Restoration Certification develops standards and credentials covering cleaning, inspection, water damage, fire restoration, mold remediation, carpet cleaning, upholstery, odor control, and related technical work. https://iicrc.org/ Its certification catalog gives practitioners a route from entry-level cleaning credentials into specialized restoration disciplines. https://iicrc.org/iicrccertifications/ The IICRC Carpet Cleaning Technician credential covers fiber identification, yarn and carpet construction, finishes, soil conditions, cleaning chemistry, methods, and practical service problems. https://iicrc.org/cct/ Boise-area practitioners can access in-person IICRC instruction through The Flying Rug Guy’s Boise training program, which advertises local certification classes and examinations. https://theflyingrugguy.com/training/ This local training availability reduces the need for technicians to travel out of state and strengthens the Treasure Valley’s capacity to support certified carpet, textile, restoration, and inspection firms.

IICRC’s live-stream system broadens access for Treasure Valley workers who cannot attend scheduled classroom programs. https://iicrc.org/livestreaming/ The resulting workforce pipeline is modular: an entry-level cleaner can gain employer experience, obtain a Carpet Cleaning Technician credential, add water-restoration or odor-control training, become a lead technician, and eventually move into estimating, insurance documentation, project management, or ownership. That structure explains why restoration and specialty-cleaning businesses can recruit without relying on a conventional Idaho apprenticeship program while still signaling technical competence to insurers and institutional customers.

ISSA’s Cleaning Management Institute provides a parallel certification path for custodial technicians, supervisors, trainers, and facility managers. https://cmi.issa.com/ ISSA’s broader education platform supplies professional-cleaning courses and credentials across operational and management levels. https://www.issa.com/education/ The IICRC pathway is concentrated on inspection, textiles, restoration, and technical remediation, while CMI is oriented toward scalable custodial systems, supervision, procedure standardization, productivity, quality control, and facility operations. The two systems therefore correspond to different local market structures: restoration companies and carpet specialists benefit from IICRC credentials, while schools, universities, healthcare systems, janitorial contractors, and municipal facilities benefit from CMI-style workforce standardization.

Boise State University demonstrates how institutional employers create internal career ladders even without a public cleaning-college major. The university’s classified job architecture separately identifies custodial, environmental safety, facilities maintenance, facilities operations, engineering, landscape, mechanical, and skilled-trades career families. https://www.boisestate.edu/jobs/career-ladders/ Its building-coordinator policy positions custodial services within a broader security and building-management system by making coordinators liaisons among occupants, custodial staff, and university security. https://www.boisestate.edu/policy/facilities-planning-campus-safety/policy-title-building-coordinator-policy/ This institutional design creates progression from cleaner to lead, supervisor, building coordinator, facilities operations, environmental safety, or management even when the initial job requires no degree.

Consumer discovery is increasingly controlled by aggregators that determine which local firms receive calls, quote requests, and reputation signals. Angi maintains a Meridian dryer-vent-cleaning marketplace extending its location graph across Boise, Garden City, Star, Eagle, Caldwell, Kuna, Middleton, Melba, Greenleaf, Marsing, and surrounding communities. https://www.angi.com/companylist/us/id/meridian/dryer-vent-cleaning.htm The platform organizes vendors by service category, geography, ratings, and customer reviews, enabling a niche provider to compete beyond its own website while simultaneously making the provider dependent on platform ranking, lead pricing, review volume, and category accuracy. A business that is technically strong but misclassified as general housecleaning rather than dryer-vent service, trauma remediation, hood cleaning, or industrial pressure washing can lose visibility because aggregator taxonomies mediate consumer discovery.

Franchise and national-network expansion produces a second form of platform dependence. HOODZ supplies a national category brand for commercial exhaust cleaning while the Treasure Valley franchise executes locally. https://www.hoodzinternational.com/treasure-valley/ SERVPRO’s Boise biohazard page similarly combines local emergency response with a nationally recognized restoration system. https://www.servpro.com/locations/id/servpro-of-boise/services/cleaning/specialty/biohazard-cleaning Stanley Steemer’s Boise location brings centralized branding, fleet systems, equipment standards, and broad service bundling into competition with independent carpet and duct cleaners. https://www.stanleysteemer.com/locations/ID/Boise/967 The market implication is not that independents disappear; it is that customer acquisition, training, equipment purchasing, insurance relationships, and operating procedures become progressively standardized through franchise and national-brand networks.

The growth of specialty firms also reveals how Treasure Valley expansion creates viable subcategories below general cleaning. Dryer On Fire can serve eight named municipalities because the metropolitan housing stock supplies enough distributed dryer systems to sustain a focused route business. https://dryeronfire.com/ Bare Metal Standard can base a kitchen-exhaust operation in Garden City while serving the entire Valley because restaurant ventilation systems require recurring specialist service. https://www.baremetalstandard.com/idaho/ Sano Blast can market dry-ice blasting across Idaho because high-value industrial, automotive, restoration, and equipment-cleaning jobs justify a wider service radius than recurring housecleaning. https://sanoblast.com/home/ The geographic scale of the market therefore varies by ticket size and specialization: low-ticket recurring cleaners require route density, while rare technical services can economically cover the entire region or state.

The cleaning vertical’s connection to fire protection is broader than hood cleaning. Dryer-vent firms sell lint removal as a safety and airflow service; hood cleaners remove combustible grease from restaurant exhaust systems; restoration firms respond after fire and smoke damage; dry-ice blasting firms remove soot and residue from sensitive surfaces; janitorial companies manage combustible waste and chemical storage. Dryer On Fire’s Treasure Valley service model links residential cleaning directly to appliance performance and fire prevention. https://dryeronfire.com/ Bare Metal Standard’s inspection-led hood-cleaning model links restaurant sanitation to commercial fire-code readiness. https://www.baremetalstandard.com/idaho/ Stanley Steemer’s Boise water-damage response links household cleaning to post-loss emergency restoration. https://www.stanleysteemer.com/locations/ID/Boise/967 These are separate service categories operationally but converge in insurer loss prevention and building-risk management.

The vertical’s connection to semiconductor and advanced manufacturing is emerging through industrial-cleaning capability rather than ordinary janitorial labor. Dry-ice blasting can clean machinery and sensitive assemblies with limited secondary waste, while hazardous-waste and wastewater rules govern residues removed from production equipment. https://www.coldjet.com/dry-ice-blasting/industries/contract-cleaning/ https://adminrules.idaho.gov/rules/current/58/580105.pdf The inference is that Treasure Valley expansion in precision manufacturing increases demand not merely for more custodians but for contractors capable of documented contamination control, nonabrasive equipment cleaning, controlled chemical use, hazardous-waste characterization, and production-compatible scheduling.

The local cleaning market remains structurally favorable to small firms because general entry barriers are low, but the newly identified subcategories show that profitable defensibility rises with regulatory complexity, recurring inspection requirements, specialized equipment, certification, emergency availability, and integration with customer risk systems. Home cleaning can be launched with limited capital, while biohazard remediation, hood cleaning, dry-ice blasting, fleet washing, water restoration, and technical carpet care require progressively greater investment in training, insurance, equipment, documentation, waste management, and customer trust. Municipal home-occupation controls in Meridian and Caldwell shape the smallest entrants; Idaho pesticide, solid-waste, hazardous-waste, and wastewater rules shape specialty operators; franchise systems and review aggregators shape customer acquisition; certification bodies shape technical legitimacy. https://meridiancity.org/community-development/planning/general-information-faq/ https://codelibrary.amlegal.com/codes/caldwellid/latest/caldwell_id/0-0-0-61956 https://adminrules.idaho.gov/rules/current/02/020303.pdf https://adminrules.idaho.gov/rules/current/58/580106.pdf https://adminrules.idaho.gov/rules/current/58/580105.pdf https://adminrules.idaho.gov/rules/current/58/580116.pdf

https://www.biooneboise.com/ — Local Bio-One operator page identifying Boise-area trauma, hoarding, blood, odor, animal-waste, and distressed-property remediation services.

https://www.steri-clean.com/service-areas/idaho/ — Steri-Clean’s Idaho service page covering crime-scene, trauma, hoarding, death, blood, and biohazard cleanup.

https://crimecleaners.com/locations/idaho-crime-scene-clean-up/boise-crime-scene-cleanup-2/ — Boise-specific Steri-Clean page describing local trauma and biohazard-response capability.

https://www.servpro.com/locations/id/servpro-of-boise/services/cleaning/specialty/biohazard-cleaning — SERVPRO of Boise’s specialty biohazard-cleaning service page.

https://www.baremetalstandard.com/idaho/ — Bare Metal Standard’s Garden City kitchen-exhaust-cleaning operation and Idaho service territory.

https://www.hoodzinternational.com/treasure-valley/ — HOODZ of Treasure Valley’s commercial-kitchen and exhaust-cleaning service page.

https://www.franchise.org/2026/01/hoodz-comes-to-idaho-with-new-franchise-location-opening/ — International Franchise Association report on HOODZ entering Idaho through a Treasure Valley franchise in 2026.

https://greasebusters.com/locations/boise-idaho/ — GreaseBusters Boise page covering hood, duct, fan, kitchen, documentation, and fire-department reporting services.

https://hoodandduct.com/eagle-idaho/ — Eagle and Treasure Valley commercial exhaust-cleaning operator page.

https://sanoblast.com/home/ — Sano Blast Restoration’s Idaho dry-ice-blasting and surface-restoration service page.

https://www.coldjet.com/dry-ice-blasting/industries/contract-cleaning/ — Equipment-manufacturer description of dry-ice-blasting systems used by contract cleaners.

https://solpressurewash.com/heavy-equipment-fleet-pressure-washing/ — Treasure Valley fleet and heavy-equipment pressure-washing service page.

https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-13449 — Boise’s Stormwater Management and Discharge Control Ordinance.

https://www.cityofnampa.us/DocumentCenter/View/13231/2021-MS4-Permit--City-of-Nampa?bidId= — Nampa’s municipal stormwater permit addressing pollutant-generating activities including vehicle washing and power washing.

https://www.cityofnampa.us/DocumentCenter/View/19657/Nampa-Spill-Prevention-and-Respone-Plan-Final — Nampa’s spill-prevention and cleanup plan governing containment, contractor involvement, and disposal.

https://www.cityofnampa.us/DocumentCenter/View/13465/Industrial-Wastewater-Capacity-Policy-Final_August-3-2021 — Nampa’s industrial-wastewater capacity and pretreatment policy.

https://dryeronfire.com/ — Treasure Valley dryer-vent and air-duct cleaning operator serving Boise, Meridian, Nampa, Caldwell, Eagle, Star, Kuna, and Middleton.

https://codysappliancerepair.com/dryer-vent-cleaning-boise/ — Cody’s Appliance Repair page integrating dryer-vent cleaning with appliance service.

https://kingswayidaho.com/dryer-vent-cleaning/ — Kingsway Idaho’s locally owned dryer-vent and carpet-cleaning service page.

https://www.systemkleen.com/carpet-cleaning-services — System Kleen’s Meridian and Treasure Valley carpet-cleaning page describing more than twenty-eight years of experience.

https://www.stanleysteemer.com/locations/ID/Boise/967 — Stanley Steemer’s Boise carpet, upholstery, tile, rug, duct, and water-restoration location page.

https://www.superiorcarpetandair.com/cleaning-tips-insights-for-boise-the-treasure-valley — Superior Carpet and Air’s Treasure Valley carpet, duct, vent, and commercial-cleaning resource.

https://meridiancity.org/city-clerk/license-and-permit-applications/ — Meridian’s official statement that it has no general business license while retaining activity-specific permits.

https://meridiancity.org/community-development/planning/general-information-faq/ — Meridian’s home-occupation policy requiring low-impact residential operations.

https://apps.meridiancity.org/CITYFEEWEB/ — Meridian’s official fee schedule, including the home-occupation accessory-use fee.

https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms/Business-License-Permit — Caldwell’s mandatory business-license and permit requirements.

https://codelibrary.amlegal.com/codes/caldwellid/latest/caldwell_id/0-0-0-61956 — Caldwell’s home-occupation code governing permits, inspections, compliance, and revocation.

https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/applications/home-occupation-application.pdf — Caldwell’s official home-occupation permit application.

https://adminrules.idaho.gov/rules/current/02/020303.pdf — IDAPA 02.03.03 governing pesticide registration, use, applicator licensing, storage, handling, transportation, and disposal.

https://adminrules.idaho.gov/rules/current/58/580106.pdf — Idaho’s current Solid Waste Management Rules.

https://adminrules.idaho.gov/rules/current/58/580105.pdf — Idaho’s current hazardous-waste rules incorporating federal waste-management standards.

https://adminrules.idaho.gov/rules/current/58/580116.pdf — Idaho’s current wastewater rules for domestic and industrial wastewater infrastructure.

https://iicrc.org/ — Institute of Inspection, Cleaning and Restoration Certification standards and credentialing portal.

https://iicrc.org/iicrccertifications/ — IICRC’s catalog of cleaning, inspection, and restoration certifications.

https://iicrc.org/cct/ — IICRC Carpet Cleaning Technician certification requirements and curriculum.

https://theflyingrugguy.com/training/ — Boise and Idaho Falls IICRC classroom-training provider.

https://iicrc.org/livestreaming/ — IICRC’s live-stream certification system for remote practitioners.

https://cmi.issa.com/ — ISSA Cleaning Management Institute’s custodial and supervisory certification portal.

https://www.issa.com/education/ — ISSA’s professional-cleaning education and certification platform.

https://www.boisestate.edu/jobs/career-ladders/ — Boise State career ladders for custodial, environmental-safety, facilities, mechanical, and skilled-trade personnel.

https://www.boisestate.edu/policy/facilities-planning-campus-safety/policy-title-building-coordinator-policy/ — Boise State policy connecting building coordinators, custodial services, occupants, and campus security.

https://www.angi.com/companylist/us/id/meridian/dryer-vent-cleaning.htm — Angi’s Meridian-area dryer-vent-cleaning marketplace and regional location graph.


SEMANTIC EDGE LEDGER · CLEANING_SERVICES · refinery-treasurevalley-v1.0.0
85 🌲 EVERGREEN · 72 🌿 BRANCH · 1 🫐 BERRY · 0 🌱 SEED
85 🌲 EVERGREEN
72 🌿 BRANCH
1 🫐 BERRY
0 🌱 SEED
Articles raw: 161 · Deduped: 158 · Entities: 0 · Sections: 0 · Noise filtered: 0 · Dropped noise: 0 · Dropped dupes: 3
EXACT TITLE 84 KW HIGH 72 URL CROSSREF 1 KW LOW 1
◈ 🌲 EVERGREEN 85 EDGES
1.00
vertical-level
ada county,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ada county,". Entity: vertical-level.
1.00
Agriculture ↗ Q11451 EXACT TITLE
vertical-level
agriculture
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "agriculture". Entity: vertical-level.
1.00
vertical-level
duct
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "duct". Entity: vertical-level.
1.00
Angi ↗ Q85741689 EXACT TITLE
vertical-level
angi
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "angi". Entity: vertical-level.
1.00
vertical-level
antimicrobial
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "antimicrobial". Entity: vertical-level.
1.00
vertical-level
apprenticeship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "apprenticeship". Entity: vertical-level.
1.00
Asbestos ↗ Q104085 EXACT TITLE
vertical-level
asbestos
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "asbestos". Entity: vertical-level.
1.00
vertical-level
background check
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "background check". Entity: vertical-level.
1.00
Bactericide ↗ Q804539 EXACT TITLE
vertical-level
bactericide
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "bactericide". Entity: vertical-level.
1.00
vertical-level
better business bureau
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "better business bureau". Entity: vertical-level.
1.00
vertical-level
bureau of labor statistics
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "bureau of labor statistics". Entity: vertical-level.
1.00
vertical-level
business license
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "business license". Entity: vertical-level.
1.00
vertical-level
canyon county,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "canyon county,". Entity: vertical-level.
1.00
vertical-level
carpet cleaning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "carpet cleaning". Entity: vertical-level.
1.00
vertical-level
certificate of occupancy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "certificate of occupancy". Entity: vertical-level.
1.00
Cleaner ↗ Q1760141 EXACT TITLE
vertical-level
cleaner
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "cleaner". Entity: vertical-level.
1.00
Cleaning ↗ Q12773274 EXACT TITLE
vertical-level
cleaning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "cleaning". Entity: vertical-level.
1.00
vertical-level
college of western idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "college of western idaho". Entity: vertical-level.
1.00
vertical-level
confined space
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "confined space". Entity: vertical-level.
1.00
vertical-level
construction
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "construction". Entity: vertical-level.
1.00
Contract ↗ Q93288 EXACT TITLE
vertical-level
contract
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "contract". Entity: vertical-level.
1.00
Corporation ↗ Q167037 EXACT TITLE
vertical-level
corporation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "corporation". Entity: vertical-level.
1.00
Dairy ↗ Q637776 EXACT TITLE
vertical-level
dairy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "dairy". Entity: vertical-level.
1.00
Detergent ↗ Q334637 EXACT TITLE
vertical-level
detergent
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "detergent". Entity: vertical-level.
1.00
vertical-level
disaster restoration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "disaster restoration". Entity: vertical-level.
1.00
Disinfectant ↗ Q73984 EXACT TITLE
vertical-level
disinfectant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "disinfectant". Entity: vertical-level.
1.00
vertical-level
dry cleaning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "dry cleaning". Entity: vertical-level.
1.00
vertical-level
dry-ice blasting
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "dry-ice blasting". Entity: vertical-level.
1.00
Ergonomics ↗ Q1750812 EXACT TITLE
vertical-level
ergonomics
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ergonomics". Entity: vertical-level.
1.00
vertical-level
exhaust system
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "exhaust system". Entity: vertical-level.
1.00
vertical-level
fall protection
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fall protection". Entity: vertical-level.
1.00
Fire ↗ Q3196 EXACT TITLE
vertical-level
fire
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fire". Entity: vertical-level.
1.00
vertical-level
fire prevention
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fire prevention". Entity: vertical-level.
1.00
vertical-level
fire protection
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fire protection". Entity: vertical-level.
1.00
Fungicide ↗ Q193237 EXACT TITLE
vertical-level
fungicide
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fungicide". Entity: vertical-level.
1.00
vertical-level
garden city,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "garden city,". Entity: vertical-level.
1.00
Glassdoor ↗ Q15954148 EXACT TITLE
vertical-level
glassdoor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "glassdoor". Entity: vertical-level.
1.00
vertical-level
government procurement
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "government procurement". Entity: vertical-level.
1.00
vertical-level
hazard communication
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hazard communication". Entity: vertical-level.
1.00
vertical-level
hazardous waste
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hazardous waste". Entity: vertical-level.
1.00
Hepatitis B ↗ Q6853 EXACT TITLE
vertical-level
hepatitis b
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hepatitis b". Entity: vertical-level.
1.00
Hepatitis C ↗ Q154869 EXACT TITLE
vertical-level
hepatitis c
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hepatitis c". Entity: vertical-level.
1.00
Hoarding ↗ Q1343347 EXACT TITLE
vertical-level
hoarding
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hoarding". Entity: vertical-level.
1.00
vertical-level
home business
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "home business". Entity: vertical-level.
1.00
Hospital ↗ Q16917 EXACT TITLE
vertical-level
hospital
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hospital". Entity: vertical-level.
1.00
Hotel ↗ Q27686 EXACT TITLE
vertical-level
hotel
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "hotel". Entity: vertical-level.
1.00
vertical-level
housekeeping
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "housekeeping". Entity: vertical-level.
1.00
vertical-level
idaho state
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho state". Entity: vertical-level.
1.00
Idaho ↗ Q1221 EXACT TITLE
vertical-level
idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho". Entity: vertical-level.
1.00
Indeed ↗ Q1045367 EXACT TITLE
vertical-level
indeed
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "indeed". Entity: vertical-level.
1.00
vertical-level
industrial wastewater
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "industrial wastewater". Entity: vertical-level.
1.00
vertical-level
infection prevention
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "infection prevention". Entity: vertical-level.
1.00
Insurance ↗ Q43183 EXACT TITLE
vertical-level
insurance
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "insurance". Entity: vertical-level.
1.00
vertical-level
internal revenue service
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "internal revenue service". Entity: vertical-level.
1.00
Laundry ↗ Q852100 EXACT TITLE
vertical-level
laundry
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "laundry". Entity: vertical-level.
1.00
LinkedIn ↗ Q213660 EXACT TITLE
vertical-level
linkedin
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "linkedin". Entity: vertical-level.
1.00
Logistics ↗ Q177777 EXACT TITLE
vertical-level
logistics
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "logistics". Entity: vertical-level.
1.00
Maid ↗ Q833860 EXACT TITLE
vertical-level
maid
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "maid". Entity: vertical-level.
1.00
vertical-level
manufacturing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "manufacturing". Entity: vertical-level.
1.00
Mold ↗ Q159341 EXACT TITLE
vertical-level
mold
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mold". Entity: vertical-level.
1.00
Odor ↗ Q485537 EXACT TITLE
vertical-level
odor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "odor". Entity: vertical-level.
1.00
vertical-level
on-the-job training
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "on-the-job training". Entity: vertical-level.
1.00
vertical-level
personal protective equipment
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "personal protective equipment". Entity: vertical-level.
1.00
Pesticide ↗ Q131656 EXACT TITLE
vertical-level
pesticide
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "pesticide". Entity: vertical-level.
1.00
vertical-level
powered industrial truck
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "powered industrial truck". Entity: vertical-level.
1.00
vertical-level
pressure washing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "pressure washing". Entity: vertical-level.
1.00
vertical-level
property management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "property management". Entity: vertical-level.
1.00
Real estate ↗ Q684740 EXACT TITLE
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
Restaurant ↗ Q11707 EXACT TITLE
vertical-level
restaurant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "restaurant". Entity: vertical-level.
1.00
vertical-level
short-term rental
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "short-term rental". Entity: vertical-level.
1.00
Smoke ↗ Q130768 EXACT TITLE
vertical-level
smoke
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "smoke". Entity: vertical-level.
1.00
vertical-level
sole proprietorship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "sole proprietorship". Entity: vertical-level.
1.00
vertical-level
stanley steemer
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "stanley steemer". Entity: vertical-level.
1.00
vertical-level
steam cleaning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "steam cleaning". Entity: vertical-level.
1.00
Stormwater ↗ Q1421263 EXACT TITLE
vertical-level
stormwater
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "stormwater". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
1.00
vertical-level
universal precautions
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "universal precautions". Entity: vertical-level.
1.00
Upholstery ↗ Q1123578 EXACT TITLE
vertical-level
upholstery
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "upholstery". Entity: vertical-level.
1.00
vertical-level
ventilation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ventilation". Entity: vertical-level.
1.00
Virucide ↗ Q3560867 EXACT TITLE
vertical-level
virucide
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "virucide". Entity: vertical-level.
1.00
Warehouse ↗ Q181623 EXACT TITLE
vertical-level
warehouse
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "warehouse". Entity: vertical-level.
1.00
vertical-level
waste management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "waste management". Entity: vertical-level.
1.00
Wastewater ↗ Q336191 EXACT TITLE
vertical-level
wastewater
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "wastewater". Entity: vertical-level.
1.00
Zoning ↗ Q702232 EXACT TITLE
vertical-level
zoning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "zoning". Entity: vertical-level.
0.9500
vertical-level
URL CROSSREF: Wikipedia article external links match URLs found in research markdown. Score: 0.95. Matched URLs: https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030. Entity: vertical-level.
◈ 🌿 BRANCH 72 EDGES
0.9091
vertical-level
cleancleanerscleaningfloorfloorsjobmainmajoroccupationthroughout
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "clean", "cleaners", "cleaning", "floor", "floors", "job", "main", "major", "occupation", "throughout". Score: 0.9091. Entity: vertical-level.
0.7857
vertical-level
adaamongboisecapitalcensuscitiesidahomakingmeridianpopulationsecond
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "census", "cities", "idaho", "making", "meridian", "population", "second". Score: 0.7857. Entity: vertical-level.
0.7778
vertical-level
adaboisecensuseagleidahonorthwestpopulation
KEYWORD OVERLAP (high): 7 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "census", "eagle", "idaho", "northwest", "population". Score: 0.7778. Entity: vertical-level.
0.7333
vertical-level
adaadditionalboisecensusgainidahokunametropolitannearlypercentpopulation
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "additional", "boise", "census", "gain", "idaho", "kuna", "metropolitan", "nearly", "percent", "population". Score: 0.7333. Entity: vertical-level.
0.7273
vertical-level
boisecanyoncensusidahometropolitanmiddletonnampapopulation
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "canyon", "census", "idaho", "metropolitan", "middleton", "nampa", "population". Score: 0.7273. Entity: vertical-level.
0.7143
vertical-level
actdisposalfederalgoverninghazardouslawrecoveryresourcesolidwaste
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "disposal", "federal", "governing", "hazardous", "law", "recovery", "resource", "solid", "waste". Score: 0.7143. Entity: vertical-level.
0.6170
vertical-level
buildingbuildingscleaningcommonlydefineselectricalexamplefacilitiesfacilityfieldfunctionalinternationalmaintenancemanagementmechanicaloccupantsoperationsplanningrequirementssecuritysitesspacestandardstandardssupportsystemsystemsthemvaries
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "building", "buildings", "cleaning", "commonly", "defines", "electrical", "example", "facilities", "facility", "field", "functional", "international", "maintenance", "management", "mechanical", "occupants", "operations", "planning", "requirements", "security", "sites", "space", "standard", "standards", "support", "system", "systems", "them", "varies". Score: 0.6170. Entity: vertical-level.
0.6154
vertical-level
abmairelectricalenergyengineeringfacilityfoundedindustriesjanitoriallandscapelightingmanagementmechanicalprovidertransportationventilation
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abm", "air", "electrical", "energy", "engineering", "facility", "founded", "industries", "janitorial", "landscape", "lighting", "management", "mechanical", "provider", "transportation", "ventilation". Score: 0.6154. Entity: vertical-level.
0.5897
vertical-level
accesscleanercleaningcommercialcompensationcontractedequipmentexteriorformalglassin-personincreasinglylicensinglightingnationallyprocessesregulationsstructuraltechnologyvarywashingwindowwork
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "cleaner", "cleaning", "commercial", "compensation", "contracted", "equipment", "exterior", "formal", "glass", "in-person", "increasingly", "licensing", "lighting", "nationally", "processes", "regulations", "structural", "technology", "vary", "washing", "window", "work". Score: 0.5897. Entity: vertical-level.
0.5769
vertical-level
boisecenterclinicsemployeesfoundedhealthhealthcarehospitalhospitalsidaholukemedicalregionalstaffedsystem
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "center", "clinics", "employees", "founded", "health", "healthcare", "hospital", "hospitals", "idaho", "luke", "medical", "regional", "staffed", "system". Score: 0.5769. Entity: vertical-level.
0.5686
vertical-level
actadministrationchemicalscodecoldconditionscreatedemployeesemployersenvironmentexposurefederalgoverninggovernmenthazardshealthinstitutelaborlawlevelsmainmechanicalnationaloccupationaloshaprivaterecognizedsafetytoxic
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "chemicals", "code", "cold", "conditions", "created", "employees", "employers", "environment", "exposure", "federal", "governing", "government", "hazards", "health", "institute", "labor", "law", "levels", "main", "mechanical", "national", "occupational", "osha", "private", "recognized", "safety", "toxic". Score: 0.5686. Entity: vertical-level.
0.5532
vertical-level
actadministrationappliesapplycosmeticcoverenvironmentalepafederalfoodimplementlawprivateprotectionprovidingpublicqualityregulatedrequiredservedsetstandardssupplierssystemsystemswater
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "applies", "apply", "cosmetic", "cover", "environmental", "epa", "federal", "food", "implement", "law", "private", "protection", "providing", "public", "quality", "regulated", "required", "served", "set", "standards", "suppliers", "system", "systems", "water". Score: 0.5532. Entity: vertical-level.
0.5500
vertical-level
disposalfacilitymanagementmaterialsmunicipalprocessprogramsolidtechnicallytreatmentwaste
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "disposal", "facility", "management", "materials", "municipal", "process", "program", "solid", "technically", "treatment", "waste". Score: 0.5500. Entity: vertical-level.
0.5469
vertical-level
actagainstagenciesapplicatorsappropriateauthoritychemicalcomplianceconsumerscontrolenvironmentenvironmentalepaexpandedfederalframeworkgoverninghealthhumanlaworiginalpesticidepesticidesprocessproductsproofprotectprotectionregistrationregulatedregulationregulatorysalessetsystem
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "against", "agencies", "applicators", "appropriate", "authority", "chemical", "compliance", "consumers", "control", "environment", "environmental", "epa", "expanded", "federal", "framework", "governing", "health", "human", "law", "original", "pesticide", "pesticides", "process", "products", "proof", "protect", "protection", "registration", "regulated", "regulation", "regulatory", "sales", "set", "system". Score: 0.5469. Entity: vertical-level.
0.5385
vertical-level
actadministrationapplyassetsauthoritiesauthorizationbusinessbusinessescertificationclassifiedcorporationsdefinitiondependingemployeesgovernmenthomehomesindustryinspectionlargelicensemeasuresmedicalmethodsnetoperateoperationsorganizationspartnershipspolicyprogramsproprietorshipsregulatedregulatoryrequirerestaurantsretailrevenuesalesservingsizesmallsolesupporttaxtermstypesvarywork
KEYWORD OVERLAP (high): 49 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "apply", "assets", "authorities", "authorization", "business", "businesses", "certification", "classified", "corporations", "definition", "depending", "employees", "government", "home", "homes", "industry", "inspection", "large", "license", "measures", "medical", "methods", "net", "operate", "operations", "organizations", "partnerships", "policy", "programs", "proprietorships", "regulated", "regulatory", "require", "restaurants", "retail", "revenue", "sales", "serving", "size", "small", "sole", "support", "tax", "terms", "types", "vary", "work". Score: 0.5385. Entity: vertical-level.
0.5185
vertical-level
broadcategoryemployeesestateeventfoodhospitalityhotelsindustrylodgingplanningrealrestaurantstravel
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "broad", "category", "employees", "estate", "event", "food", "hospitality", "hotels", "industry", "lodging", "planning", "real", "restaurants", "travel". Score: 0.5185. Entity: vertical-level.
0.5000
vertical-level
boisebrightcanyoncensuscollegecomesfootprinthomeidahomeridianmetropolitannamenampanorthwestpopulationseconduniversitywestern
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "bright", "canyon", "census", "college", "comes", "footprint", "home", "idaho", "meridian", "metropolitan", "name", "nampa", "northwest", "population", "second", "university", "western". Score: 0.5000. Entity: vertical-level.
0.4896
vertical-level
associationavailabilitybusinessbusinessescertaincertificatecharacteristicscorporatecorporationsdependingdifferentdistinctdocumententityexampleformfoundingincorporatedinsteadinternallegalliabilitylicenselimitedllcsmedicaloperatingoperationsownerownersownershipphysicalprivateprofessionalproprietorshipratherrequiredrequiringrulessimilarlysinglesolestockstructuretaxtreatedtype
KEYWORD OVERLAP (high): 47 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "association", "availability", "business", "businesses", "certain", "certificate", "characteristics", "corporate", "corporations", "depending", "different", "distinct", "document", "entity", "example", "form", "founding", "incorporated", "instead", "internal", "legal", "liability", "license", "limited", "llcs", "medical", "operating", "operations", "owner", "owners", "ownership", "physical", "private", "professional", "proprietorship", "rather", "required", "requiring", "rules", "similarly", "single", "sole", "stock", "structure", "tax", "treated", "type". Score: 0.4896. Entity: vertical-level.
0.4831
vertical-level
anotherapplicationbarrierscleanupconditionsconstructioncontainedcontainmentcreatedependdisposalenvironmentalfieldgenerallyhazardoushealthhumanimpactindustrylandlowmaterialmaterialsmediamunicipalphysicalpressureprogramprogramsregulationsregulatoryremediationremovalrequiredrequirementsriskssoilstandardssubjectsubstancestreatmentwallswaste
KEYWORD OVERLAP (high): 43 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "another", "application", "barriers", "cleanup", "conditions", "construction", "contained", "containment", "create", "depend", "disposal", "environmental", "field", "generally", "hazardous", "health", "human", "impact", "industry", "land", "low", "material", "materials", "media", "municipal", "physical", "pressure", "program", "programs", "regulations", "regulatory", "remediation", "removal", "required", "requirements", "risks", "soil", "standards", "subject", "substances", "treatment", "walls", "waste". Score: 0.4831. Entity: vertical-level.
0.4828
vertical-level
adaboisecanyoncensushouseidahometropolitanmiddletonnamepopulationschoolschoolssharedstar
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "canyon", "census", "house", "idaho", "metropolitan", "middleton", "name", "population", "school", "schools", "shared", "star". Score: 0.4828. Entity: vertical-level.
0.4750
vertical-level
amongawardscasecompensationcoveragecreateddamagediffereconomicemployeeemployeesemployeremployersemploymentformgeneralgenerallyhealthhighinsurancelackliabilitylimitedlossmandatorymedicaloutsideplaceplansproblemsprovidingresultsecuritysystemwagewagesworkerworkers
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "awards", "case", "compensation", "coverage", "created", "damage", "differ", "economic", "employee", "employees", "employer", "employers", "employment", "form", "general", "generally", "health", "high", "insurance", "lack", "liability", "limited", "loss", "mandatory", "medical", "outside", "place", "plans", "problems", "providing", "result", "security", "system", "wage", "wages", "worker", "workers". Score: 0.4750. Entity: vertical-level.
0.4737
vertical-level
boisecaldwellcanyoncensuscollegeidaholocallymetropolitanpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "caldwell", "canyon", "census", "college", "idaho", "locally", "metropolitan", "population". Score: 0.4737. Entity: vertical-level.
0.4730
vertical-level
activitiesadministersadministrationbuildingcarryingconditionscoverdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgoverninggovernmenthealthhistoryhourimplementimprovejoblaboroccupationaloutprofitableregulationsreportssafetysecretarystandardsstatisticsthemwageworkers
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "administers", "administration", "building", "carrying", "conditions", "cover", "department", "departments", "directly", "economic", "employers", "employment", "federal", "governing", "government", "health", "history", "hour", "implement", "improve", "job", "labor", "occupational", "out", "profitable", "regulations", "reports", "safety", "secretary", "standards", "statistics", "them", "wage", "workers". Score: 0.4730. Entity: vertical-level.
0.4679
vertical-level
activitiesaffectanotherappropriatebodieschangesconditionscontaminationcontrolcumulativediffusedischargesexampleformformshumanimpactincreasedindustrialinfrastructureleadmainmanagementmetalspesticidesplansplantspollutantspowerproblemsproductsreducesrequiresresourceresultrunoffsanitationsolutionssourcesspillstormstormwatersubstancessurfacetechnologytoxictreatmenturbanwastewastewaterwater
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "affect", "another", "appropriate", "bodies", "changes", "conditions", "contamination", "control", "cumulative", "diffuse", "discharges", "example", "form", "forms", "human", "impact", "increased", "industrial", "infrastructure", "lead", "main", "management", "metals", "pesticides", "plans", "plants", "pollutants", "power", "problems", "products", "reduces", "requires", "resource", "result", "runoff", "sanitation", "solutions", "sources", "spill", "storm", "stormwater", "substances", "surface", "technology", "toxic", "treatment", "urban", "waste", "wastewater", "water". Score: 0.4679. Entity: vertical-level.
0.4655
vertical-level
amongbiohazardsbloodcertainchemicalchemicalsclassifiedcontactcorrosivesequipmentexposurehazardhazardoushazardshealthhighleadmaterialsoccupationalpersonalpressureprotectiveriskseparatelysmokesubstantiallytype
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "biohazards", "blood", "certain", "chemical", "chemicals", "classified", "contact", "corrosives", "equipment", "exposure", "hazard", "hazardous", "hazards", "health", "high", "lead", "materials", "occupational", "personal", "pressure", "protective", "risk", "separately", "smoke", "substantially", "type". Score: 0.4655. Entity: vertical-level.
0.4565
vertical-level
actappliesclaimcommercecoveragecreatesemployeesemployeremploymentexemptionfortygoodshourslaborlawminimumproductionprohibitsstandardswagework
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "applies", "claim", "commerce", "coverage", "creates", "employees", "employer", "employment", "exemption", "forty", "goods", "hours", "labor", "law", "minimum", "production", "prohibits", "standards", "wage", "work". Score: 0.4565. Entity: vertical-level.
0.4545
vertical-level
contactdangerousdirectenergyequipmenthazardousidentifyingindustriesisolatedlawlockoutmaintenancemethodoutpowerprocedureremoverepairrequiressafetysourcesstartuptagoutworkworker
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "contact", "dangerous", "direct", "energy", "equipment", "hazardous", "identifying", "industries", "isolated", "law", "lockout", "maintenance", "method", "out", "power", "procedure", "remove", "repair", "requires", "safety", "sources", "startup", "tagout", "work", "worker". Score: 0.4545. Entity: vertical-level.
0.4500
vertical-level
americanbuildbureaubusinessbusinessescensuscommercecommunitiescontaincurrentdatadepartmentdepartmentseconomiceconomyfederalfiregovernmenthospitalshouseinformationinfrastructurelocalmaintainmakingoccursplanpopulationproducingprogramsrelatedreportsschoolsstatisticstradetransportation
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "american", "build", "bureau", "business", "businesses", "census", "commerce", "communities", "contain", "current", "data", "department", "departments", "economic", "economy", "federal", "fire", "government", "hospitals", "house", "information", "infrastructure", "local", "maintain", "making", "occurs", "plan", "population", "producing", "programs", "related", "reports", "schools", "statistics", "trade", "transportation". Score: 0.4500. Entity: vertical-level.
0.4466
vertical-level
anotherarrangementbrandbusinesscapitalcertaincompetecomplyconditionscorporatedirecteconomicentityexampleexpansionexplicitlyfinancialfranchisegrowthinvestmentinvolvelargelegalliabilitylicenseslicensingmarketmeansmodelobligationsoutownedproceduresproductsproperpropertyregulateresearchriskrulesellsetsmallspecificsystemvehicle
KEYWORD OVERLAP (high): 46 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "another", "arrangement", "brand", "business", "capital", "certain", "compete", "comply", "conditions", "corporate", "direct", "economic", "entity", "example", "expansion", "explicitly", "financial", "franchise", "growth", "investment", "involve", "large", "legal", "liability", "licenses", "licensing", "market", "means", "model", "obligations", "out", "owned", "procedures", "products", "proper", "property", "regulate", "research", "risk", "rule", "sell", "set", "small", "specific", "system", "vehicle". Score: 0.4466. Entity: vertical-level.
0.4419
vertical-level
catalogcodecollectedcommonlydefinitiondisposalfooditemsmunicipalmunicipalitiespublicrubbishseparatelysolidsourcesspecificallytraditionaltypewaste
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "catalog", "code", "collected", "commonly", "definition", "disposal", "food", "items", "municipal", "municipalities", "public", "rubbish", "separately", "solid", "sources", "specifically", "traditional", "type", "waste". Score: 0.4419. Entity: vertical-level.
0.4400
vertical-level
airbuildingbuildingsconsiderationscontroldesignelectricalenergyenvironmentalhvacimpactmaintenancemechanicaloperatingperformancequalityregulatesystemstechnologyvehiclesventilationwater
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "air", "building", "buildings", "considerations", "control", "design", "electrical", "energy", "environmental", "hvac", "impact", "maintenance", "mechanical", "operating", "performance", "quality", "regulate", "systems", "technology", "vehicles", "ventilation", "water". Score: 0.4400. Entity: vertical-level.
0.4390
vertical-level
brandchemicalconsumerdatadependingdifferentdocumentenvironmentalgeneralhazardhazardshealthidenticalinformationinsteadinstructionslabellabelslistsmaterialnamenamesnationaloccupationalproceduresproductproductsrequirementsrisksafetysheetstandardstandardizedsubstancestypevary
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "brand", "chemical", "consumer", "data", "depending", "different", "document", "environmental", "general", "hazard", "hazards", "health", "identical", "information", "instead", "instructions", "label", "labels", "lists", "material", "name", "names", "national", "occupational", "procedures", "product", "products", "requirements", "risk", "safety", "sheet", "standard", "standardized", "substances", "type", "vary". Score: 0.4390. Entity: vertical-level.
0.4348
vertical-level
certificationcertificationseducationaljobperformpersonprofessionalpublictasktrade
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "certification", "certifications", "educational", "job", "perform", "person", "professional", "public", "task", "trade". Score: 0.4348. Entity: vertical-level.
0.4333
vertical-level
avoidbuildingscommercialdirectlydisposaldrainsindustrialinfrastructuremunicipalitiesoccursrunoffseparateservedservingsewerstormstormwatersurfacesystemsystemstransporttreatmenttypeurbanwastewaterwaters
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "avoid", "buildings", "commercial", "directly", "disposal", "drains", "industrial", "infrastructure", "municipalities", "occurs", "runoff", "separate", "served", "serving", "sewer", "storm", "stormwater", "surface", "system", "systems", "transport", "treatment", "type", "urban", "wastewater", "waters". Score: 0.4333. Entity: vertical-level.
0.4231
vertical-level
activitiesamericanassociationcarecovereddailydifferentemergencyfacilitiesfacilityhomehomeshospitalhourshousekeepinginstitutionsinsurancemedicalnearlyneedneedsoccupationalphysicalprivatepublicrequireresidentialrestseniorshort-termstafftermstype
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "american", "association", "care", "covered", "daily", "different", "emergency", "facilities", "facility", "home", "homes", "hospital", "hours", "housekeeping", "institutions", "insurance", "medical", "nearly", "need", "needs", "occupational", "physical", "private", "public", "require", "residential", "rest", "senior", "short-term", "staff", "terms", "type". Score: 0.4231. Entity: vertical-level.
0.4188
vertical-level
accountadvancedapplicationaroundavailabilityaveragebusinessescentralizedcitiesconnectedconstructioncriteriadecentralizeddemanddesigndevelopeddifferentdischargedischargesdisinfectiondrainageenergyenvironmentevenexamplefieldhumanindustriallandlargelevellowmainmanagementmunicipalneednetworkoperatingplantspopulationprocessprocessesproducequalityremovalremoveremovingrequirementsrunoffsanitationsecondaryselectionsewersolidstormwatersurroundingsystemstechnicaltechnologytreattreatedtreatmenttypeurbanwastewastewaterwater
KEYWORD OVERLAP (high): 67 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "account", "advanced", "application", "around", "availability", "average", "businesses", "centralized", "cities", "connected", "construction", "criteria", "decentralized", "demand", "design", "developed", "different", "discharge", "discharges", "disinfection", "drainage", "energy", "environment", "even", "example", "field", "human", "industrial", "land", "large", "level", "low", "main", "management", "municipal", "need", "network", "operating", "plants", "population", "process", "processes", "produce", "quality", "removal", "remove", "removing", "requirements", "runoff", "sanitation", "secondary", "selection", "sewer", "solid", "stormwater", "surrounding", "systems", "technical", "technology", "treat", "treated", "treatment", "type", "urban", "waste", "wastewater", "water". Score: 0.4188. Entity: vertical-level.
0.4125
vertical-level
actadministrationairamongbuildingcampuscarecentercenterschemicalschemistrycompensationcontrolcreateddeathdepartmentdisciplinesdistinctdivisionemergingengineeringexposurefederalfieldfoundedfunctionsgovernmenthazardhazardshealthhumanindustrialinformationinstituteintegratedknowledgelaboratoriesmakingmobilenamesnationaloccupationalofficesoperationsoshaoutpersonalpreventionproductsprogramprogramsprotectiveregulatoryresearchsafetyseparatesignssmallstaffstatisticssupportsystemtechnologytoxictradeworkers
KEYWORD OVERLAP (high): 66 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "air", "among", "building", "campus", "care", "center", "centers", "chemicals", "chemistry", "compensation", "control", "created", "death", "department", "disciplines", "distinct", "division", "emerging", "engineering", "exposure", "federal", "field", "founded", "functions", "government", "hazard", "hazards", "health", "human", "industrial", "information", "institute", "integrated", "knowledge", "laboratories", "making", "mobile", "names", "national", "occupational", "offices", "operations", "osha", "out", "personal", "prevention", "products", "program", "programs", "protective", "regulatory", "research", "safety", "separate", "signs", "small", "staff", "statistics", "support", "system", "technology", "toxic", "trade", "workers". Score: 0.4125. Entity: vertical-level.
0.4118
vertical-level
adaboisecanyoncitiescommonlycomponentcountieshomeidahomainmeridianmetropolitannampanearlynorthwestpercentpopulationsectiontreasurevalleywider
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "canyon", "cities", "commonly", "component", "counties", "home", "idaho", "main", "meridian", "metropolitan", "nampa", "nearly", "northwest", "percent", "population", "section", "treasure", "valley", "wider". Score: 0.4118. Entity: vertical-level.
0.4026
vertical-level
activebusinesscapitalcategorychangescontrolexpansionfinancefinancialfirmfirmsgeneralinsteadinvestmentlimitedmanagementoperationalotherwiseownershippartnershipspreferencesprivateproductproductspublicrathershiftsspecializedspecificstocktarget
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "business", "capital", "category", "changes", "control", "expansion", "finance", "financial", "firm", "firms", "general", "instead", "investment", "limited", "management", "operational", "otherwise", "ownership", "partnerships", "preferences", "private", "product", "products", "public", "rather", "shifts", "specialized", "specific", "stock", "target". Score: 0.4026. Entity: vertical-level.
0.4023
vertical-level
actaddressaddressingchangeschemicalcleancontaminationcontrolcoordinationdirectlyenvironmentalepafederalformgoverninglawmaintainmajormodernnameownedphysicalprotectionprovidingprovisionsqualityrecoveryregulationsresourcetechnicallythoughtreatmentwastewaterwaterwaters
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "address", "addressing", "changes", "chemical", "clean", "contamination", "control", "coordination", "directly", "environmental", "epa", "federal", "form", "governing", "law", "maintain", "major", "modern", "name", "owned", "physical", "protection", "providing", "provisions", "quality", "recovery", "regulations", "resource", "technically", "though", "treatment", "wastewater", "water", "waters". Score: 0.4023. Entity: vertical-level.
0.3966
vertical-level
airappliancecombinationcommercialexhaustexteriorfanfiregreasehomehoodkitchenmechanicaloutoutsideproductsremoveremovessmokesteamsystemtypevent
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "air", "appliance", "combination", "commercial", "exhaust", "exterior", "fan", "fire", "grease", "home", "hood", "kitchen", "mechanical", "out", "outside", "products", "remove", "removes", "smoke", "steam", "system", "type", "vent". Score: 0.3966. Entity: vertical-level.
0.3957
vertical-level
activitiesanimalbloodcapablecarecharacteristicschemicalchemicalsclinicscontactcontainedcontaminateddisposaldistinctemergencyenvironmentenvironmentalfacilitiesgeneralgeneratehazardoushealthhealthcarehomehomeshospitalhospitalshumanindustrialinfectiouslaboratoriesliquidmaterialmaterialsmedicalnormalofficesoperatingpotentiallypreventionproducersproperrequireresearchresultsharpssolidsourcessuppliestissuetreatmenttypetypesuniversalwaste
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "animal", "blood", "capable", "care", "characteristics", "chemical", "chemicals", "clinics", "contact", "contained", "contaminated", "disposal", "distinct", "emergency", "environment", "environmental", "facilities", "general", "generate", "hazardous", "health", "healthcare", "home", "homes", "hospital", "hospitals", "human", "industrial", "infectious", "laboratories", "liquid", "material", "materials", "medical", "normal", "offices", "operating", "potentially", "prevention", "producers", "proper", "require", "research", "result", "sharps", "solid", "sources", "supplies", "tissue", "treatment", "type", "types", "universal", "waste". Score: 0.3957. Entity: vertical-level.
0.3934
vertical-level
buildingbuildingscodescommonlycomponentconstructiondepartmentdivisioneventfirehazardhazardsimpactincreasesinspectionsmeasuresoccupantsoccurspracticespreventionsafetyschoolssetstructures
KEYWORD OVERLAP (high): 24 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "building", "buildings", "codes", "commonly", "component", "construction", "department", "division", "event", "fire", "hazard", "hazards", "impact", "increases", "inspections", "measures", "occupants", "occurs", "practices", "prevention", "safety", "schools", "set", "structures". Score: 0.3934. Entity: vertical-level.
0.3861
vertical-level
arounddepartmenteducationemployeeemployeesenergyenforcementenvironmentalepafederalfinancialgovernmenthouseindependentindustriesinformationjanuarylaboratorieslegallevellevelslocalmattersmeasuresmonitoringnationalofficesoperationpermittingpreventionprogramsproposedprotectionpublicrecognizedregionalresearchspecialistsstandards
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "around", "department", "education", "employee", "employees", "energy", "enforcement", "environmental", "epa", "federal", "financial", "government", "house", "independent", "industries", "information", "january", "laboratories", "legal", "level", "levels", "local", "matters", "measures", "monitoring", "national", "offices", "operation", "permitting", "prevention", "programs", "proposed", "protection", "public", "recognized", "regional", "research", "specialists", "standards". Score: 0.3861. Entity: vertical-level.
0.3855
vertical-level
careercollegedependingeconomiceducationeducationalformalformsfurthergeneralhigherknowledgelevellevelsmethodsnamesoccupationoccupationspersonplacerelatedschoolschoolsspecializedspecificspecificallytechnicaltechnologytradetrainingtypeuniversities
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "career", "college", "depending", "economic", "education", "educational", "formal", "forms", "further", "general", "higher", "knowledge", "level", "levels", "methods", "names", "occupation", "occupations", "person", "place", "related", "school", "schools", "specialized", "specific", "specifically", "technical", "technology", "trade", "training", "type", "universities". Score: 0.3855. Entity: vertical-level.
0.3816
vertical-level
acquisitionactactivitiesactualadditionaladministrationagenciesauthoritiesauthorizesbusinesscannotchemicalcleancleaningcleanupcombinationcompensationcontaminatedcontrolscreateddamagedepartmentdetermineearlyeligibleenvironmentenvironmentalepaestablishedexposurefederalgeneralgenerallygovernmenthazardhazardoushealthhumanidentifyidentifyinginfrastructureinjuriesinvestmentjobslawlegalliabilitylistmanagemeansnamenationaloccursoperationsoutpercentperformpetroleumpotentiallyprogramproposedprotectionpublicrankingrecognizedrecreationrelatedreleasesremediationresourceresponserestorationriskssecondaryseekingsitesitessmallestsubstancessupportsystemtaxthemtoxictrustuseswaste
KEYWORD OVERLAP (high): 87 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquisition", "act", "activities", "actual", "additional", "administration", "agencies", "authorities", "authorizes", "business", "cannot", "chemical", "clean", "cleaning", "cleanup", "combination", "compensation", "contaminated", "controls", "created", "damage", "department", "determine", "early", "eligible", "environment", "environmental", "epa", "established", "exposure", "federal", "general", "generally", "government", "hazard", "hazardous", "health", "human", "identify", "identifying", "infrastructure", "injuries", "investment", "jobs", "law", "legal", "liability", "list", "manage", "means", "name", "national", "occurs", "operations", "out", "percent", "perform", "petroleum", "potentially", "program", "proposed", "protection", "public", "ranking", "recognized", "recreation", "related", "releases", "remediation", "resource", "response", "restoration", "risks", "secondary", "seeking", "site", "sites", "smallest", "substances", "support", "system", "tax", "them", "toxic", "trust", "uses", "waste". Score: 0.3816. Entity: vertical-level.
0.3778
vertical-level
adaboisecapitalcensuscountiesemployershomeidaholevellocallymajormanufacturingmetropolitanpopulationtechnologytreasurevalley
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "capital", "census", "counties", "employers", "home", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "population", "technology", "treasure", "valley". Score: 0.3778. Entity: vertical-level.
0.3735
vertical-level
amongbloodclassifiedcontactcontaincontaminationcontractedcontroldeterminedifficultdirectlyevenhealthhepatitishigh-riskhumanidentifiedinfectioninfectiousmeansmedicalmicroorganismspathogenspotentiallyprecautionsratherstandardthoughtypetypesworkers
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "blood", "classified", "contact", "contain", "contamination", "contracted", "control", "determine", "difficult", "directly", "even", "health", "hepatitis", "high-risk", "human", "identified", "infection", "infectious", "means", "medical", "microorganisms", "pathogens", "potentially", "precautions", "rather", "standard", "though", "type", "types", "workers". Score: 0.3735. Entity: vertical-level.
0.3731
vertical-level
administersagriculturebudgetcommercialcommunitiescomponentcurrentdepartmentdirectlyendfederalfoodgovernmentnationalneedsproductionprogramprogramspromotesreportssafetysecretaryservedtogethertrade
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administers", "agriculture", "budget", "commercial", "communities", "component", "current", "department", "directly", "end", "federal", "food", "government", "national", "needs", "production", "program", "programs", "promotes", "reports", "safety", "secretary", "served", "together", "trade". Score: 0.3731. Entity: vertical-level.
0.3710
vertical-level
actadministrationconditionsdepartmenteducationemploymentestablishedfederalfirmhealthinspectionslaborlawoccupationaloshaprovidingratingsregulationsregulatorysafetysalesstandardstraining
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "conditions", "department", "education", "employment", "established", "federal", "firm", "health", "inspections", "labor", "law", "occupational", "osha", "providing", "ratings", "regulations", "regulatory", "safety", "sales", "standards", "training". Score: 0.3710. Entity: vertical-level.
0.3673
vertical-level
abilityaccessadditionalaffectaroundbarriersbasecarecommunitiesconditionsconstitutecoverageeconomiceconomyestablishedexamplefacilitiesfinancialgeneralhealthhealthcarehistoryhumaninformationinsurancelacklowmaintenancemeansmechanismmedicalneedsoccupationalorganizationspersonalphysicalpoliciespreventionprovidersprovidingpublicqualityreliablerequiressecondarysystemsystemstermstrainingtransportationtreatmentvaryworkworkforce
KEYWORD OVERLAP (high): 54 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "access", "additional", "affect", "around", "barriers", "base", "care", "communities", "conditions", "constitute", "coverage", "economic", "economy", "established", "example", "facilities", "financial", "general", "health", "healthcare", "history", "human", "information", "insurance", "lack", "low", "maintenance", "means", "mechanism", "medical", "needs", "occupational", "organizations", "personal", "physical", "policies", "prevention", "providers", "providing", "public", "quality", "reliable", "requires", "secondary", "system", "systems", "terms", "training", "transportation", "treatment", "vary", "work", "workforce". Score: 0.3673. Entity: vertical-level.
0.3654
vertical-level
affectbiohazardchemicalcontainmentdevelopedexposedgenerallyhazardhealthhumanlabelingmaterialmaterialspotentiallyprecautionsproductsriskriskssubstances
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affect", "biohazard", "chemical", "containment", "developed", "exposed", "generally", "hazard", "health", "human", "labeling", "material", "materials", "potentially", "precautions", "products", "risk", "risks", "substances". Score: 0.3654. Entity: vertical-level.
0.3578
vertical-level
accessactactivitiesadministrationbusinessbusinessescapitalcenterscertaincommunitiesconnectcontractsdirectoryeconomiceconomyenablingfederalfranchisegovernmentheldindependentjanuaryjobslaunchedleadleastmaintainmakingofficeownerspercentprogramprogramsreachrecoverysmallsupportuniversitiesvolumes
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "act", "activities", "administration", "business", "businesses", "capital", "centers", "certain", "communities", "connect", "contracts", "directory", "economic", "economy", "enabling", "federal", "franchise", "government", "held", "independent", "january", "jobs", "launched", "lead", "least", "maintain", "making", "office", "owners", "percent", "program", "programs", "reach", "recovery", "small", "support", "universities", "volumes". Score: 0.3578. Entity: vertical-level.
0.3551
vertical-level
affectagricultureanalysisapplicationboundarycasecharacteristicscontaminationdamagedifferentedgeexamplehazardshealthlandmakingmanagementmeansmechanismsmethodsmodelmodelsmonitoringoccursplantspollutantspresencepreventionproducesprotectionpublicqualityratherremediationsanitationsitesoilsuppliessurfacesystemsthereforetransporttreatmenttypewastewaterwaterwaterswiderzoning
KEYWORD OVERLAP (high): 49 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affect", "agriculture", "analysis", "application", "boundary", "case", "characteristics", "contamination", "damage", "different", "edge", "example", "hazards", "health", "land", "making", "management", "means", "mechanisms", "methods", "model", "models", "monitoring", "occurs", "plants", "pollutants", "presence", "prevention", "produces", "protection", "public", "quality", "rather", "remediation", "sanitation", "site", "soil", "supplies", "surface", "systems", "therefore", "transport", "treatment", "type", "wastewater", "water", "waters", "wider", "zoning". Score: 0.3551. Entity: vertical-level.
0.3519
vertical-level
actuallyaffectagainstarrangementcaseclaimclaimscompensationcontractcoveragecoveredcoverscreateddamagededicateddefaultevenexpresslygeneralinsurancelegalliabilitylossmodernotherwiseoutpoliciespolicyprotectprotectionratherriskrisksrulespecificspecifiedsystemthough
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actually", "affect", "against", "arrangement", "case", "claim", "claims", "compensation", "contract", "coverage", "covered", "covers", "created", "damage", "dedicated", "default", "even", "expressly", "general", "insurance", "legal", "liability", "loss", "modern", "otherwise", "out", "policies", "policy", "protect", "protection", "rather", "risk", "risks", "rule", "specific", "specified", "system", "though". Score: 0.3519. Entity: vertical-level.
0.3500
vertical-level
agriculturechangeschemicalclassificationclassificationsdifferentenvironmentalfiberfoodformformshomeimpactindustriallevelsmakingmethodsnecessaryneedsotherwisephysicalproductproductsrequiredsecondarysecurityturnswaste
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agriculture", "changes", "chemical", "classification", "classifications", "different", "environmental", "fiber", "food", "form", "forms", "home", "impact", "industrial", "levels", "making", "methods", "necessary", "needs", "otherwise", "physical", "product", "products", "required", "secondary", "security", "turns", "waste". Score: 0.3500. Entity: vertical-level.
0.3453
vertical-level
accessactivitiesadvancedanotherappropriatebackgroundbroadcarecenterscertifiedcheckschildcarecommunitiescomponentcorecoversdailyearlyeconomiceducationeducationalenvironmentsfacilityfamiliesfocusedformhome-basedhomeshousingimplicationsincreasedinstitutionslaborlicensedorganizationspersonprofessionalprogramproviderprovidersqualityreferencerequirerequiresschoolssupervisiontrainingwork
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "activities", "advanced", "another", "appropriate", "background", "broad", "care", "centers", "certified", "checks", "childcare", "communities", "component", "core", "covers", "daily", "early", "economic", "education", "educational", "environments", "facility", "families", "focused", "form", "home-based", "homes", "housing", "implications", "increased", "institutions", "labor", "licensed", "organizations", "person", "professional", "program", "provider", "providers", "quality", "reference", "require", "requires", "schools", "supervision", "training", "work". Score: 0.3453. Entity: vertical-level.
0.3365
vertical-level
appliescarecategorycleaningcommonlydevelopeddomesticemployeremploymenthomehouseholdlargelaundrylimitedmaintenancemanagementnecessaryoccupationalperformsperiodpersonplaceprovidingregulatedresidencesubjectsystemtasksthoughtraditionalwageswhoseworkworkerworkers
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "applies", "care", "category", "cleaning", "commonly", "developed", "domestic", "employer", "employment", "home", "household", "large", "laundry", "limited", "maintenance", "management", "necessary", "occupational", "performs", "period", "person", "place", "providing", "regulated", "residence", "subject", "system", "tasks", "though", "traditional", "wages", "whose", "work", "worker", "workers". Score: 0.3365. Entity: vertical-level.
0.3182
vertical-level
actinsteadlandmethodrubbishsitewaste
KEYWORD OVERLAP (high): 7 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "instead", "land", "method", "rubbish", "site", "waste". Score: 0.3182. Entity: vertical-level.
0.3172
Bleach ↗ Q11587 KW HIGH
vertical-level
activecapablechemicalchemicalscleaningconditionscontactcontaincontroldamagedioxidedisinfectingequipmentfiberfoodgasgenerallyhealthhouseholdindustrialliquidmakingmaterialsnamenicheplacesprocessprocessesproductproductspropertiespurereleasesremoveremovingrequiredsanitationsanitizingsolutionsolutionsspecificallysubstancesthemtoxicuseswork
KEYWORD OVERLAP (high): 46 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "capable", "chemical", "chemicals", "cleaning", "conditions", "contact", "contain", "control", "damage", "dioxide", "disinfecting", "equipment", "fiber", "food", "gas", "generally", "health", "household", "industrial", "liquid", "making", "materials", "name", "niche", "places", "process", "processes", "product", "products", "properties", "pure", "releases", "remove", "removing", "required", "sanitation", "sanitizing", "solution", "solutions", "specifically", "substances", "them", "toxic", "uses", "work". Score: 0.3172. Entity: vertical-level.
0.3148
vertical-level
airappliancebecomebeddingdryerdryinghouseholditemslossmaintainneedpoweredremovespacesteamtextileswashing
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "air", "appliance", "become", "bedding", "dryer", "drying", "household", "items", "loss", "maintain", "need", "powered", "remove", "space", "steam", "textiles", "washing". Score: 0.3148. Entity: vertical-level.
0.3086
vertical-level
adaairbaseboisecentercommercialcommissiondepartmentfacilityfallsfieldfirefunctionsgeneralidahointernationalnationalnextoperatesprotectionreceiverequiringsupportuseswestern
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "air", "base", "boise", "center", "commercial", "commission", "department", "facility", "falls", "field", "fire", "functions", "general", "idaho", "international", "national", "next", "operates", "protection", "receive", "requiring", "support", "uses", "western". Score: 0.3086. Entity: vertical-level.
0.3061
vertical-level
associationconsumerdecadesdesigngrowthindependentlyindustryintegratedintensitylawlicensedmakingmarketmaterialmethodnetworkspowerproducingproductionrapidreachresearchrevenuesalessecondsegmentsemiconductorsingletechnologywider
KEYWORD OVERLAP (high): 30 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "association", "consumer", "decades", "design", "growth", "independently", "industry", "integrated", "intensity", "law", "licensed", "making", "market", "material", "method", "networks", "power", "producing", "production", "rapid", "reach", "research", "revenue", "sales", "second", "segment", "semiconductor", "single", "technology", "wider". Score: 0.3061. Entity: vertical-level.
0.2973
vertical-level
actadaagainstamendedbroadbusinesschangescharacteristicscoveredemployeesemployershivhouseimposesjanuarylawnationalprohibitsprotectionpublicrequirementsrequires
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "ada", "against", "amended", "broad", "business", "changes", "characteristics", "covered", "employees", "employers", "hiv", "house", "imposes", "january", "law", "national", "prohibits", "protection", "public", "requirements", "requires". Score: 0.2973. Entity: vertical-level.
0.2929
vertical-level
affectarrangementavoidbloodcallscarecertaincommonlyconditionsconsistsdegreedentalevidencefacialfocusedguidehistoryhivhospitalsinstitutionsmanagementmanualmedicalmodernoutpracticespractitionerpreventionprivatereconstructionrequireresearchsecondaryspecializationspecialtytechnicianstermstreatmentwaterworkwritten
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affect", "arrangement", "avoid", "blood", "calls", "care", "certain", "commonly", "conditions", "consists", "degree", "dental", "evidence", "facial", "focused", "guide", "history", "hiv", "hospitals", "institutions", "management", "manual", "medical", "modern", "out", "practices", "practitioner", "prevention", "private", "reconstruction", "require", "research", "secondary", "specialization", "specialty", "technicians", "terms", "treatment", "water", "work", "written". Score: 0.2929. Entity: vertical-level.
0.2869
Ammonia ↗ Q4087 KW HIGH
vertical-level
agriculturearoundbuildingchemicalchemicalsclassifiedcleaningcompositiondamagedirectlyenergyevenformformsgashazardoushouseholdindustrialliquidneedsoccurspressureprocessproductionprovidingpureroadservingsoilsolutionstablesystemstoxicwastewater
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agriculture", "around", "building", "chemical", "chemicals", "classified", "cleaning", "composition", "damage", "directly", "energy", "even", "form", "forms", "gas", "hazardous", "household", "industrial", "liquid", "needs", "occurs", "pressure", "process", "production", "providing", "pure", "road", "serving", "soil", "solution", "stable", "systems", "toxic", "waste", "water". Score: 0.2869. Entity: vertical-level.
0.2667
vertical-level
cleancleanerscleaningcontaindoorhandlehealthliquidsremoveremovingsubstancessurfaces
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "clean", "cleaners", "cleaning", "contain", "door", "handle", "health", "liquids", "remove", "removing", "substances", "surfaces". Score: 0.2667. Entity: vertical-level.
0.2642
vertical-level
boisecensuschamberchambersdatadistrictsdividedevengovernmenthouseidahopopulationsinglesubsequent
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "census", "chamber", "chambers", "data", "districts", "divided", "even", "government", "house", "idaho", "population", "single", "subsequent". Score: 0.2642. Entity: vertical-level.
0.2424
vertical-level
citiescoversidaholandmajornorthwestsouthernwestward
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cities", "covers", "idaho", "land", "major", "northwest", "southern", "westward". Score: 0.2424. Entity: vertical-level.
0.1905
vertical-level
buildingidahonearbysupreme
KEYWORD OVERLAP (high): 4 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "building", "idaho", "nearby", "supreme". Score: 0.1905. Entity: vertical-level.
0.1786
HIV ↗ Q15787 KW HIGH
vertical-level
allowsaveragebloodcontactdependingdirectexposurehivhumaninfectionlevellevelslowmechanismsnumbersprogressivelyresearchspecificallysystemtreatment
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "allows", "average", "blood", "contact", "depending", "direct", "exposure", "hiv", "human", "infection", "level", "levels", "low", "mechanisms", "numbers", "progressively", "research", "specifically", "system", "treatment". Score: 0.1786. Entity: vertical-level.
0.1562
vertical-level
boisedrainsidahourbanwestern
KEYWORD OVERLAP (high): 5 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "drains", "idaho", "urban", "western". Score: 0.1562. Entity: vertical-level.
◈ 🫐 BERRY 1 EDGES
0.1486
vertical-level
airbluedistinctformgenerallygrowthhumanplantsproducerelatedsurfaces
KEYWORD OVERLAP (low): 11 tokens shared (corpus-noise filtered). Tokens: "air", "blue", "distinct", "form", "generally", "growth", "human", "plants", "produce", "related", "surfaces". Score: 0.1486. Entity: vertical-level.
Provenance
Cleaning Services refinery-treasurevalley-v1.0.0 71,141 chars · 0 entities · 0 sections 158 articles · 158 edges 565e05f21800bf0c