—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Substance Use Recovery page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 147 edges
Information Vertical · Treasure Valley

Substance Use Recovery

0 Research Entities
147 Wikipedia Articles
147 Semantic Edges
0 Sections

Substance-use prevention, treatment, harm reduction, recovery support, crisis response, criminal-justice diversion, professional licensing, Medicaid financing, and controlled-substance oversight in the Treasure Valley operate as one interdependent behavioral-health system rather than as a single industry. The Idaho Department of Health and Welfare’s Division of Behavioral Health is the principal state behavioral-health authority, administering adult and youth behavioral-health programs, substance-use-disorder services, recovery supports, crisis resources, provider standards, and publicly financed care https://healthandwelfare.idaho.gov/services-programs/behavioral-health. The department defines substance-use disorder as recurrent alcohol or drug use producing clinically significant health, legal, occupational, educational, social, or functional impairment and states that the condition is treatable and compatible with sustained recovery https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-substance-use-disorder. Idaho’s operational continuum includes outpatient, intensive outpatient, residential, inpatient, withdrawal-management, crisis, medication, counseling, case-management, peer-support, and recovery-coaching functions, with entry routes through treatment providers, the Idaho Behavioral Health Plan, county courts, hospitals, crisis systems, 211 Idaho CareLine, and community organizations https://healthandwelfare.idaho.gov/services-programs/health-behavioral-health-and-substance-use-disorder https://healthandwelfare.idaho.gov/services-programs/behavioral-health/get-help-0.

The Idaho Behavioral Health Plan is the central public-financing and network-management infrastructure for Medicaid behavioral-health services, offering outpatient, inpatient, residential, and crisis care based on medical necessity and using Magellan Healthcare to administer the statewide network for Medicaid members and other eligible populations https://healthandwelfare.idaho.gov/providers/managed-care-providers/behavioral-health. Magellan’s Idaho resource system directs residents to local mental-health, substance-use, and recovery resources and functions as a navigational layer between state eligibility structures and community providers https://magellanofidaho.com/w/local-mh-su-rr-resources. Idaho Department of Health and Welfare provider pages centralize substance-use program information, reimbursement materials, participation requirements, departmental standards, recovery-coaching guidance, and DUI-evaluator information https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/recovery-coaching https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/driving-under-influence-evaluators. Recovery coaches are institutionally recognized as guides and mentors who remove practical barriers, connect people to recovery communities, and support continuity after acute treatment https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/recovery-coaching.

The Idaho Office of Drug Policy, located in Boise, leads statewide drug and substance-misuse policy and prevention through strategic plans, interagency collaboration, public education, grant administration, data coordination, prescription-drug-disposal initiatives, and issue-specific work concerning alcohol, opioids, and other drugs https://odp.idaho.gov/ https://odp.idaho.gov/wp-content/uploads/2025/05/ODP-Resource-Handout.pdf. Prevention Idaho operates as the state’s primary portal for prevention resources, funded programs, provider opportunities, training, and Substance Use Prevention, Treatment, and Recovery Services Block Grant activity https://prevention.odp.idaho.gov/ https://prevention.odp.idaho.gov/odp-grant-opportunities/ https://prevention.odp.idaho.gov/training/. The Office of Drug Policy’s State Epidemiological Outcomes Workgroup data dashboard supplies a statewide surveillance and planning layer for substance-use indicators and prevention decision-making https://odp.idaho.gov/seow-data-dashboard/. Boise State University’s Idaho RADAR Center preserves and distributes prevention research, historical needs assessments, training resources, and institutional literature, linking academic research to state agencies, coalitions, counselors, schools, and community prevention practitioners https://www.boisestate.edu/radar/newsletters-and-online-journals/ https://radarcart.boisestate.edu/library/files/2018/04/SAP_2017-Needs-Assessment_Final.pdf.

Central District Health is the public-health district serving Ada, Boise, Elmore, and Valley counties and therefore occupies a direct jurisdictional position over the Boise metropolitan portion of the Treasure Valley’s prevention, community-health, overdose, and opioid-settlement environment. A Boise State University Idaho Policy Institute environmental scan prepared for Central District Health found that the regional service system depends heavily on a limited number of withdrawal-management and crisis facilities, identified Allumbaugh House as one of the few detoxification providers serving Central District Health counties, reported annual service volumes of approximately 700 to 800 patients since 2020, found that approximately 96 to 98 percent of those patients received detoxification services, and documented a rise in reported daily detoxification cost from roughly $600 in 2020 to approximately $700 in 2023 https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/ https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf. The same environmental scan connects withdrawal management to emergency departments, law enforcement, crisis evaluation, housing instability, Medicaid access, uninsured care, transportation, and post-discharge placement, demonstrating that treatment capacity depends upon broader health, public-safety, and social-service infrastructure https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf.

Southwest District Health serves Canyon, Gem, Owyhee, Payette, Adams, and Washington counties and anchors the public-health side of the western Treasure Valley, including Nampa and Caldwell. Its fiscal-year 2024 impact report defines the district’s mission around preventing premature death, promoting healthy behavior, protecting community health, and coordinating regional partners, functions that place it upstream of treatment in prevention, surveillance, education, and community planning https://www.canyoncounty.id.gov/wp-content/uploads/2025/05/SWDH_Impact-Report_FY24_FINAL.pdf. Canyon County’s misdemeanor-probation system explicitly combines accountability and public protection with opportunities for competency development, and its operational links to DUI Court, domestic-violence court, veterans court, felony probation, community service, assessment, and treatment make the county justice system a significant referral and compliance channel for substance-use services https://www.canyoncounty.id.gov/elected-officials/commissioners/misdemeanor-probation/. Canyon County budget, court, probation, indigency, and public-health records show that behavioral-health and substance-use services are embedded in county expenditures, court-supervision programs, evaluations, medical-indigency processes, and contracted services rather than confined to standalone treatment centers https://www.canyoncounty.id.gov/wp-content/uploads/2024/10/Canyon-County-Fiscal-Year-2025-Board-of-County-Commissioners-Budget-Book.pdf https://www.canyoncounty.id.gov/wp-content/uploads/2025/04/ACFR-FY2024-Final.pdf.

Ada County’s justice and public-finance systems form the corresponding eastern Treasure Valley institutional layer. County budget documents identify statutory screenings, assessments, substance-abuse treatment, mental-health counseling, court programming, and opioid-related funding within county operations https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2019/08/FY-20-Budget-Book-Digital-Version.pdf. Ada County financial reporting has separately recorded opioid-settlement revenue, creating a restricted public-funding stream capable of supporting prevention, treatment, recovery, harm-reduction, and public-health interventions authorized under settlement terms https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2025/04/ACFR-2024-Online.pdf. These county functions connect substance-use services to prosecutors, public defenders, district courts, probation officers, treatment contractors, hospitals, emergency medical systems, jail-release planning, and indigent-care mechanisms, making the county courthouse and county budget structurally significant nodes in the regional recovery graph https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2019/08/FY-20-Budget-Book-Digital-Version.pdf.

Allumbaugh House is a critical low-barrier regional facility because it provides detoxification and substance-use services to insured, uninsured, and Medicaid populations and accepts referrals arising from hospitals, crisis evaluators, law enforcement, and community systems https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/. Its limited regional substitutes make it a capacity chokepoint: emergency departments may medically stabilize intoxication or withdrawal, but patients still require an appropriate receiving facility, transportation pathway, clinical handoff, and post-detox treatment placement https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf. This creates direct cross-domain edges from substance-use recovery to hospital bed utilization, emergency medicine, ambulance services, municipal policing, county detention, supportive housing, insurance authorization, and nonprofit case management https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf.

PEER Wellness Center represents the Treasure Valley’s nonclinical recovery-community infrastructure, providing free peer-based recovery-support services intended to prevent relapse, reduce isolation, solve practical problems, build social connection, and sustain long-term recovery among people affected by substance-use or mental-health disorders https://www.peerwellnesscenter.org/. Its service model occupies the space between formal treatment and independent community living, where meeting access, peer mentorship, employment stability, transportation, housing, family repair, social identity, and recovery-oriented activities influence whether a person maintains gains achieved in detoxification or clinical care https://www.peerwellnesscenter.org/. The center’s role illustrates why recovery capital is an infrastructure category: clinical discharge without safe housing, social support, transportation, employment, or continuing peer contact leaves major relapse drivers unresolved https://www.peerwellnesscenter.org/.

The Treasure Valley contains a mixed provider market of nonprofit, regional, and investor-operated organizations delivering different levels of care. Northpoint Recovery operates clinically oriented inpatient addiction treatment and serves as a major Boise-area residential provider for substance-use and co-occurring behavioral-health needs https://www.northpointrecovery.com/. Behavioral Health Group’s Boise operation specializes in medications for opioid-use disorder, including methadone, buprenorphine products, and naltrexone, placing it within the federally regulated opioid-treatment-program and medication-access segment https://www.bhgrecovery.com/locations/boise-id/. Eagle Creek Ranch Recovery operates a men’s treatment facility in Nampa and advertises detoxification, residential treatment, and clinically driven levels of care in a ranch-based setting https://idahorecoverycenter.com/. Recovery Ways Idaho supplies outpatient behavioral-health and addiction-related care using individualized therapy and evidence-based treatment approaches https://recoverywaysidaho.com/. Trivium Life Services maintains a Boise location within a nonprofit behavioral-health and long-term-support organization serving people seeking mental-health and related assistance https://www.triviumlifeservices.org/locations/id/boise/7/. Zelus Recovery markets substance-use programming to Boise and the broader Treasure Valley, including Boise, Meridian, Nampa, and Caldwell https://www.zelusrecovery.com/boise-substance-abuse-programs/. Icarus Wellness and Recovery offers addiction and mental-health treatment and reports acceptance of Idaho Medicaid and multiple commercial insurance plans, connecting clinical access directly to public and private payer networks https://icarusbehavioralhealthidaho.com/.

The region’s medication-based treatment infrastructure is governed simultaneously by federal opioid-treatment-program rules, Drug Enforcement Administration controlled-substance requirements, Idaho professional licensing, pharmacy law, and payer credentialing. Title 42 Code of Federal Regulations Part 8 establishes federal certification and care standards for opioid treatment programs, including programs dispensing methadone for opioid-use disorder https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8. SAMHSA’s 2024 revisions shifted the framework toward patient-centered care, permanently incorporated several pandemic-era flexibilities, expanded access, removed the former one-year opioid-use-history admission prerequisite, reduced barriers involving counseling participation, and allowed specified external or telehealth screening practices https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8/changes https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8/faqs. Opioid-treatment-program oversight remains multilateral, involving SAMHSA certification, DEA controlled-substance registration and security oversight, accreditation bodies, and state regulatory authority https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/become-otp.

The federal Controlled Substances Act classifies regulated drugs into five schedules based on accepted medical use, abuse potential, safety, and dependence liability and establishes the foundational legal structure for prescribing, dispensing, storing, documenting, and enforcing controlled substances used or encountered in addiction medicine https://www.dea.gov/drug-information/csa https://www.dea.gov/drug-information/drug-scheduling. DEA rules and registrations affect opioid-treatment programs, pharmacies, hospitals, physicians, advanced-practice clinicians, and other prescribers handling methadone, buprenorphine, benzodiazepines, stimulants, and controlled pain medications https://www.dea.gov/drug-information/csa. DEA has expressly described medication-assisted treatment as a recovery-supporting and overdose-prevention intervention and has adopted measures intended to expand access, particularly in rural and underserved areas https://www.dea.gov/press-releases/2022/03/23/deas-commitment-expanding-access-medication-assisted-treatment https://www.dea.gov/press-releases/2021/06/28/dea-finalizes-measures-expand-medication-assisted-treatment.

Substance-use treatment records occupy a privacy category more restrictive than ordinary healthcare records because 42 U.S.C. § 290dd-2 protects records identifying a person as having received substance-use-disorder education, prevention, training, treatment, rehabilitation, or research services in federally assisted programs https://www.law.cornell.edu/uscode/text/42/290dd-2. The implementing regulations in 42 CFR Part 2 restrict uses and disclosures of identifying substance-use records, define covered programs and information, regulate consent, authorize limited nonconsensual disclosures, establish medical-emergency and research provisions, and control judicial orders for disclosure https://www.law.cornell.edu/cfr/text/42/part-2 https://www.law.cornell.edu/cfr/text/42/2.12 https://www.law.cornell.edu/cfr/text/42/part-2/subpart-D https://www.law.cornell.edu/cfr/text/42/part-2/subpart-E. These rules materially affect data exchange among Treasure Valley treatment centers, hospitals, courts, probation departments, crisis teams, insurers, and primary-care providers because a technically available record is not necessarily legally redisclosable https://www.law.cornell.edu/cfr/text/42/2.2.

Idaho’s state regulatory structure is layered across the Department of Health and Welfare, the Division of Occupational and Professional Licenses, profession-specific boards, Medicaid contracting, controlled-substance law, and provider standards. Historical IDAPA 16.07.20 rules established approval and service standards for alcohol and substance-use-disorder treatment programs, including programs furnishing outpatient services to drug courts https://adminrules.idaho.gov/rules/2014/16/0720.pdf. Earlier and archived Department of Health and Welfare rule compilations document coverage definitions, treatment limitations, eligibility, provider obligations, and administrative-review mechanisms affecting publicly funded alcohol and substance-use treatment https://adminrules.idaho.gov/rules/2012/16/0717.pdf https://adminrules.idaho.gov/rules/2018%20Archive/16/160717.pdf. Current provider participation must be evaluated against contemporary Department of Health and Welfare standards, Medicaid requirements, Magellan network provisions, professional scopes of practice, and any applicable facility or program approval requirements https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers.

The Idaho Board of Pharmacy and Division of Occupational and Professional Licenses regulate pharmacies, pharmacists, controlled-substance handling, and the Prescription Drug Monitoring Program. Idaho requires drug outlets dispensing controlled substances for human patients in or into the state to report specified data to the prescription-tracking program by the end of the next business day, creating a surveillance system used to identify prescribing patterns, multiple-provider episodes, potentially dangerous combinations, and diversion risks https://dopl.idaho.gov/bop/bop-facilities/. The prescription-monitoring infrastructure links addiction medicine to pharmacy operations, pain management, emergency medicine, dentistry, primary care, law enforcement, professional discipline, and insurer utilization review https://dopl.idaho.gov/bop/bop-facilities/. Idaho’s naloxone framework permits pharmacists and other authorized health professionals to prescribe and dispense naloxone to people at risk of opioid overdose and to people likely to encounter someone experiencing an overdose, while state standing-order mechanisms support distribution by eligible agencies https://prevention.odp.idaho.gov/naloxone/ https://healthandwelfare.idaho.gov/services-programs/behavioral-health/naloxone-information.

Naloxone distribution forms the principal harm-reduction and overdose-reversal infrastructure in the Treasure Valley. Idaho Department of Health and Welfare describes naloxone as a medication capable of reversing an opioid overdose and directs residents toward community access points https://healthandwelfare.idaho.gov/services-programs/behavioral-health/naloxone-information. The Office of Drug Policy’s naloxone program connects state policy to first responders, treatment organizations, community agencies, families, and individuals at elevated overdose risk https://prevention.odp.idaho.gov/naloxone/. Naloxone access depends operationally on procurement, grant funding, pharmacy stocking, standing orders, training, expiration monitoring, community distribution, emergency dispatch, and rapid transport to emergency departments, creating procurement and logistics edges that are separate from but indispensable to clinical treatment https://prevention.odp.idaho.gov/naloxone/.

Prescription-drug disposal is another upstream prevention mechanism. The Idaho Office of Drug Policy maintains information concerning permanent prescription-drug disposal locations and public resources intended to reduce diversion of unused medications https://odp.idaho.gov/wp-content/uploads/2025/05/ODP-Resource-Handout.pdf. The Drug Enforcement Administration’s National Prescription Drug Take Back Day system provides a searchable collection-site mechanism and supports periodic removal of unused medicines from homes and communities https://www.dea.gov/takebackday?utm_medium=email&utm_source=govdelivery. Disposal programs connect substance-use prevention to pharmacies, municipal police departments, sheriffs, solid-waste systems, environmental management, healthcare providers, senior services, and household safety because unused controlled medications can become a diversion source while improper disposal can create environmental or public-health risks https://www.dea.gov/takebackday?utm_medium=email&utm_source=govdelivery.

The Treasure Valley workforce includes licensed professional counselors, clinical professional counselors, clinical social workers, marriage and family therapists, psychologists, physicians, advanced-practice clinicians, nurses, pharmacists, peer-recovery coaches, case managers, behavioral-health technicians, probation officers, prevention specialists, crisis workers, emergency personnel, and program administrators. Boise State University supplies a major regional education and research pipeline through counseling, social work, behavioral-health, addiction-related instruction, the Institute for the Study of Behavioral Health and Addiction, and the Idaho RADAR Center https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/faculty/. Boise State faculty profiles document direct links among addiction studies, counseling education, refugee services, juvenile justice, crisis intervention, problematic substance use, the Idaho RADAR Center, and the Idaho Conference on Alcohol and Drug Dependency Foundation https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/faculty/. Historical Boise State research identified training needs among Idaho licensed professional counselors and clinical professional counselors treating substance-use disorders, reflecting the persistent workforce problem of ensuring that general behavioral-health practitioners possess sufficient addiction-specific competence https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/wp-content/uploads/sites/527/2013/10/EspCV102513.pdf.

The Idaho RADAR Center functions as both a research repository and a workforce-support institution by making prevention studies, needs assessments, newsletters, journals, training materials, and coalition resources accessible to practitioners and policymakers https://www.boisestate.edu/radar/newsletters-and-online-journals/. Community Coalitions of Idaho was created in 2009 to strengthen advocacy, collaboration, and cooperation among community substance-abuse-prevention coalitions, establishing a statewide civic network that supports local prevention organizations serving Treasure Valley communities https://www.boisestate.edu/radar/newsletters-and-online-journals/. The Idaho Conference on Alcohol and Drug Dependency Foundation connects education, professional development, and practitioner networks, while Boise State faculty participation creates a direct academic-to-professional association edge https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/faculty/.

Idaho’s modern prevention infrastructure developed through the interaction of federal block grants, state epidemiological planning, community coalitions, school-based prevention, prescription-opioid policy, and behavioral-health system reform. A historical Idaho Office of Drug Policy white paper described the office as the state entity leading substance-abuse policy and prevention through strategic planning and coordinated implementation https://radarcart.boisestate.edu/library/files/2017/07/ODPWhite-Paper.pdf. Idaho’s 2017 Substance Abuse Prevention Needs Assessment was produced through a multiagency State Epidemiological Outcomes Workgroup involving the Idaho Office of Drug Policy, Idaho State Police Statistical Analysis Center, Idaho Supreme Court representation, and other institutional participants, demonstrating that prevention planning was already being built as a cross-agency data function rather than a single-department program https://radarcart.boisestate.edu/library/files/2018/04/SAP_2017-Needs-Assessment_Final.pdf. The emergence of fentanyl, counterfeit pills, opioid settlements, medication-access reform, and escalating detoxification costs subsequently shifted regional attention toward overdose reversal, withdrawal-management capacity, evidence-based medication, public education, and settlement-funded infrastructure https://www.dea.gov/resources/facts-about-fentanyl https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf.

Boise State University’s Idaho Policy Institute has become a significant applied-research node by evaluating public campaigns and conducting policy scans for Idaho agencies. Its published work includes evaluation of media materials designed to increase substance-use-disorder awareness, communicate treatment options, and normalize conversations about recovery https://www.boisestate.edu/sps-ipi/may-2023/. Its Central District Health opioid-settlement scan compiles regional provider capacity, service utilization, public-health resources, stakeholder observations, and potential funding priorities https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/. This applied-research model links university expertise to public procurement because agencies use contracts, grants, and settlement funds to purchase environmental scans, evaluations, program design, and outcome measurement from academic and consulting institutions https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/.

Substance use intersects directly with housing and real estate because successful transition from detoxification or residential treatment often requires sober housing, permanent supportive housing, rental access, zoning-compatible group residences, transportation, and proximity to outpatient care. PEER Wellness Center’s emphasis on reducing isolation and supporting long-term recovery demonstrates the role of stable community integration after clinical care https://www.peerwellnesscenter.org/. The Central District Health environmental scan identifies service-navigation and continuity problems that cannot be solved solely by adding clinical appointments, because patients leaving detoxification need somewhere safe to live and a practical pathway into continuing care https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf. Real-estate availability, landlord screening, neighborhood opposition, zoning, transit access, and operating capital therefore affect treatment outcomes even when they are not formally classified as healthcare regulation.

Substance use intersects with emergency medicine because overdoses, severe intoxication, complicated withdrawal, infections, injuries, psychiatric crises, and co-occurring medical conditions are frequently encountered first in emergency departments or by emergency medical services. Naloxone can reverse opioid overdose, but reversal does not replace medical evaluation, observation, transport, withdrawal treatment, or long-term opioid-use-disorder care https://healthandwelfare.idaho.gov/services-programs/behavioral-health/naloxone-information. The regional detoxification scan documents referrals from crisis and emergency systems into withdrawal-management facilities, establishing a care-transfer edge between hospitals and community behavioral-health providers https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf. Hospital discharge planning, electronic-record interoperability, 42 CFR Part 2 consent, Medicaid authorization, ambulance availability, and treatment-bed capacity consequently determine whether an emergency encounter becomes an entry into recovery or a repeated crisis episode https://www.law.cornell.edu/cfr/text/42/part-2.

Substance use intersects with criminal justice through DUI evaluation, drug courts, probation conditions, incarceration, diversion, child-protection cases, and reentry. Idaho Department of Health and Welfare directs people seeking approved DUI evaluators to their county district courts, placing courts in a gatekeeping role for legally mandated assessment https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/driving-under-influence-evaluators. Historical Idaho administrative rules specifically addressed substance-use treatment programs seeking approval to serve drug-court participants https://adminrules.idaho.gov/rules/2014/16/0720.pdf. Canyon County’s probation structure links court supervision to DUI Court, veterans court, community service, accountability, and rehabilitative opportunity https://www.canyoncounty.id.gov/elected-officials/commissioners/misdemeanor-probation/. These connections create recurring data-governance conflicts because courts and probation agencies may require compliance information while treatment programs remain bound by federal substance-use-record confidentiality restrictions https://www.law.cornell.edu/cfr/text/42/part-2.

Substance use intersects with employment and economic development through workforce shortages, absenteeism, disability, criminal records, occupational licensing, insurance coverage, and the availability of recovery-supportive employers. Treatment providers compete for clinicians, nurses, peer workers, technicians, and prescribers with hospitals, schools, correctional systems, private practices, and other behavioral-health organizations. National labor research has found a long-term shift in substance-use-treatment hiring away from hospital-centered positions toward outpatient settings and toward counselors and social workers, a pattern consistent with the Treasure Valley’s broad outpatient and community-provider market https://arxiv.org/abs/1908.00216. Boise State’s counseling, social-work, addiction-study, and applied-research infrastructure is therefore not peripheral; it is a labor-supply mechanism for a regional sector whose service capacity is constrained by qualified personnel as much as by buildings or reimbursement https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/faculty/.

Substance use intersects with schools, colleges, and youth systems through prevention curricula, student health, juvenile justice, family intervention, and early identification. The Idaho Office of Drug Policy maintains an Idaho College Health Coalition as part of its statewide prevention architecture https://odp.idaho.gov/idaho-college-health-coalition/. Boise State research and historical faculty work have addressed evidence-based school prevention, high-school drinking interventions, counselor training, juvenile justice, and problematic substance use https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/wp-content/uploads/sites/527/2013/10/EspCV102513.pdf. Prevention Idaho’s grants and training resources supply a formal funding and educational pathway through which schools, nonprofits, coalitions, and local agencies can implement primary-prevention programming https://prevention.odp.idaho.gov/odp-grant-opportunities/ https://prevention.odp.idaho.gov/training/.

Substance use intersects with family welfare, domestic violence, homelessness, and mental health because many clients present with overlapping trauma, psychiatric disorders, unstable relationships, legal problems, and economic insecurity. Idaho’s behavioral-health system explicitly integrates mental-health and substance-use services within the same departmental and managed-care architecture https://healthandwelfare.idaho.gov/services-programs/behavioral-health https://healthandwelfare.idaho.gov/providers/managed-care-providers/behavioral-health. Providers such as Northpoint Recovery, Recovery Ways Idaho, Trivium Life Services, and Icarus Wellness and Recovery advertise treatment of addiction alongside mental-health or co-occurring conditions, reflecting the market’s movement toward dual-diagnosis care https://www.northpointrecovery.com/ https://recoverywaysidaho.com/ https://www.triviumlifeservices.org/locations/id/boise/7/ https://icarusbehavioralhealthidaho.com/. The practical consequence is that a complete regional knowledge graph must distinguish substance-specific treatment, general mental-health treatment, co-occurring-disorder care, crisis stabilization, peer recovery, housing support, and medical withdrawal management rather than merging them into one undifferentiated behavioral-health category.

Substance-use infrastructure in the Treasure Valley is financially dependent on Medicaid reimbursement, commercial insurance, federal block grants, county budgets, opioid-settlement proceeds, state appropriations, charitable support, and client payments. The Idaho Behavioral Health Plan is the dominant public payer and network mechanism for eligible residents https://healthandwelfare.idaho.gov/providers/managed-care-providers/behavioral-health. Prevention Idaho administers grant opportunities connected to the federal Substance Use Prevention, Treatment, and Recovery Services Block Grant https://prevention.odp.idaho.gov/odp-grant-opportunities/. Ada County has recorded opioid-settlement funds in its financial statements, while Central District Health commissioned a formal environmental scan to guide potential settlement spending https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2025/04/ACFR-2024-Online.pdf https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/. Treatment availability therefore depends not only on clinical demand but on reimbursement rates, network contracts, settlement-allocation decisions, grant cycles, uncompensated-care capacity, and the financial viability of facilities serving uninsured patients.

The region’s most consequential infrastructure gaps are visible at transition points: overdose reversal to emergency care, emergency care to detoxification, detoxification to residential or outpatient treatment, incarceration to community care, treatment discharge to housing, and short-term treatment to sustained peer recovery. The Central District Health scan demonstrates the scarcity and rising expense of detoxification capacity https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf. PEER Wellness Center demonstrates the need for free, persistent, community-based support after formal treatment https://www.peerwellnesscenter.org/. Magellan’s local-resource system and Idaho’s 211 service demonstrate the continuing need for navigation across fragmented eligibility, payer, provider, and social-service systems https://magellanofidaho.com/w/local-mh-su-rr-resources https://healthandwelfare.idaho.gov/services-programs/health-behavioral-health-and-substance-use-disorder. A resilient Treasure Valley recovery system therefore requires simultaneous investment in clinical capacity, medication access, peer support, privacy-compliant data exchange, transportation, housing, trained personnel, prevention, and accountable public financing.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health — Idaho Department of Health and Welfare overview of the state behavioral-health authority and its adult, youth, crisis, mental-health, and substance-use functions.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-substance-use-disorder — State definition and explanation of substance-use disorder, its effects, treatability, and recovery.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/get-help-0 — Idaho treatment and recovery entry-point information for people seeking substance-use assistance.

https://healthandwelfare.idaho.gov/services-programs/health-behavioral-health-and-substance-use-disorder — Idaho Department of Health and Welfare portal connecting residents with healthcare, behavioral-health, substance-use, and 211 resources.

https://healthandwelfare.idaho.gov/providers/managed-care-providers/behavioral-health — Official description of the Idaho Behavioral Health Plan and Magellan-managed behavioral-health services.

https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers — State provider portal for substance-use programs, standards, participation information, and reimbursement materials.

https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/recovery-coaching — Idaho Department of Health and Welfare definition and institutional support for recovery coaching.

https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/driving-under-influence-evaluators — Official state guidance for locating DUI evaluation providers through county district courts.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/naloxone-information — Idaho Department of Health and Welfare information concerning naloxone, overdose reversal, and community access.

https://magellanofidaho.com/w/local-mh-su-rr-resources — Magellan of Idaho directory for local mental-health, substance-use, and recovery resources.

https://odp.idaho.gov/ — Official Idaho Office of Drug Policy portal describing statewide drug-policy and prevention responsibilities.

https://odp.idaho.gov/wp-content/uploads/2025/05/ODP-Resource-Handout.pdf — Idaho Office of Drug Policy resource document covering prevention, disposal, data, and policy programs.

https://odp.idaho.gov/seow-data-dashboard/ — Idaho State Epidemiological Outcomes Workgroup data-dashboard portal.

https://odp.idaho.gov/idaho-college-health-coalition/ — Idaho Office of Drug Policy page for the Idaho College Health Coalition.

https://prevention.odp.idaho.gov/ — Prevention Idaho portal for substance-misuse prevention resources, providers, grants, and opportunities.

https://prevention.odp.idaho.gov/odp-grant-opportunities/ — Idaho prevention grant information, including the Substance Use Prevention, Treatment, and Recovery Services Block Grant.

https://prevention.odp.idaho.gov/training/ — Idaho Office of Drug Policy prevention-training resources.

https://prevention.odp.idaho.gov/naloxone/ — Idaho naloxone law, standing-order, agency-distribution, and access information.

https://prevention.odp.idaho.gov/resource-library/ — Idaho prevention resource library containing public-education and prescription-opioid-misuse materials.

https://www.boisestate.edu/sps-ipi/our-research/central-district-health-opioid-settlement-fund-environmental-scan/ — Boise State Idaho Policy Institute summary of the Central District Health opioid-settlement environmental scan.

https://www.boisestate.edu/sps-ipi/wp-content/uploads/sites/125/2025/07/Opioid-Environmental-Scan.pdf — Full regional opioid environmental scan documenting detoxification capacity, service utilization, costs, providers, and system gaps.

https://www.boisestate.edu/sps-ipi/may-2023/ — Boise State Idaho Policy Institute work evaluating substance-use-disorder awareness and recovery media materials.

https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/faculty/ — Boise State faculty and institutional profiles connecting addiction studies, counseling, RADAR, crisis work, and professional organizations.

https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/wp-content/uploads/sites/527/2013/10/EspCV102513.pdf — Boise State academic record documenting Idaho counselor-training research, prevention education, and addiction-related scholarship.

https://www.boisestate.edu/radar/newsletters-and-online-journals/ — Idaho RADAR Center collection of prevention newsletters, journals, and Community Coalitions of Idaho information.

https://radarcart.boisestate.edu/library/files/2017/07/ODPWhite-Paper.pdf — Historical Idaho Office of Drug Policy white paper describing the development of statewide prevention strategy.

https://radarcart.boisestate.edu/library/files/2018/04/SAP_2017-Needs-Assessment_Final.pdf — Idaho Substance Abuse Prevention Needs Assessment produced through the State Epidemiological Outcomes Workgroup.

https://www.canyoncounty.id.gov/wp-content/uploads/2025/05/SWDH_Impact-Report_FY24_FINAL.pdf — Southwest District Health impact report describing its regional public-health mission and programs.

https://www.canyoncounty.id.gov/elected-officials/commissioners/misdemeanor-probation/ — Canyon County misdemeanor-probation portal linking supervision with DUI Court, veterans court, community service, and rehabilitative programming.

https://www.canyoncounty.id.gov/wp-content/uploads/2024/10/Canyon-County-Fiscal-Year-2025-Board-of-County-Commissioners-Budget-Book.pdf — Canyon County fiscal-year 2025 budget documenting county programs and institutional expenditures.

https://www.canyoncounty.id.gov/wp-content/uploads/2025/04/ACFR-FY2024-Final.pdf — Canyon County annual comprehensive financial report for fiscal year 2024.

https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2019/08/FY-20-Budget-Book-Digital-Version.pdf — Ada County budget document identifying screenings, assessments, treatment, counseling, and court-related services.

https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2025/04/ACFR-2024-Online.pdf — Ada County annual financial report recording opioid-settlement revenue and county finances.

https://www.peerwellnesscenter.org/ — PEER Wellness Center’s official description of free peer-based recovery-support services and long-term recovery mission.

https://www.northpointrecovery.com/ — Northpoint Recovery’s official site describing inpatient addiction and behavioral-health treatment.

https://www.bhgrecovery.com/locations/boise-id/ — Behavioral Health Group’s Boise opioid-treatment location and medication services.

https://idahorecoverycenter.com/ — Eagle Creek Ranch Recovery’s official Nampa treatment-facility site.

https://recoverywaysidaho.com/ — Recovery Ways Idaho’s official outpatient mental-health and addiction-treatment site.

https://www.triviumlifeservices.org/locations/id/boise/7/ — Trivium Life Services’ Boise behavioral-health and support-services location.

https://www.zelusrecovery.com/boise-substance-abuse-programs/ — Zelus Recovery’s Boise and Treasure Valley substance-use-program page.

https://icarusbehavioralhealthidaho.com/ — Icarus Wellness and Recovery’s Idaho addiction, mental-health, Medicaid, and insurance information.

https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8 — SAMHSA’s official explanation of federal opioid-treatment-program regulations.

https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8/changes — SAMHSA table describing changes made by the revised opioid-treatment-program rule.

https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/42-cfr-part-8/faqs — SAMHSA frequently asked questions concerning implementation of the revised federal rule.

https://www.samhsa.gov/substance-use/treatment/opioid-treatment-program/become-otp — SAMHSA explanation of opioid-treatment-program certification and multilateral oversight.

https://www.samhsa.gov/substance-use/treatment/statutes-regulations-guidelines — SAMHSA collection of statutes, regulations, and federal guidance governing substance-use treatment.

https://www.dea.gov/drug-information/csa — Drug Enforcement Administration overview of the federal Controlled Substances Act.

https://www.dea.gov/drug-information/drug-scheduling — DEA explanation of controlled-substance schedules and scheduling criteria.

https://www.dea.gov/press-releases/2022/03/23/deas-commitment-expanding-access-medication-assisted-treatment — DEA statement concerning medication-assisted treatment, recovery, and overdose prevention.

https://www.dea.gov/press-releases/2021/06/28/dea-finalizes-measures-expand-medication-assisted-treatment — DEA action expanding medication-treatment access, particularly in underserved areas.

https://www.dea.gov/resources/facts-about-fentanyl — DEA information concerning fentanyl, counterfeit pills, potency, and overdose risk.

https://www.dea.gov/takebackday?utm_medium=email&utm_source=govdelivery — DEA National Prescription Drug Take Back Day collection-site and disposal portal.

https://www.law.cornell.edu/uscode/text/42/290dd-2 — Text of the federal statute protecting substance-use-disorder patient records.

https://www.law.cornell.edu/cfr/text/42/part-2 — Complete regulatory text of 42 CFR Part 2 governing confidentiality of substance-use-disorder records.

https://www.law.cornell.edu/cfr/text/42/2.2 — Regulation describing the purpose and legal effect of Part 2 confidentiality protections.

https://www.law.cornell.edu/cfr/text/42/2.12 — Regulation defining the applicability of Part 2 restrictions.

https://www.law.cornell.edu/cfr/text/42/part-2/subpart-D — Federal provisions governing specified disclosures without patient consent.

https://www.law.cornell.edu/cfr/text/42/part-2/subpart-E — Federal provisions governing court orders authorizing disclosure of protected substance-use records.

https://adminrules.idaho.gov/rules/2014/16/0720.pdf — Archived IDAPA standards for alcohol and substance-use-disorder treatment programs, including drug-court providers.

https://adminrules.idaho.gov/rules/2012/16/0717.pdf — Archived Idaho administrative rules governing publicly funded alcohol and substance-use treatment services.

https://adminrules.idaho.gov/rules/2018%20Archive/16/160717.pdf — Later archived version of Idaho treatment-service administrative rules and definitions.

https://dopl.idaho.gov/bop/bop-facilities/ — Idaho Board of Pharmacy information concerning controlled-substance reporting and the Prescription Drug Monitoring Program.

https://arxiv.org/abs/1908.00216 — Research examining hiring trends and occupational shifts in the substance-use-treatment workforce.

Idaho’s statutory foundation assigns the Department of Health and Welfare responsibility for establishing a comprehensive and coordinated program for the treatment of people affected by alcoholism, intoxication, and drug addiction, authorizes cooperation with public and private agencies, and makes state coordination a legal duty rather than an optional policy preference https://law.justia.com/codes/idaho/title-39/chapter-3/section-39-304/. Title 39, Chapter 3 separately addresses eligibility screening, clinical assessment, provider selection, residential treatment, voluntary treatment, protective custody, patient payment, and limits on the use of criminal law, creating the legal architecture beneath publicly financed substance-use services https://law.justia.com/codes/idaho/title-39/chapter-3/. Idaho Code § 39-307 permits an individual affected by alcoholism or drug addiction to apply directly to an approved public treatment facility for voluntary treatment and provides a representative application pathway for minors or legally incompetent people https://codes.findlaw.com/id/title-39-health-and-safety/id-st-sect-39-307/. These provisions imply that provider approval, public eligibility administration, and individual consent are separate legal nodes: an organization may offer recovery-related assistance without necessarily being an approved public treatment facility, while admission into publicly administered treatment remains governed by statutory screening and program rules https://law.justia.com/codes/idaho/title-39/chapter-3/ https://codes.findlaw.com/id/title-39-health-and-safety/id-st-sect-39-307/.

Idaho’s overdose Good Samaritan law protects a person who, acting in good faith, seeks medical assistance during a drug-related emergency from specified possession, under-the-influence, and paraphernalia prosecutions when the evidence was obtained because assistance was requested https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/. The statute also extends relevant protection to the person experiencing the overdose, reducing the legal deterrent to calling 911 at the exact point where emergency medicine and criminal enforcement intersect https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/. An independent legal analysis of Idaho harm-reduction law reports that Idaho enacted naloxone-access legislation in 2015, expanded it in 2019, and permits broad dispensing by licensed or registered health professionals, while separately analyzing syringe access and Good Samaritan protection https://www.networkforphl.org/wp-content/uploads/2020/09/Idaho-Harm-Reduction-Laws_FINAL.pdf. The direct implication is that Treasure Valley overdose response depends upon both sides of the legal graph: immunity reduces fear of police consequences, while naloxone authority expands the number of pharmacists, agencies, first responders, peers, and family members capable of intervening before an ambulance arrives https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/ https://www.networkforphl.org/wp-content/uploads/2020/09/Idaho-Harm-Reduction-Laws_FINAL.pdf.

Idaho’s consent rules create a distinct youth-treatment pathway. IDAPA 16.05.01.250 provides that an individual at least sixteen years old may consent to substance-abuse treatment and restricts disclosure to a parent or guardian unless the individual authorizes it, subject to Idaho Code and federal substance-use-record protections https://www.law.cornell.edu/regulations/idaho/IDAPA-16.05.01.250. The rule means that Treasure Valley adolescent treatment is not legally reducible to parental consent: schools, pediatric clinicians, juvenile-justice personnel, counselors, and treatment providers must distinguish the minor’s independent treatment consent and confidentiality rights from ordinary parental access to healthcare information https://www.law.cornell.edu/regulations/idaho/IDAPA-16.05.01.250. This rule also creates a technical requirement for electronic health records and release-of-information workflows because systems that automatically expose adolescent treatment records through family portals may conflict with the minor-specific confidentiality structure https://www.law.cornell.edu/regulations/idaho/IDAPA-16.05.01.250.

Idaho’s historical behavioral-health program standards required each substance-use-service location to employ at least one qualified substance-use-disorders professional and required sufficient multidisciplinary staffing for the treatments offered https://www.law.cornell.edu/regulations/idaho/IDAPA-16.07.17.200. The rule recognized multiple qualifying professional pathways rather than treating addiction treatment as the exclusive domain of one license, which explains why Treasure Valley programs recruit combinations of counselors, social workers, nurses, physicians, psychologists, marriage and family therapists, certified addiction professionals, and recovery-support personnel https://www.law.cornell.edu/regulations/idaho/IDAPA-16.07.17.200. Archived Idaho standards further defined safe-and-sober housing as a service directed toward practicing recovery skills, preventing relapse, improving self-care and social functioning, building recovery-supportive networks, reintegrating participants into school, employment, and family life, and preparing them for independent living https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2019%20Archive%20C1/16/160717.pdf. That definition establishes that state-funded recovery housing was conceived as a rehabilitative transition service rather than merely inexpensive lodging, creating measurable expectations around functioning, relapse prevention, and reintegration https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2019%20Archive%20C1/16/160717.pdf.

The Idaho Board of Alcohol/Drug Counselor Certification is the principal Idaho-specific credentialing body for addiction professionals, prevention specialists, and recovery-support practitioners and operates as a member board of the International Certification and Reciprocity Consortium https://www.ibadcc.org/. Certification and renewal require continuing education and adherence to professional ethical standards, making IBADCC a labor-market gatekeeper even though it is distinct from Idaho’s state occupational-licensing boards https://www.ibadcc.org/. Idaho administrative definitions identify IBADCC as the entity overseeing addiction-studies and alcohol-and-drug-counselor credentials in the state https://regulations.justia.com/states/idaho/16/16-07-17/section-16-07-17-011/. The Division of Occupational and Professional Licenses directs people seeking alcohol-and-drug certification to IBADCC, confirming the divided regulatory structure under which Idaho licenses broad counseling professions through a state board while addiction-specific credentials are administered through a specialized certification organization https://dopl.idaho.gov/cou/general-information-of-interest/. This split matters to employers because a licensed counselor may still require addiction-specific education, supervision, or certification to satisfy a program contract or staffing standard, while an addiction credential alone does not necessarily authorize the independent practice reserved to a state-licensed clinical profession https://dopl.idaho.gov/cou/general-information-of-interest/ https://www.ibadcc.org/.

The Idaho Board of Professional Counselors and Marriage and Family Therapists regulates professional counselor and marriage-and-family-therapy practice, requiring applicants to submit qualifying graduate transcripts, examination results, and other evidence of professional preparation https://dopl.idaho.gov/cou/. Idaho Code § 54-3404 grants the board authority to regulate professional counselors, clinical professional counselors, associate marriage and family therapists, and marriage and family therapists and to establish specialty and technology-mediated practice standards https://law.justia.com/codes/idaho/title-54/chapter-34/section-54-3404/. Archived IDAPA 24.15.01 rules distinguish clinical professional counselor licensure from entry-level professional counselor licensure and require examination and supervised experience for the clinical credential https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2023%20Archive/24/241501.pdf. Telehealth expansion therefore does not erase state licensure boundaries: a Treasure Valley provider delivering addiction counseling by video remains constrained by the practitioner’s license, supervision status, credential, patient location, and professional-board rules governing communication technology https://law.justia.com/codes/idaho/title-54/chapter-34/section-54-3404/ https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2023%20Archive/24/241501.pdf.

Boise State University’s undergraduate Addiction Studies Certificate began admitting students in fall 2023 after approval by the Idaho State Board of Education in March 2023, marking a recent formal expansion of the Treasure Valley’s addiction-workforce pipeline https://www.boisestate.edu/news/2023/06/21/new-addiction-studies-certificate-to-start-in-fall-2023/. The certificate requires nine credits consisting of Introduction to Drugs and Society, Motivational Interviewing, and Assessment and Case Management of Behavioral Health Disorders https://www.boisestate.edu/socialwork/undergraduate-bsw/addiction-studies/. Its compact structure makes addiction-specific training accessible to students pursuing social work and related degrees without requiring a separate full degree, thereby broadening the number of future practitioners who enter child welfare, corrections, healthcare, schools, housing programs, and nonprofit services with baseline addiction competence https://www.boisestate.edu/socialwork/undergraduate-bsw/addiction-studies/ https://www.boisestate.edu/news/2023/06/21/new-addiction-studies-certificate-to-start-in-fall-2023/.

Boise State’s Department of Counselor Education operates a sixty-credit Master of Arts in Counseling with an Addiction Counseling cognate and a doctoral program in Counselor Education and Supervision https://www.boisestate.edu/healthsciences-counselored/. The addiction-counseling graduate pathway includes a minimum 100-hour practicum and 700-hour internship in a clinical setting and is aligned with the Council for Accreditation of Counseling and Related Educational Programs’ core areas https://www.boisestate.edu/provost-licensure/master-of-arts-in-counseling-addiction-counseling-cognate/. The degree therefore supplies both direct-service clinicians and future supervisors, faculty members, and program leaders, addressing two different workforce bottlenecks: insufficient frontline counselors and insufficient qualified personnel capable of supervising licensure candidates or expanding accredited educational capacity https://www.boisestate.edu/healthsciences-counselored/ https://www.boisestate.edu/provost-licensure/master-of-arts-in-counseling-addiction-counseling-cognate/. Boise State’s Institute for the Study of Behavioral Health and Addiction supplies complementary professional development, information dissemination, research, program evaluation, and community and legislative engagement for prevention and treatment organizations https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/. The combined academic graph therefore runs from undergraduate exposure to graduate clinical formation, doctoral leadership, continuing education, evaluation, and policy translation within one Treasure Valley institution https://www.boisestate.edu/socialwork/undergraduate-bsw/addiction-studies/ https://www.boisestate.edu/healthsciences-counselored/ https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/.

Idaho State University provides a twenty-five-credit Addiction Studies Academic Certificate whose curriculum, combined with 300 internship hours, can qualify a student for the Substance Use Disorders Associate credential through IBADCC; completion alongside a bachelor’s degree can support eligibility for the Alcohol and Drug Counselor credential https://www.isu.edu/publichealth/addiction/. Although Idaho State University’s main campus lies outside the Treasure Valley, its program feeds a statewide labor market and can supply interns and credential candidates to Boise, Meridian, Nampa, and Caldwell providers https://www.isu.edu/publichealth/addiction/. The contrast between Boise State’s nine-credit interdisciplinary certificate and Idaho State University’s twenty-five-credit credential-oriented certificate reveals two separate workforce strategies: diffusion of addiction competence across general helping professions and production of workers specifically progressing toward addiction certification https://www.boisestate.edu/socialwork/undergraduate-bsw/addiction-studies/ https://www.isu.edu/publichealth/addiction/.

Port of Hope represents a historically important Idaho-origin treatment operator with continuing Boise and Nampa presence. The organization began in Twin Falls in 1971 as a sober-living home and expanded into alcohol- and substance-use treatment, while a later Coeur d’Alene location closed in 2020 and Boise and Nampa locations remained identified as active https://rehabs.org/port-of-hope/. This history demonstrates a pathway distinct from venture-backed expansion: an Idaho sober residence evolved over decades into a multi-location treatment organization, connecting the modern Treasure Valley provider market to the state’s earlier community-based recovery infrastructure https://rehabs.org/port-of-hope/. Treasure Valley Recovery in Nampa is separately described as a private organization offering inpatient and outpatient services to adults and young adults, with modalities including cognitive behavioral therapy, contingency management, brief intervention, and community reinforcement https://recovered.org/rehabs/treasure-valley-recovery-nampa-id. These smaller operators increase modality and referral diversity but also make provider comparison difficult because level-of-care terminology, accreditation, payer participation, staffing, and service intensity vary across organizations https://recovered.org/rehabs/treasure-valley-recovery-nampa-id https://rehabs.org/port-of-hope/.

Phoenix House Boise occupies the family-oriented sober-living niche, advertising structured, substance-free housing for men and women and describing resident accountability, household support, affordability, family reunification, and limited accommodation of children https://boisesoberliving.com/. A consumer-facing facility profile describes Phoenix House as providing a therapeutic-community environment, resident lockboxes, internet, laundry supplies, bedding, computer access, and limited overnight stays for children https://recovery.com/phoenix-house-boise-idaho/. The operator’s family accommodation creates a direct edge to child welfare, family courts, parenting plans, and employment because parents rebuilding custody or visitation need housing rules that permit safe contact with children while maintaining sobriety and household accountability https://boisesoberliving.com/ https://recovery.com/phoenix-house-boise-idaho/. Phoenix House’s appearance on both its own operator site and a commercial recovery marketplace also shows how reputation is mediated twice: first through provider-controlled claims and resident testimonials, then through an aggregator’s standardized amenities and service description https://boisesoberliving.com/ https://recovery.com/phoenix-house-boise-idaho/.

Rising Sun Sober Living operates gender-specific recovery residences in Boise, Nampa, and Caldwell as part of a broader Idaho network and reports more than 500 beds developed since 2008 https://www.risingsunsoberliving.com/. Its scale positions it differently from a single-house operator because centralized admissions, standardized rules, bed availability, and multi-city placement can influence discharge planning across hospitals, jails, residential programs, and outpatient providers https://www.risingsunsoberliving.com/. Recovery Idaho’s housing resource identifies Oxford House as a democratically governed, self-supporting, drug-free housing model, with homes for men, women, and women with children and typical occupancy of six to fifteen residents https://www.recoveryidaho.org/recovery-housing/. The Oxford model and Rising Sun model produce different governance edges: Oxford Houses rely on resident democracy and house self-support, while a scaled operator can centralize ownership or management across many properties https://www.recoveryidaho.org/recovery-housing/ https://www.risingsunsoberliving.com/. A statewide sober-house directory warns that Idaho oversight may depend on whether a residence participates in state behavioral-health safe-and-sober services rather than on a universal certification regime, making contract status and service designation material facts for consumers https://soberhousedirectory.com/homes/idaho/.

Idaho’s recovery-housing market remains structurally fragmented because no single source establishes that every sober residence is licensed, certified, clinically staffed, or subject to identical standards. Recovery.com describes sober living as substance-free transitional housing based on structure, accountability, and peer support and states that it connects consumers directly to providers without profiting from referrals https://recovery.com/idaho/sober-living/. Sober House Directory separately markets a statewide search interface while advising users to investigate program structure, supports, and certification conditions https://soberhousedirectory.com/homes/idaho/. Consumer discovery therefore shifts part of the due-diligence burden onto residents and families, who must verify house rules, testing policies, eviction procedures, medication policies, staffing, transportation, fees, refund terms, child access, and whether the residence supplies treatment or only housing https://recovery.com/idaho/sober-living/ https://soberhousedirectory.com/homes/idaho/. The absence of a uniform consumer-facing classification can cause a peer-run house, staffed recovery residence, transitional program, and treatment-linked residence to appear equivalent in search results even when their legal duties and service intensity differ substantially https://soberhousedirectory.com/homes/idaho/.

Behavioral Health Group’s Boise presence belongs to a national private-equity-backed opioid-treatment platform rather than an independent local clinic. Frontenac reports that it sold Behavioral Health Group to The Vistria Group in December 2018 after BHG had grown to more than fifty treatment centers in twelve states https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/ https://frontenac.com/portfolio/behavioral-health-group/. BHG states that it was founded in April 2006 and expanded to twenty-three centers across seven states during its first six years https://www.bhgrecovery.com/about-bhg/. Under Vistria ownership, BHG announced an agreement to acquire Center for Behavioral Health, describing BHG as the country’s largest network of Joint Commission-accredited outpatient opioid-treatment and recovery centers https://vistria.com/behavioral-health-group-acquires-center-for-behavioral-health/. BHG’s own acquisition record shows continued roll-up activity, including the 2022 acquisition of Center for Behavioral Health and two South Carolina treatment programs https://www.bhgrecovery.com/bhg-acquires-center-for-behavioral-health/ https://www.bhgrecovery.com/south-carolina-expansion/. The local implication is that Boise’s methadone and medication-treatment capacity is partly governed by national capital allocation, acquisition strategy, centralized compliance, and enterprise reimbursement systems rather than exclusively by locally owned clinical organizations https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/ https://vistria.com/behavioral-health-group-acquires-center-for-behavioral-health/.

Private-equity consolidation can increase the capital available for accreditation, compliance, information systems, recruiting, new clinics, and acquisition of smaller operators, while also transferring strategic control and economic returns outside the Treasure Valley. National research identifying behavioral-health acquisitions found that facility transactions increased materially over time and that private-equity-backed acquisitions became an increasingly visible component of the sector https://pmc.ncbi.nlm.nih.gov/articles/PMC11235319/. BHG’s documented expansion from twenty-three centers to more than fifty and its subsequent acquisition of Center for Behavioral Health exemplify the platform-and-add-on pattern described in the acquisition literature https://www.bhgrecovery.com/about-bhg/ https://frontenac.com/portfolio/behavioral-health-group/ https://pmc.ncbi.nlm.nih.gov/articles/PMC11235319/. Consolidation can narrow local ownership diversity even while increasing the nominal number of branded sites, so a provider-count graph must distinguish facilities, brands, operating companies, and ultimate financial sponsors rather than counting each address as an independent market participant https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/ https://pmc.ncbi.nlm.nih.gov/articles/PMC11235319/.

Northpoint operates through a multi-state holding-company structure whose portfolio includes adult, adolescent, addiction, and mental-health programs rather than a single Boise residential facility https://www.northpointholdings.com/. A 2019 corporate announcement stated that Northpoint operated inpatient and outpatient facilities in Idaho and Washington and appointed behavioral-health executive John Flanagan as chief executive officer https://www.prnewswire.com/news-releases/northpoint-recovery-announces-john-flanagan-as-ceo-300815133.html. The holding-company structure centralizes branding, executive management, program replication, marketing, admissions, and expansion across states https://www.northpointholdings.com/ https://www.prnewswire.com/news-releases/northpoint-recovery-announces-john-flanagan-as-ceo-300815133.html. Publicly accessible sources reviewed here establish Northpoint’s corporate platform and expansion structure but do not conclusively disclose a current controlling private-equity sponsor, so ownership beyond the holding company should not be inferred from the availability of an investor-profile page or from general behavioral-health consolidation trends https://www.northpointholdings.com/.

Treatment courts are a major demand-routing institution for Treasure Valley providers because Idaho operates treatment courts in every judicial district and combines evidence-based treatment, frequent judicial supervision, drug testing, counseling, and recovery services https://isc.idaho.gov/about-the-courts/treatment-courts. The Idaho Supreme Court states that treatment courts reduce rearrest, improve treatment outcomes, reunify families, and lower public costs https://isc.idaho.gov/about-the-courts/treatment-courts. This model creates a recurring procurement and data edge: courts need qualified treatment capacity and reliable compliance reporting, while providers need referral volume, payment arrangements, legally valid releases, and clarity about what clinical information may be disclosed to judges, prosecutors, defense counsel, probation officers, and court teams https://isc.idaho.gov/about-the-courts/treatment-courts. Treatment-court expansion can therefore increase demand without automatically increasing provider supply, making workforce shortages and outpatient capacity constraints part of court-system performance rather than merely healthcare-sector problems https://isc.idaho.gov/about-the-courts/treatment-courts.

Boise’s housing policy directly affects recovery capacity because the city’s 2021–2025 consolidated plan identifies affordable housing, homelessness prevention, rapid rehousing, supportive services, and coordination among housing, health, mental-health, and service providers as municipal priorities https://www.cityofboise.org/media/13431/2021-2025-hud-consolidated-plan-final-211021.pdf. Boise administers Community Development Block Grant and HOME funds through its Housing and Community Development Division and coordinates some affordable units with local service organizations https://www.cityofboise.org/media/13431/2021-2025-hud-consolidated-plan-final-211021.pdf. Recovery providers originating on the healthcare side therefore depend on municipal housing actions on the receiving side: a patient can complete detoxification or outpatient treatment yet remain clinically unstable when affordable, sober, or supportive housing is unavailable https://www.cityofboise.org/media/13431/2021-2025-hud-consolidated-plan-final-211021.pdf https://www.recoveryidaho.org/recovery-housing/. Boise’s Shelter Better Task Force further concluded that municipal zoning directly affects current and future shelter siting and recommended examination of how code provisions enable or obstruct emergency-shelter homes https://www.cityofboise.org/media/13257/shelterbettertaskforce_report.pdf. The same land-use mechanisms affect recovery residences and transitional facilities because location, occupancy classification, parking, neighborhood process, and permitted-use categories determine whether social-service housing can open where treatment and transportation are accessible https://www.cityofboise.org/media/13257/shelterbettertaskforce_report.pdf.

Meridian’s housing and community-development system creates a parallel cross-sector edge. Its 2022–2026 consolidated plan assigns funding and goals to homelessness, non-homeless special-needs populations, public services, affordable housing, infrastructure, and economic opportunity https://meridiancity.org/media/z4zj2wuv/con-plan-approved.pdf. Meridian’s 2024 action plan identifies Our Path Home as the Boise City/Ada County Continuum of Care and describes ongoing consultation concerning homelessness, prevention, fair housing, and community needs https://meridiancity.org/media/ok1hnlht/py24-action-plan-final.pdf. Meridian’s Unified Development Code controls allowed uses and operational requirements by zoning district, while the comprehensive plan guides future land-use intensity and rezoning decisions https://meridiancity.org/community-development/planning/comprehensive-plan/evolving/. A recovery residence or outpatient clinic is therefore shaped by two separate municipal systems: housing and public-service funding may support the population it serves, while zoning determines where the facility or residence can legally operate https://meridiancity.org/media/z4zj2wuv/con-plan-approved.pdf https://meridiancity.org/community-development/planning/comprehensive-plan/evolving/.

The Treasure Valley’s emergency-care and recovery systems meet physically at hospital emergency departments. St. Luke’s Meridian Medical Center operates an emergency department within a major regional hospital and supplies inpatient and outpatient medical services https://stlukesonline.org/en/get-care/locations/medical-centers/st-lukes-meridian-medical-center/. Idaho’s Good Samaritan protection encourages overdose witnesses to activate that emergency pathway, but the statute does not itself create detoxification beds, outpatient medication access, transportation, or post-discharge housing https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/. The originating emergency-medical node and receiving recovery node therefore require an operational bridge consisting of screening, stabilization, peer contact, discharge planning, medication initiation or referral, information-sharing authorization, and a confirmed destination rather than a generic list of telephone numbers https://stlukesonline.org/en/get-care/locations/medical-centers/st-lukes-meridian-medical-center/ https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/.

Construction-trade employers and organized labor constitute an underrecognized recovery-support channel because workplace injury, prescription exposure, job instability, disciplinary action, and insurance benefits can affect treatment entry and retention. Plumbers and Pipefitters Local 296 publishes Treasure Valley peer-wellness resources that include inpatient and outpatient behavioral-health providers, Southwest District Health contacts, suicide-prevention programming, and opioid-settlement activity https://www.ualocal296.org/?HomeID=919962&page=PEER20WELLNESS&zone=%2Funionactive%2Fview_article.cfm. The union-side source shows that substance-use and mental-health navigation is entering workforce institutions outside the healthcare sector, while the receiving-side providers supply the clinical and recovery capacity to which members are directed https://www.ualocal296.org/?HomeID=919962&page=PEER20WELLNESS&zone=%2Funionactive%2Fview_article.cfm. Employers and unions can therefore become early-identification, insurance-navigation, leave-management, and return-to-work nodes, but only when confidentiality and employment consequences are clearly separated from clinical disclosure.

Consumer-facing discovery is dominated by platforms whose business models and classification methods differ. Psychology Today’s Boise intensive-outpatient directory displays treatment programs by location and service category and permits facilities to describe niches such as faith-based care, mental-health integration, and intensive outpatient programming https://www.psychologytoday.com/us/treatment-rehab/id/boise?category=intensive-outpatient-program. Addiction Center supplies a Boise-area search interface that filters inpatient, outpatient, detoxification, sober-living, intensive-outpatient, telehealth, and insurance attributes https://www.addictioncenter.com/rehabs/idaho/boise/. Recovered.org publishes facility profiles and modality descriptions, including its profile of Treasure Valley Recovery in Nampa https://recovered.org/rehabs/treasure-valley-recovery-nampa-id. Recovery.com profiles treatment and sober-living operators using amenities, service categories, and consumer-facing descriptions https://recovery.com/phoenix-house-boise-idaho/. These platforms can increase access but also shape market competition through ranking, category assignment, lead capture, paid placement, profile completeness, and search-engine visibility, meaning that discoverability is not a neutral reflection of clinical quality https://www.psychologytoday.com/us/treatment-rehab/id/boise?category=intensive-outpatient-program https://www.addictioncenter.com/rehabs/idaho/boise/ https://recovery.com/phoenix-house-boise-idaho/.

Idaho 211 operates a structured information-and-referral database through CommunityOS and supplies another discovery layer distinct from commercial rehabilitation marketplaces https://211-idaho.communityos.org/guided_search/render/ds/%7B%22service%5C%5Cservice_taxonomy%5C%5Cmodule_servicepost%22%3A%7B%22value%22%3A%5B%7B%22taxonomy_id%22%3A412589%7D%5D%2C%22operator%22%3A%5B%22contains_array%22%5D%7D%2C%22agency%5C%5Cagency_system%5C%5Cname%22%3A%7B%22value%22%3A%22VLTEST%22%2C%22operator%22%3A%5B%22notequals%22%5D%7D%7D. Unlike a treatment-marketing website, an information-and-referral database organizes agencies through service taxonomies and can connect substance-use needs to food, housing, transportation, healthcare, domestic-violence, legal, and financial-assistance programs https://211-idaho.communityos.org/guided_search/render/ds/%7B%22service%5C%5Cservice_taxonomy%5C%5Cmodule_servicepost%22%3A%7B%22value%22%3A%5B%7B%22taxonomy_id%22%3A412589%7D%5D%2C%22operator%22%3A%5B%22contains_array%22%5D%7D%2C%22agency%5C%5Cagency_system%5C%5Cname%22%3A%7B%22value%22%3A%22VLTEST%22%2C%22operator%22%3A%5B%22notequals%22%5D%7D%7D. This makes 211 a cross-domain graph router rather than merely a treatment directory, but accuracy depends upon taxonomy maintenance, agency updates, service eligibility data, and removal of closed or changed programs.

A federal review of Idaho residential behavioral-health regulation reports that substance-use-disorder residential withdrawal-management services must be available continuously twenty-four hours per day, seven days per week https://aspe.hhs.gov/sites/default/files/2021-08/StateBHCond-Idaho.pdf. Continuous operation imposes a materially different cost structure from office-based counseling because it requires round-the-clock staffing, medication and emergency protocols, food service, facilities maintenance, insurance, documentation, security, and access to medical escalation https://aspe.hhs.gov/sites/default/files/2021-08/StateBHCond-Idaho.pdf. This distinction explains why adding therapists does not automatically solve withdrawal-management scarcity: residential capacity depends on real estate, shift coverage, nursing or medical access, life-safety compliance, and sufficient reimbursement to sustain twenty-four-hour operations https://aspe.hhs.gov/sites/default/files/2021-08/StateBHCond-Idaho.pdf.

A historical Idaho legislative evaluation found that state law required Health and Welfare to establish a coordinated treatment system and examined how Idaho organized and financed substance-abuse treatment efforts https://idahodocs.contentdm.oclc.org/digital/api/collection/p16293coll3/id/80896/download. The report provides institutional context for the present division between state administration, contracted providers, courts, local governments, and private organizations https://idahodocs.contentdm.oclc.org/digital/api/collection/p16293coll3/id/80896/download. Idaho’s current fragmented market is therefore not merely the accidental result of many private providers; it reflects a longstanding policy model in which the state coordinates and purchases services rather than owning and directly operating the complete treatment continuum https://idahodocs.contentdm.oclc.org/digital/api/collection/p16293coll3/id/80896/download https://law.justia.com/codes/idaho/title-39/chapter-3/section-39-304/.

Research on behavioral-health acquisitions found that acquisition activity expanded substantially from 2010 onward and that private-equity participation became increasingly prominent in facility ownership https://pmc.ncbi.nlm.nih.gov/articles/PMC11235319/. That national evidence illuminates the Treasure Valley because BHG’s Boise opioid-treatment operation belongs to a platform sold by Frontenac to Vistria and expanded through subsequent acquisitions https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/ https://vistria.com/behavioral-health-group-acquires-center-for-behavioral-health/. The market implication is not that every Treasure Valley provider is investor-owned, but that locally presented brands coexist with capital structures ranging from peer-run nonprofit housing and Idaho-origin operators to national, sponsor-backed treatment platforms https://www.recoveryidaho.org/recovery-housing/ https://rehabs.org/port-of-hope/ https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/.

Research on rolling-admission group therapy shows that continually changing group composition creates correlated outcomes and methodological challenges when evaluating residential substance-use treatment https://arxiv.org/abs/1108.0240. This is operationally relevant to Treasure Valley intensive outpatient and residential programs because open groups are easier to keep filled and permit rapid admission, but participants repeatedly enter and leave, changing group cohesion, peer influence, and exposure to specific sessions https://arxiv.org/abs/1108.0240. Programs reporting aggregate completion or symptom outcomes without accounting for rolling group structure may therefore overstate the independence of individual results or fail to identify session-level effects https://arxiv.org/abs/1108.0240.

Research on institutionalization in substance-use-treatment outcome studies warns that incarceration, hospitalization, or other controlled settings can make drug-use and criminal-behavior outcomes unobservable or artificially constrained and can distort comparisons between residential and outpatient services https://arxiv.org/abs/0811.1831. This directly affects Treasure Valley treatment-court and justice-referred populations because a participant who remains abstinent while jailed is not analytically equivalent to a participant sustaining recovery while housed and employed in the community https://arxiv.org/abs/0811.1831 https://isc.idaho.gov/about-the-courts/treatment-courts. A regional performance system should therefore distinguish voluntary community abstinence, treatment engagement, incarceration, hospitalization, housing stability, employment, and rearrest rather than collapsing them into one success indicator https://arxiv.org/abs/0811.1831.

Computational research on substance-use prevention and recovery identifies relapse-risk detection, empowerment of social-support networks, and meaningful data exchange across formal and informal care as major technology opportunities https://arxiv.org/abs/2006.13259. These opportunities map directly onto the Treasure Valley’s fragmented provider, court, housing, hospital, peer, and directory ecosystem, but implementation is constrained by youth consent, professional licensure, substance-use-record confidentiality, commercial platform incentives, and the variable technical capacity of small operators https://arxiv.org/abs/2006.13259 https://www.law.cornell.edu/regulations/idaho/IDAPA-16.05.01.250. A regional knowledge graph can improve navigation and referral matching without becoming a clinical record system, but it must separate publicly verifiable organizational facts from protected patient-level information and must preserve ownership, credential, location, service, payer, and regulatory provenance as distinct entity types.

https://law.justia.com/codes/idaho/title-39/chapter-3/section-39-304/ — Idaho Code § 39-304 assigning the Department of Health and Welfare responsibility for a coordinated treatment program.

https://law.justia.com/codes/idaho/title-39/chapter-3/ — Idaho Code Title 39, Chapter 3 index covering treatment administration, assessment, provider selection, residential care, voluntary treatment, and related provisions.

https://codes.findlaw.com/id/title-39-health-and-safety/id-st-sect-39-307/ — Text of Idaho Code § 39-307 governing voluntary treatment applications.

https://law.justia.com/codes/idaho/title-37/chapter-27/article-iv/section-37-2739c/ — Idaho’s drug-overdose Good Samaritan protection statute.

https://www.networkforphl.org/wp-content/uploads/2020/09/Idaho-Harm-Reduction-Laws_FINAL.pdf — Independent legal analysis of Idaho naloxone, overdose-immunity, and syringe-access law.

https://www.law.cornell.edu/regulations/idaho/IDAPA-16.05.01.250 — Idaho administrative rule governing substance-use-treatment consent and confidentiality for individuals age sixteen and older.

https://www.law.cornell.edu/regulations/idaho/IDAPA-16.07.17.200 — Idaho staffing rule requiring qualified substance-use professionals and multidisciplinary program staffing.

https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2019%20Archive%20C1/16/160717.pdf — Archived Idaho behavioral-health rules defining safe-and-sober housing and related recovery services.

https://www.ibadcc.org/ — Idaho Board of Alcohol/Drug Counselor Certification credentialing and continuing-education portal.

https://regulations.justia.com/states/idaho/16/16-07-17/section-16-07-17-011/ — Idaho administrative definitions identifying IBADCC’s addiction-professional credentialing role.

https://dopl.idaho.gov/cou/general-information-of-interest/ — Idaho Division of Occupational and Professional Licenses page directing addiction-certification inquiries to IBADCC.

https://dopl.idaho.gov/cou/ — Idaho Board of Professional Counselors and Marriage and Family Therapists licensing portal.

https://law.justia.com/codes/idaho/title-54/chapter-34/section-54-3404/ — Idaho Code provision defining the counseling and marriage-and-family-therapy board’s regulatory powers.

https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/2023%20Archive/24/241501.pdf — Archived Idaho professional-counselor licensing rules covering examinations and supervised clinical experience.

https://www.boisestate.edu/news/2023/06/21/new-addiction-studies-certificate-to-start-in-fall-2023/ — Boise State announcement documenting approval and launch of its Addiction Studies Certificate.

https://www.boisestate.edu/socialwork/undergraduate-bsw/addiction-studies/ — Boise State undergraduate Addiction Studies Certificate curriculum and credit requirements.

https://www.boisestate.edu/healthsciences-counselored/ — Boise State counselor-education programs, including the Addiction Counseling cognate and doctoral program.

https://www.boisestate.edu/provost-licensure/master-of-arts-in-counseling-addiction-counseling-cognate/ — Boise State licensure disclosure describing the sixty-credit addiction-counseling degree, practicum, and internship.

https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/ — Boise State institute providing behavioral-health training, research, evaluation, and professional development.

https://www.isu.edu/publichealth/addiction/ — Idaho State University Addiction Studies Certificate and IBADCC credential pathway.

https://rehabs.org/port-of-hope/ — Historical and current-location profile of Port of Hope, including its 1971 founding and Boise and Nampa presence.

https://recovered.org/rehabs/treasure-valley-recovery-nampa-id — Consumer profile of Treasure Valley Recovery’s Nampa services and treatment modalities.

https://boisesoberliving.com/ — Phoenix House Boise operator site describing sober housing, accountability, family access, and resident experiences.

https://recovery.com/phoenix-house-boise-idaho/ — Commercial recovery-platform profile of Phoenix House Boise’s environment and amenities.

https://www.risingsunsoberliving.com/ — Rising Sun Sober Living operator site documenting its Treasure Valley locations, gender-specific housing, and reported scale.

https://www.recoveryidaho.org/recovery-housing/ — Recovery Idaho housing resource describing Oxford Houses and other recovery-housing structures.

https://soberhousedirectory.com/homes/idaho/ — Idaho sober-house search platform and explanation of variable recovery-residence oversight.

https://recovery.com/idaho/sober-living/ — Consumer-facing Idaho sober-living directory and recovery-residence description.

https://frontenac.com/frontenaccompletessaleofbehavioralhealthgroup/ — Frontenac announcement documenting the 2018 sale of Behavioral Health Group to The Vistria Group.

https://frontenac.com/portfolio/behavioral-health-group/ — Former investor profile describing BHG’s treatment model and scale at Frontenac’s exit.

https://www.bhgrecovery.com/about-bhg/ — BHG corporate history documenting its 2006 founding and early expansion.

https://vistria.com/behavioral-health-group-acquires-center-for-behavioral-health/ — Vistria announcement of BHG’s agreement to acquire Center for Behavioral Health.

https://www.bhgrecovery.com/bhg-acquires-center-for-behavioral-health/ — BHG announcement of the Center for Behavioral Health acquisition.

https://www.bhgrecovery.com/south-carolina-expansion/ — BHG announcement documenting acquisition of two South Carolina treatment programs.

https://pmc.ncbi.nlm.nih.gov/articles/PMC11235319/ — Peer-reviewed study of behavioral-health-facility acquisitions and private-equity participation.

https://www.northpointholdings.com/ — Northpoint’s holding-company site describing its multi-program behavioral-health platform.

https://www.prnewswire.com/news-releases/northpoint-recovery-announces-john-flanagan-as-ceo-300815133.html — Corporate announcement documenting Northpoint’s multi-state operations and 2019 chief-executive appointment.

https://isc.idaho.gov/about-the-courts/treatment-courts — Idaho Supreme Court description of statewide treatment-court operations and outcomes.

https://www.cityofboise.org/media/13431/2021-2025-hud-consolidated-plan-final-211021.pdf — Boise consolidated plan covering affordable housing, homelessness, supportive services, and interagency coordination.

https://www.cityofboise.org/media/13257/shelterbettertaskforce_report.pdf — Boise Shelter Better Task Force report addressing municipal zoning and shelter siting.

https://meridiancity.org/media/z4zj2wuv/con-plan-approved.pdf — Meridian consolidated plan covering housing, special-needs populations, homelessness, infrastructure, and public services.

https://meridiancity.org/media/ok1hnlht/py24-action-plan-final.pdf — Meridian action plan describing collaboration with the regional Continuum of Care.

https://meridiancity.org/community-development/planning/comprehensive-plan/evolving/ — Meridian planning page explaining the relationship between comprehensive planning and zoning requirements.

https://stlukesonline.org/en/get-care/locations/medical-centers/st-lukes-meridian-medical-center/ — St. Luke’s Meridian Medical Center page documenting emergency and hospital services.

https://www.ualocal296.org/?HomeID=919962&page=PEER20WELLNESS&zone=%2Funionactive%2Fview_article.cfm — Treasure Valley union resource connecting workers to behavioral-health, opioid, and peer-wellness programs.

https://www.psychologytoday.com/us/treatment-rehab/id/boise?category=intensive-outpatient-program — Psychology Today directory for Boise intensive-outpatient treatment providers.

https://www.addictioncenter.com/rehabs/idaho/boise/ — Commercial Boise rehabilitation search interface with level-of-care and insurance filters.

https://211-idaho.communityos.org/guided_search/render/ds/%7B%22service%5C%5Cservice_taxonomy%5C%5Cmodule_servicepost%22%3A%7B%22value%22%3A%5B%7B%22taxonomy_id%22%3A412589%7D%5D%2C%22operator%22%3A%5B%22contains_array%22%5D%7D%2C%22agency%5C%5Cagency_system%5C%5Cname%22%3A%7B%22value%22%3A%22VLTEST%22%2C%22operator%22%3A%5B%22notequals%22%5D%7D%7D — Idaho 211 CommunityOS information-and-referral database interface.

https://aspe.hhs.gov/sites/default/files/2021-08/StateBHCond-Idaho.pdf — Federal summary of Idaho residential behavioral-health and withdrawal-management requirements.

https://idahodocs.contentdm.oclc.org/digital/api/collection/p16293coll3/id/80896/download — Idaho government evaluation of the state’s substance-abuse-treatment system and statutory responsibilities.

https://arxiv.org/abs/1108.0240 — Research on statistical analysis of rolling-admission group therapy in substance-use treatment.

https://arxiv.org/abs/0811.1831 — Research on institutionalization bias in evaluations of residential and outpatient substance-use treatment.

https://arxiv.org/abs/2006.13259 — Interdisciplinary research agenda for computational support of substance-use prevention, treatment, and recovery.


SEMANTIC EDGE LEDGER · SUBSTANCE_USE_RECOVERY · refinery-treasurevalley-v1.0.0
61 🌲 EVERGREEN · 86 🌿 BRANCH · 0 🫐 BERRY · 0 🌱 SEED
61 🌲 EVERGREEN
86 🌿 BRANCH
0 🫐 BERRY
0 🌱 SEED
Articles raw: 148 · Deduped: 147 · Entities: 0 · Sections: 0 · Noise filtered: 1 · Dropped noise: 0 · Dropped dupes: 1
KW HIGH 86 EXACT TITLE 61
◈ 🌲 EVERGREEN 61 EDGES
1.00
vertical-level
addiction medicine
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "addiction medicine". Entity: vertical-level.
1.00
vertical-level
affordable housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "affordable housing". Entity: vertical-level.
1.00
Alcoholism ↗ Q15326 EXACT TITLE
vertical-level
alcoholism
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "alcoholism". Entity: vertical-level.
1.00
vertical-level
benzodiazepine
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "benzodiazepine". Entity: vertical-level.
1.00
vertical-level
block grant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "block grant". Entity: vertical-level.
1.00
vertical-level
boise metropolitan
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise metropolitan". Entity: vertical-level.
1.00
vertical-level
boise state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise state university". Entity: vertical-level.
1.00
vertical-level
buprenorphine
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "buprenorphine". Entity: vertical-level.
1.00
vertical-level
case management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "case management". Entity: vertical-level.
1.00
vertical-level
cognitive behavioral therapy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "cognitive behavioral therapy". Entity: vertical-level.
1.00
vertical-level
community service
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community service". Entity: vertical-level.
1.00
vertical-level
contingency management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "contingency management". Entity: vertical-level.
1.00
vertical-level
continuing education
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "continuing education". Entity: vertical-level.
1.00
vertical-level
controlled substances act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "controlled substances act". Entity: vertical-level.
1.00
vertical-level
criminal justice
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "criminal justice". Entity: vertical-level.
1.00
vertical-level
crisis intervention
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "crisis intervention". Entity: vertical-level.
1.00
vertical-level
detoxification
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "detoxification". Entity: vertical-level.
1.00
vertical-level
domestic violence
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "domestic violence". Entity: vertical-level.
1.00
vertical-level
substance use disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "substance use disorder". Entity: vertical-level.
1.00
Drug court ↗ Q5308883 EXACT TITLE
vertical-level
drug court
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "drug court". Entity: vertical-level.
1.00
vertical-level
drug disposal
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "drug disposal". Entity: vertical-level.
1.00
vertical-level
drug enforcement administration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "drug enforcement administration". Entity: vertical-level.
1.00
vertical-level
electronic health record
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "electronic health record". Entity: vertical-level.
1.00
vertical-level
emergency department
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency department". Entity: vertical-level.
1.00
vertical-level
emergency medical services
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency medical services". Entity: vertical-level.
1.00
vertical-level
emergency medicine
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency medicine". Entity: vertical-level.
1.00
Fentanyl ↗ Q407541 EXACT TITLE
vertical-level
fentanyl
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fentanyl". Entity: vertical-level.
1.00
vertical-level
good samaritan law
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "good samaritan law". Entity: vertical-level.
1.00
vertical-level
harm reduction
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "harm reduction". Entity: vertical-level.
1.00
vertical-level
health services
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "health services". Entity: vertical-level.
1.00
vertical-level
homelessness
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "homelessness". Entity: vertical-level.
1.00
vertical-level
idaho department of health and welfare
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho department of health and welfare". Entity: vertical-level.
1.00
vertical-level
idaho state police
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho state police". Entity: vertical-level.
1.00
vertical-level
idaho supreme court
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho supreme court". Entity: vertical-level.
1.00
Idaho ↗ Q1221 EXACT TITLE
vertical-level
idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho". Entity: vertical-level.
1.00
vertical-level
intensive outpatient program
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "intensive outpatient program". Entity: vertical-level.
1.00
Medicaid ↗ Q1141363 EXACT TITLE
vertical-level
medicaid
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "medicaid". Entity: vertical-level.
1.00
Methadone ↗ Q179996 EXACT TITLE
vertical-level
methadone
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "methadone". Entity: vertical-level.
1.00
vertical-level
motivational interviewing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "motivational interviewing". Entity: vertical-level.
1.00
Naltrexone ↗ Q409587 EXACT TITLE
vertical-level
naltrexone
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "naltrexone". Entity: vertical-level.
1.00
Nursing ↗ Q121176 EXACT TITLE
vertical-level
nursing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "nursing". Entity: vertical-level.
1.00
vertical-level
opioid overdose
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "opioid overdose". Entity: vertical-level.
1.00
vertical-level
oxford house
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "oxford house". Entity: vertical-level.
1.00
vertical-level
peer support
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "peer support". Entity: vertical-level.
1.00
Pharmacist ↗ Q105186 EXACT TITLE
vertical-level
pharmacist
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "pharmacist". Entity: vertical-level.
1.00
Pharmacy ↗ Q614304 EXACT TITLE
vertical-level
pharmacy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "pharmacy". Entity: vertical-level.
1.00
vertical-level
prescription drug
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "prescription drug". Entity: vertical-level.
1.00
Probation ↗ Q13961 EXACT TITLE
vertical-level
probation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "probation". Entity: vertical-level.
1.00
vertical-level
program evaluation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "program evaluation". Entity: vertical-level.
1.00
Psychology ↗ Q9418 EXACT TITLE
vertical-level
psychology
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychology". Entity: vertical-level.
1.00
vertical-level
rehabilitation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "rehabilitation". Entity: vertical-level.
1.00
Relapse ↗ Q2292472 EXACT TITLE
vertical-level
relapse
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "relapse". Entity: vertical-level.
1.00
vertical-level
residential treatment
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "residential treatment". Entity: vertical-level.
1.00
vertical-level
sober living
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "sober living". Entity: vertical-level.
1.00
Social work ↗ Q205398 EXACT TITLE
vertical-level
social work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "social work". Entity: vertical-level.
1.00
vertical-level
substance abuse
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "substance abuse". Entity: vertical-level.
1.00
vertical-level
support for
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "support for". Entity: vertical-level.
1.00
vertical-level
supportive housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "supportive housing". Entity: vertical-level.
1.00
Telehealth ↗ Q46994 EXACT TITLE
vertical-level
telehealth
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "telehealth". Entity: vertical-level.
1.00
vertical-level
transitional housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "transitional housing". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
◈ 🌿 BRANCH 86 EDGES
0.6818
vertical-level
adaadamsboisecanyoncountieselmoregemidahometropolitanowyheepayetteregiontreasurevalleywashington
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "adams", "boise", "canyon", "counties", "elmore", "gem", "idaho", "metropolitan", "owyhee", "payette", "region", "treasure", "valley", "washington". Score: 0.6818. Entity: vertical-level.
0.6667
vertical-level
administeredavailabilitybehaviorcriminaldifferdifferentdiversionenforcementformfutureintendedinterventionjudicialjusticelawleadingoperationspreventprogramrehabilitationsystemsystems
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "availability", "behavior", "criminal", "differ", "different", "diversion", "enforcement", "form", "future", "intended", "intervention", "judicial", "justice", "law", "leading", "operations", "prevent", "program", "rehabilitation", "system", "systems". Score: 0.6667. Entity: vertical-level.
0.6667
vertical-level
alcoholbehavioralco-occurringconditionsconsequencescounselingdependencedependencydisordersdrugdrugsenablefinancialgeneralgroupslegalmedicalmedicationsparticipationpatientpeopleprescriptionpresentprocessprocessesprofessionalspsychiatricrecoveryrehabilitationsocialsubstancesubstancestrainedtreatment
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "alcohol", "behavioral", "co-occurring", "conditions", "consequences", "counseling", "dependence", "dependency", "disorders", "drug", "drugs", "enable", "financial", "general", "groups", "legal", "medical", "medications", "participation", "patient", "people", "prescription", "present", "process", "processes", "professionals", "psychiatric", "recovery", "rehabilitation", "social", "substance", "substances", "trained", "treatment". Score: 0.6667. Entity: vertical-level.
0.6522
vertical-level
admissioncareclinicscomprehensiveconditionhospitalinpatientmedicinemodernpatientsrequiresrequiringseveretraumawhose
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "admission", "care", "clinics", "comprehensive", "condition", "hospital", "inpatient", "medicine", "modern", "patients", "requires", "requiring", "severe", "trauma", "whose". Score: 0.6522. Entity: vertical-level.
0.6481
vertical-level
abuseactaddictionadministrationannouncedappropriationsauthorizedauthorizesavailabilitybuildcommunitycomprehensivedisordereducationfederalfundinggrantsincreaseintendedlawmajormentalnetworksopioidorganizationspreventionprocessprogramsprovisionspublicrecoveryrepresentativesamhsasubstancetreatment
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "act", "addiction", "administration", "announced", "appropriations", "authorized", "authorizes", "availability", "build", "community", "comprehensive", "disorder", "education", "federal", "funding", "grants", "increase", "intended", "law", "major", "mental", "networks", "opioid", "organizations", "prevention", "process", "programs", "provisions", "public", "recovery", "representative", "samhsa", "substance", "treatment". Score: 0.6481. Entity: vertical-level.
0.6383
vertical-level
addressingadministeredadministeringappointedauthorizedcommissionedconcerningconsentcreateddepartmenteducationexecutivefederalfundinggeneralgovernmenthealthcarehhshumanmattersmedicalmissionprimaryprivateprovidingpublicseparatestudiessystemwelfare
KEYWORD OVERLAP (high): 30 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addressing", "administered", "administering", "appointed", "authorized", "commissioned", "concerning", "consent", "created", "department", "education", "executive", "federal", "funding", "general", "government", "healthcare", "hhs", "human", "matters", "medical", "mission", "primary", "private", "providing", "public", "separate", "studies", "system", "welfare". Score: 0.6383. Entity: vertical-level.
0.6271
vertical-level
accountabilityactadministeradministersadministrationadministrativeagencycarecenterscertificationchildrenclinicaldepartmentfacilitiesfederalfinancinggovgovernmentshealthcarehhshomehomeshumaninsurancelong-termmaintainingmedicaidnursingoversightprocessprogramprogramsqualityreportsresponsibilitiesstandardssystem
KEYWORD OVERLAP (high): 37 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "act", "administer", "administers", "administration", "administrative", "agency", "care", "centers", "certification", "children", "clinical", "department", "facilities", "federal", "financing", "gov", "governments", "healthcare", "hhs", "home", "homes", "human", "insurance", "long-term", "maintaining", "medicaid", "nursing", "oversight", "process", "program", "programs", "quality", "reports", "responsibilities", "standards", "system". Score: 0.6271. Entity: vertical-level.
0.6230
vertical-level
administeredamonganotherbenefitsbuprenorphinecasecognitivedependencedescribedisorderenvironmentalexperiencefunctioningincreasedindividuallifelivelowermaintenancemedicationmethadoneongoingopioidopioidspatientspeopleprogramsqualityratesreductionrehabilitativeretentionroughlysocialsubstancetherapytreatmentwithdrawal
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "among", "another", "benefits", "buprenorphine", "case", "cognitive", "dependence", "describe", "disorder", "environmental", "experience", "functioning", "increased", "individual", "life", "live", "lower", "maintenance", "medication", "methadone", "ongoing", "opioid", "opioids", "patients", "people", "programs", "quality", "rates", "reduction", "rehabilitative", "retention", "roughly", "social", "substance", "therapy", "treatment", "withdrawal". Score: 0.6230. Entity: vertical-level.
0.6111
vertical-level
administeredadultaloneamonganotherchildconstitutecontrolledcriminaldefinitiondifferentdirecteddiversiondrugdrugseducationindividualindividualsintendedinvolvingjusticelegallegallymedicalpersonprofessionalprogramprogramspurposerehabilitationsubstancesubstancessystem
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "adult", "alone", "among", "another", "child", "constitute", "controlled", "criminal", "definition", "different", "directed", "diversion", "drug", "drugs", "education", "individual", "individuals", "intended", "involving", "justice", "legal", "legally", "medical", "person", "professional", "program", "programs", "purpose", "rehabilitation", "substance", "substances", "system". Score: 0.6111. Entity: vertical-level.
0.6000
vertical-level
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population". Score: 0.6000. Entity: vertical-level.
0.5938
vertical-level
businesscaredefinesdepartmentfacilityhumanindividualinsurancelicensedmedicalmedicationorganizationpaidpaymentspersonprofessionalproviderproviderstreatment
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "business", "care", "defines", "department", "facility", "human", "individual", "insurance", "licensed", "medical", "medication", "organization", "paid", "payments", "person", "professional", "provider", "providers", "treatment". Score: 0.5938. Entity: vertical-level.
0.5938
vertical-level
becomedescribesdevelopeddisordersdrugsfoundeditselfmajormenmodelnonprofitorganizationpeopleproblemsocietysubstanceusesweekwomen
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "become", "describes", "developed", "disorders", "drugs", "founded", "itself", "major", "men", "model", "nonprofit", "organization", "people", "problem", "society", "substance", "uses", "week", "women". Score: 0.5938. Entity: vertical-level.
0.5714
vertical-level
abusealcoholcombinedconditiondependencedependentdisorderindividualmedicalphysicallypsychiatricupon
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "alcohol", "combined", "condition", "dependence", "dependent", "disorder", "individual", "medical", "physically", "psychiatric", "upon". Score: 0.5714. Entity: vertical-level.
0.5714
vertical-level
adaamongboisecapitalidahomakingmeridianpopulation
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population". Score: 0.5714. Entity: vertical-level.
0.5686
vertical-level
addictionallowedbehaviorcontroldemanddisciplinedisorderdisordersdrugseffectsevaluationexpandingfederalfoodfundinginvolvingknowledgelegalmedicalopportunitypeopleprivatepublicrelatedresearchsectorsubstancetreatmenttreatments
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "allowed", "behavior", "control", "demand", "discipline", "disorder", "disorders", "drugs", "effects", "evaluation", "expanding", "federal", "food", "funding", "involving", "knowledge", "legal", "medical", "opportunity", "people", "private", "public", "related", "research", "sector", "substance", "treatment", "treatments". Score: 0.5686. Entity: vertical-level.
0.5583
vertical-level
abuseaccessaccountableaffectagenciesarticlebeyondchildchildrencollaborationcommunitycomponentcomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationensuringenvironmentenvironmentalevenfamiliesfamilyfreefuturegoalsgovernmentgovernmentsgroupsharmhealthcareholdinghomeidentifyidentifyingindividualindividualsjusticeleadlevelsliteraturelocallowermakingmeansneedsorganizationspeopleplacepoliciespotentialpreventpreventionprimaryprotectedprotectingprotectionprovidersprovidingprovisionqualityreducereferralregulationsrequiredresearchresourcesresponseresponsibilitiesresponsibilityrightsriskriskssafesafetysecuritysocialstabilitysupportsupportingsystemsystemsthemviolencewayswelfareyoung
KEYWORD OVERLAP (high): 91 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "access", "accountable", "affect", "agencies", "article", "beyond", "child", "children", "collaboration", "community", "component", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "ensuring", "environment", "environmental", "even", "families", "family", "free", "future", "goals", "government", "governments", "groups", "harm", "healthcare", "holding", "home", "identify", "identifying", "individual", "individuals", "justice", "lead", "levels", "literature", "local", "lower", "making", "means", "needs", "organizations", "people", "place", "policies", "potential", "prevent", "prevention", "primary", "protected", "protecting", "protection", "providers", "providing", "provision", "quality", "reduce", "referral", "regulations", "required", "research", "resources", "response", "responsibilities", "responsibility", "rights", "risk", "risks", "safe", "safety", "security", "social", "stability", "support", "supporting", "system", "systems", "them", "violence", "ways", "welfare", "young". Score: 0.5583. Entity: vertical-level.
0.5517
vertical-level
accidentaladministeredagencyagreementamongassociationbenefitsbusinesscarecasecentralcommunitycontractcostscoveragecoveredcoveringdeathdefineddisabilityentityevidenceexpensegovernmentindividualindividualsinjuryinsuranceinsurermedicalmembernationalorganizationpaymentspersonplanspolicyprivateproviderpublicresultrisksouthspecifiedsponsorstructuresystemtypes
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accidental", "administered", "agency", "agreement", "among", "association", "benefits", "business", "care", "case", "central", "community", "contract", "costs", "coverage", "covered", "covering", "death", "defined", "disability", "entity", "evidence", "expense", "government", "individual", "individuals", "injury", "insurance", "insurer", "medical", "member", "national", "organization", "payments", "person", "plans", "policy", "private", "provider", "public", "result", "risk", "south", "specified", "sponsor", "structure", "system", "types". Score: 0.5517. Entity: vertical-level.
0.5455
vertical-level
acquireactivitiesawarenesschangescommunicationcommunitiescommunityconferenceconsistingdecisionsdefineddesigneddifferentlyeducationendenvironmentalexpandingexperiencesformgroupshealthyimproveimprovingindividualindividualsinfluenceinformationinvolvingjointknowledgelifemedicinenationalopportunitiesopportunityorganizationpeoplepracticesprocessprofessionprofessionalqualityresearchskillssocialsourcesterminologytraining
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquire", "activities", "awareness", "changes", "communication", "communities", "community", "conference", "consisting", "decisions", "defined", "designed", "differently", "education", "end", "environmental", "expanding", "experiences", "form", "groups", "healthy", "improve", "improving", "individual", "individuals", "influence", "information", "involving", "joint", "knowledge", "life", "medicine", "national", "opportunities", "opportunity", "organization", "people", "practices", "process", "profession", "professional", "quality", "research", "skills", "social", "sources", "terminology", "training". Score: 0.5455. Entity: vertical-level.
0.5408
vertical-level
actactivitiesadmissionsaffordablebecomecarecasescontractingcontrollingcontrolscostcostsdeliveringdividedearlyeconomicformsgrouphealthcareimpactimplementationimprovingincentivesincreasedinpatientinsuranceintendedintensivelifemaintenancemanagementmechanismsmedicalmixednecessityorganizationorganizationsoutpatientpatientsphysiciansprivateprogramsproviderprovidersprovidingqualityreceivingreduceresultssettingsspecificspendingsystem
KEYWORD OVERLAP (high): 53 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "activities", "admissions", "affordable", "become", "care", "cases", "contracting", "controlling", "controls", "cost", "costs", "delivering", "divided", "early", "economic", "forms", "group", "healthcare", "impact", "implementation", "improving", "incentives", "increased", "inpatient", "insurance", "intended", "intensive", "life", "maintenance", "management", "mechanisms", "medical", "mixed", "necessity", "organization", "organizations", "outpatient", "patients", "physicians", "private", "programs", "provider", "providers", "providing", "quality", "receiving", "reduce", "results", "settings", "specific", "spending", "system". Score: 0.5408. Entity: vertical-level.
0.5263
vertical-level
applicationcasesdeathdrugoverdosepotentialrecommendedresultrisksubstance
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "application", "cases", "death", "drug", "overdose", "potential", "recommended", "result", "risk", "substance". Score: 0.5263. Entity: vertical-level.
0.5200
vertical-level
abuseacceptedaccreditedactadministrationagainstagenciesagencyanotherassociationauthorityauthorizedbackclosedcommunitycompilescompletecomprehensiveconsolidationcontrolcontrolledcreatescsadatadeadepartmentdeterminesdistributiondivideddrugdrugsenactedenforcementevaluationevaluationsfederalfinalfoodfoundationgeneralgovernmentgrouphhshumanindividualindividualsindustryinformationinstituteinvolvinglawlegallicenselocalmattersmechanismmedicalnationalpharmacypotentialprescriptionpreventionproductionpublicreceivedrecordrecordsregisteredregistrationregulatoryremovedrequirerequiredrequiressafetyschedulesschedulingsecuritysocietysourcesstimulantssubsequentsubstancesubstancessupervisionsystemtitletransactionstypesuponvary
KEYWORD OVERLAP (high): 91 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "accepted", "accredited", "act", "administration", "against", "agencies", "agency", "another", "association", "authority", "authorized", "back", "closed", "community", "compiles", "complete", "comprehensive", "consolidation", "control", "controlled", "creates", "csa", "data", "dea", "department", "determines", "distribution", "divided", "drug", "drugs", "enacted", "enforcement", "evaluation", "evaluations", "federal", "final", "food", "foundation", "general", "government", "group", "hhs", "human", "individual", "individuals", "industry", "information", "institute", "involving", "law", "legal", "license", "local", "matters", "mechanism", "medical", "national", "pharmacy", "potential", "prescription", "prevention", "production", "public", "received", "record", "records", "registered", "registration", "regulatory", "removed", "require", "required", "requires", "safety", "schedules", "scheduling", "security", "society", "sources", "stimulants", "subsequent", "substance", "substances", "supervision", "system", "title", "transactions", "types", "upon", "vary". Score: 0.5200. Entity: vertical-level.
0.5116
vertical-level
abuseaddictionapplybehavioralconsequencesdrugdrug-relatedfederalgovernmentimproveindividualinstituteknowledgemissionnationalpublicresearchsocialstudysupplytreatmentswhose
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "addiction", "apply", "behavioral", "consequences", "drug", "drug-related", "federal", "government", "improve", "individual", "institute", "knowledge", "mission", "national", "public", "research", "social", "study", "supply", "treatments", "whose". Score: 0.5116. Entity: vertical-level.
0.5065
vertical-level
activebusinesscapitalcategorychangescontroldescribeddevelopmententerpriseevaluationsexpansionfinancialfinanciallyfinancingfundsgeneralgoalsinvestmentinvestorlimitedlong-termmanagementmixedofferedoperationalownershipprivateprivate-equityproductsprofitingpublicratherreturnsroleshiftsspecializedspecificstrategiesstrategy
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "business", "capital", "category", "changes", "control", "described", "development", "enterprise", "evaluations", "expansion", "financial", "financially", "financing", "funds", "general", "goals", "investment", "investor", "limited", "long-term", "management", "mixed", "offered", "operational", "ownership", "private", "private-equity", "products", "profiting", "public", "rather", "returns", "role", "shifts", "specialized", "specific", "strategies", "strategy". Score: 0.5065. Entity: vertical-level.
0.5000
vertical-level
activityadultadultsarticleassistedcannotcarecasechildrenclientsconditionearlyfacilitiesfacilityfamiliesfamilygrouphomehomeshourshouseindividualsleastlivelivingmedicalmodelneedneedsnursingpeopleprogramsrelatedreportedrequiringresidenceresidentialresidentsstructuredsupervisedtrainedyoung
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "adult", "adults", "article", "assisted", "cannot", "care", "case", "children", "clients", "condition", "early", "facilities", "facility", "families", "family", "group", "home", "homes", "hours", "house", "individuals", "least", "live", "living", "medical", "model", "need", "needs", "nursing", "people", "programs", "related", "reported", "requiring", "residence", "residential", "residents", "structured", "supervised", "trained", "young". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
acquisitionacquisitionsactactivityanotherbusinesscapitalcentralcombinedcompetitionconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityexpandfederalgovernedgovernmentjusticelawlegalmanagementmarketoperatingoperationsorganizationownershipparticularlypositionpotentialprocessesprovidingregulatoryrequirerequiresresultreviewsinglestrategicstrategysubjectsubstantiallytermstransactionsunifiedunits
KEYWORD OVERLAP (high): 52 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquisition", "acquisitions", "act", "activity", "another", "business", "capital", "central", "combined", "competition", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "expand", "federal", "governed", "government", "justice", "law", "legal", "management", "market", "operating", "operations", "organization", "ownership", "particularly", "position", "potential", "processes", "providing", "regulatory", "require", "requires", "result", "review", "single", "strategic", "strategy", "subject", "substantially", "terms", "transactions", "unified", "units". Score: 0.5000. Entity: vertical-level.
0.4957
vertical-level
abuseagenciesauthorizedboardscarecontrolleddatadatabasedispensedispensingdiversiondrugdrug-relateddrugselectronicenforcementestablishedevidenceexperiencingfederallyidentifyingincreasedlawlicensingmixedmonitoringmultipleopioidopioidsoverdoseoverdosespatientspharmaciespharmacistsphysicianspotencypotentiallypractitionersprescribersprescribingprescriptionpreventprogramprogramsprovidersreceivingreportreportingrequiredrequirementsrequiresrequiringrisksubstancesubstancessupportwhoseworkers
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "agencies", "authorized", "boards", "care", "controlled", "data", "database", "dispense", "dispensing", "diversion", "drug", "drug-related", "drugs", "electronic", "enforcement", "established", "evidence", "experiencing", "federally", "identifying", "increased", "law", "licensing", "mixed", "monitoring", "multiple", "opioid", "opioids", "overdose", "overdoses", "patients", "pharmacies", "pharmacists", "physicians", "potency", "potentially", "practitioners", "prescribers", "prescribing", "prescription", "prevent", "program", "programs", "providers", "receiving", "report", "reporting", "required", "requirements", "requires", "requiring", "risk", "substance", "substances", "support", "whose", "workers". Score: 0.4957. Entity: vertical-level.
0.4934
vertical-level
accommodationaddressaddressedaddressesaffectagainstapproachescarecausechildrencommunitycomprehensivecontinuumcontrastcostdecadesdifferenteducationemergencyemploymententeringepisodeevidencefamilyformgovernmenthealthcarehomelessnesshospitalshousehouseholdhousingimplementationindependentindividualindividualsjailslevelslifemedicinemodelmodelsneednetworksobtainedoperatepeoplepermanentpoliciespolicyprimaryprogramprogramsprovidingprovisionpublicratherreducereducesresultsheltershiftsignificantsocialstabilitystablestrategysupportsupportivesystemthemtransitionaltreatmentwelfarewestern
KEYWORD OVERLAP (high): 75 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accommodation", "address", "addressed", "addresses", "affect", "against", "approaches", "care", "cause", "children", "community", "comprehensive", "continuum", "contrast", "cost", "decades", "different", "education", "emergency", "employment", "entering", "episode", "evidence", "family", "form", "government", "healthcare", "homelessness", "hospitals", "house", "household", "housing", "implementation", "independent", "individual", "individuals", "jails", "levels", "life", "medicine", "model", "models", "need", "networks", "obtained", "operate", "people", "permanent", "policies", "policy", "primary", "program", "programs", "providing", "provision", "public", "rather", "reduce", "reduces", "result", "shelter", "shift", "significant", "social", "stability", "stable", "strategy", "support", "supportive", "system", "them", "transitional", "treatment", "welfare", "western". Score: 0.4934. Entity: vertical-level.
0.4915
vertical-level
activitiesaddictionalcoholclientscommunitiescommunitydependencedifferentdisordersdruggrouphousesincreasinglylivinglong-termmentalpathpatientpracticalproblemsrehabilitationreputationresidentialseveresuccesstherapiststherapytreatmentunits
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "addiction", "alcohol", "clients", "communities", "community", "dependence", "different", "disorders", "drug", "group", "houses", "increasingly", "living", "long-term", "mental", "path", "patient", "practical", "problems", "rehabilitation", "reputation", "residential", "severe", "success", "therapists", "therapy", "treatment", "units". Score: 0.4915. Entity: vertical-level.
0.4853
vertical-level
analysiscareclinicalcollectioncurrentdatadecision-makingdecisionsdescribeevidenceevidence-basedexperienceexpertiseexternalguidehealthcarehumanimprovingindividualinformationleastmakingmanagementmeansmedicinepatientpatientsphysicianspracticepreventionpublicresearchtreatment
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "analysis", "care", "clinical", "collection", "current", "data", "decision-making", "decisions", "describe", "evidence", "evidence-based", "experience", "expertise", "external", "guide", "healthcare", "human", "improving", "individual", "information", "least", "making", "management", "means", "medicine", "patient", "patients", "physicians", "practice", "prevention", "public", "research", "treatment". Score: 0.4853. Entity: vertical-level.
0.4848
vertical-level
carecoordinationmedicalmedicationsneedspatientplanspracticepractitionerprescribepreventionproviderregisteredtrainedtrainingtreatment
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "care", "coordination", "medical", "medications", "needs", "patient", "plans", "practice", "practitioner", "prescribe", "prevention", "provider", "registered", "trained", "training", "treatment". Score: 0.4848. Entity: vertical-level.
0.4776
vertical-level
accountabilityactcareconfidentialitydegreedevelopeddisclosureeffortselectronicemployersenactedfacilityincreaseinstitutionsinsurancemaintainingmanagementmedicalmodernpatientpatientspeoplepracticeprivacyprotectingprovidersrecordsreducesecuritysettingssystemsterms
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "act", "care", "confidentiality", "degree", "developed", "disclosure", "efforts", "electronic", "employers", "enacted", "facility", "increase", "institutions", "insurance", "maintaining", "management", "medical", "modern", "patient", "patients", "people", "practice", "privacy", "protecting", "providers", "records", "reduce", "security", "settings", "systems", "terms". Score: 0.4776. Entity: vertical-level.
0.4737
vertical-level
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population". Score: 0.4737. Entity: vertical-level.
0.4702
vertical-level
addictionageassociationbehavioralbuprenorphineclinicianscognitiveconditioncontinuedcriteriacurrentdailydeathdependencedifferentdisorderdisorderseffectsfamilyfentanylformsgrouphistoryhomeimportantincreasedindividuallivinglong-termmedicalmedicationmeetingmentalmethadonenaloxonenaltrexoneopioidopioid-relatedopioidsoverdoseoverdosespainpeerpeopleprescribingprescriptionpreventproblemsprofessionalprofessionalsprogramspsychiatricrecommendedreducesrelapsereportedresponsibilitiesrisksocialstandardstatussubstancesubstancessupporttherapytraumatreatingtreatmentuserswithdrawalyoung
KEYWORD OVERLAP (high): 71 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "age", "association", "behavioral", "buprenorphine", "clinicians", "cognitive", "condition", "continued", "criteria", "current", "daily", "death", "dependence", "different", "disorder", "disorders", "effects", "family", "fentanyl", "forms", "group", "history", "home", "important", "increased", "individual", "living", "long-term", "medical", "medication", "meeting", "mental", "methadone", "naloxone", "naltrexone", "opioid", "opioid-related", "opioids", "overdose", "overdoses", "pain", "peer", "people", "prescribing", "prescription", "prevent", "problems", "professional", "professionals", "programs", "psychiatric", "recommended", "reduces", "relapse", "reported", "responsibilities", "risk", "social", "standard", "status", "substance", "substances", "support", "therapy", "trauma", "treating", "treatment", "users", "withdrawal", "young". Score: 0.4702. Entity: vertical-level.
0.4700
vertical-level
accountabilityactaddressedadministrativeauthorizedcarecasesconcerningconfidentialityconsentcoveragecoveredelectronicemployersenactedentityfamiliesfamilyfederalgrouphealthcareindividualsinformationinsurancelawlifelimitationslimitedmedicalmembersnationalpatientpatientsplanspoliciesprotectedprotectsprovidersprovisionsrequirerequiresrestrictspendingstandardstitletransactionsworkers
KEYWORD OVERLAP (high): 47 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "act", "addressed", "administrative", "authorized", "care", "cases", "concerning", "confidentiality", "consent", "coverage", "covered", "electronic", "employers", "enacted", "entity", "families", "family", "federal", "group", "healthcare", "individuals", "information", "insurance", "law", "life", "limitations", "limited", "medical", "members", "national", "patient", "patients", "plans", "policies", "protected", "protects", "providers", "provisions", "require", "requires", "restrict", "spending", "standards", "title", "transactions", "workers". Score: 0.4700. Entity: vertical-level.
0.4667
vertical-level
behaviorbenefitschildrenclientscliniciansconversationscounselingdefineddevelopeddevelopmentdifferentdirectearlyevolvedfamiliesfamilyhumanindividualinfluenceinteractioninvolvinglong-termmarriagemembersnarrowparentsparticipationpeopleproblempsychologyrelatedrelationshipsschoolsskillsstudysupportsupportivesystemsystemstermstherapiststherapy
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "behavior", "benefits", "children", "clients", "clinicians", "conversations", "counseling", "defined", "developed", "development", "different", "direct", "early", "evolved", "families", "family", "human", "individual", "influence", "interaction", "involving", "long-term", "marriage", "members", "narrow", "parents", "participation", "people", "problem", "psychology", "related", "relationships", "schools", "skills", "study", "support", "supportive", "system", "systems", "terms", "therapists", "therapy". Score: 0.4667. Entity: vertical-level.
0.4634
vertical-level
addictionalcoholbehavioralbuiltchallengescognitivecommunitydevelopeddrugsestablishedfreegroupsguidedinternationalinternetinterviewingmedicalmethodsmodelmotivationalorganizationparticipantspatientspeerpeoplepersonproblematicprofessionalprofessionalspsychologypursuingrecoveryseekingsupporttherapytrainedtrainingweek
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "alcohol", "behavioral", "built", "challenges", "cognitive", "community", "developed", "drugs", "established", "free", "groups", "guided", "international", "internet", "interviewing", "medical", "methods", "model", "motivational", "organization", "participants", "patients", "peer", "people", "person", "problematic", "professional", "professionals", "psychology", "pursuing", "recovery", "seeking", "support", "therapy", "trained", "training", "week". Score: 0.4634. Entity: vertical-level.
0.4588
vertical-level
agreementaroundassociatebegancannotcareclinicianscountrydependentdirecteducationalhealthcarejobleastmedicalmedicationsmodelphysiciansplanspracticepractitionerprescribepresentprincipalproviderprovidersqualifiedrequiredrequiringservesignificantskillssmallersupervisionsupporttrainingtreatmentuponwork
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agreement", "around", "associate", "began", "cannot", "care", "clinicians", "country", "dependent", "direct", "educational", "healthcare", "job", "least", "medical", "medications", "model", "physicians", "plans", "practice", "practitioner", "prescribe", "present", "principal", "provider", "providers", "qualified", "required", "requiring", "serve", "significant", "skills", "smaller", "supervision", "support", "training", "treatment", "upon", "work". Score: 0.4588. Entity: vertical-level.
0.4521
vertical-level
academicacquisitionapplicationapplicationsapproachesbehaviorcarecommunicationcomputationalcomputercontextdatadesigndevelopmentdomainembeddedhealthcarehospitalsimplementationimproveinformationinstitutionslibrarymanagementmedicalmethodsmultidisciplinarypatientproblemsresearchstudysystemstechnology
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "acquisition", "application", "applications", "approaches", "behavior", "care", "communication", "computational", "computer", "context", "data", "design", "development", "domain", "embedded", "healthcare", "hospitals", "implementation", "improve", "information", "institutions", "library", "management", "medical", "methods", "multidisciplinary", "patient", "problems", "research", "study", "systems", "technology". Score: 0.4521. Entity: vertical-level.
0.4520
vertical-level
actaffordableageallowedapplicantsbackbenefitsbudgetcannotcarechallengeschangesconditionscostscourtcoveragecoverededucationeffecteligibilityenactedexpandedexpansionfederalforceformallyfoundfundedfundinghealthcareimproveincreaseincreasedindividualindividualsinsuranceinsurersintendedlawlegallistmajormandatedmarchmarketmarketsmedicaidofficeoppositionparentspatientpeopleplanspopulationprotectionproviderprovisionsqualityrangingratesreceivedreducedregulatoryremainsreportsrepresentsroughlyscaledselectionsignificantspendingstatedstatusstatutestructuresupportsupremesystemuninsuredyoung
KEYWORD OVERLAP (high): 80 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "affordable", "age", "allowed", "applicants", "back", "benefits", "budget", "cannot", "care", "challenges", "changes", "conditions", "costs", "court", "coverage", "covered", "education", "effect", "eligibility", "enacted", "expanded", "expansion", "federal", "force", "formally", "found", "funded", "funding", "healthcare", "improve", "increase", "increased", "individual", "individuals", "insurance", "insurers", "intended", "law", "legal", "list", "major", "mandated", "march", "market", "markets", "medicaid", "office", "opposition", "parents", "patient", "people", "plans", "population", "protection", "provider", "provisions", "quality", "ranging", "rates", "received", "reduced", "regulatory", "remains", "reports", "represents", "roughly", "scaled", "selection", "significant", "spending", "stated", "status", "statute", "structure", "support", "supreme", "system", "uninsured", "young". Score: 0.4520. Entity: vertical-level.
0.4519
vertical-level
absenceapproachesassessmentassessmentsassociationbehaviorcaseclassificationclinicalcommunityconditionsconductingcontroldisordersemploymentexaminationexaminationsfunctionalhistoricalhistoryimpairmentindividualindustryinfluenceinpatientinstituteinterdisciplinaryinternationalmattersmeasuresmedicalmedicinemedicinesmentalmodalitiesnationalnursesoccupationalorganizationoutpatientpreventionprofessionalspsychiatricpsychologistspublishedreinforcementrelatedresearchriskrolesocialspecialtystatementstatisticalstatusstudiessubstance-abusetherapiststreatmenttreatmentsworkers
KEYWORD OVERLAP (high): 61 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absence", "approaches", "assessment", "assessments", "association", "behavior", "case", "classification", "clinical", "community", "conditions", "conducting", "control", "disorders", "employment", "examination", "examinations", "functional", "historical", "history", "impairment", "individual", "industry", "influence", "inpatient", "institute", "interdisciplinary", "international", "matters", "measures", "medical", "medicine", "medicines", "mental", "modalities", "national", "nurses", "occupational", "organization", "outpatient", "prevention", "professionals", "psychiatric", "psychologists", "published", "reinforcement", "related", "research", "risk", "role", "social", "specialty", "statement", "statistical", "status", "studies", "substance-abuse", "therapists", "treatment", "treatments", "workers". Score: 0.4519. Entity: vertical-level.
0.4487
vertical-level
acceptanceadultadultsageauthoritybehaviorbroadcapacitycausechangeschildchildrenconcerningcontextcontrastcourtcourtscreatecriminaldatadependencydevelopmentdifferdifferentlyearlyexactfurthergeneralguardianharmhavinghopeimplementationimplementingincreasinglyinitiativesinternationalinterventionjusticejuvenilelegallocallymeaningminorsmodelmodernneedsnumbersparentparticularlypoliciespracticeprotectionquestionsrecentreformreportedresponseresponsibilityrightsrulesseparateseparatelyshiftsocietysystemsthemtreatingyoungyouth
KEYWORD OVERLAP (high): 70 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acceptance", "adult", "adults", "age", "authority", "behavior", "broad", "capacity", "cause", "changes", "child", "children", "concerning", "context", "contrast", "court", "courts", "create", "criminal", "data", "dependency", "development", "differ", "differently", "early", "exact", "further", "general", "guardian", "harm", "having", "hope", "implementation", "implementing", "increasingly", "initiatives", "international", "intervention", "justice", "juvenile", "legal", "locally", "meaning", "minors", "model", "modern", "needs", "numbers", "parent", "particularly", "policies", "practice", "protection", "questions", "recent", "reform", "reported", "response", "responsibility", "rights", "rules", "separate", "separately", "shift", "society", "systems", "them", "treating", "young", "youth". Score: 0.4487. Entity: vertical-level.
0.4474
vertical-level
alcoholalonecategorychallengesco-occurringconditiondependencydependentdisorderdisordersdruggrouphavinghomelessnesshospitalizationincreasedindividualsitselfmakingmentalneedsopioidspeoplepersonprimaryproblemspsychiatricratesrelapserestrictedseveresinglesubstancesubstances
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "alcohol", "alone", "category", "challenges", "co-occurring", "condition", "dependency", "dependent", "disorder", "disorders", "drug", "group", "having", "homelessness", "hospitalization", "increased", "individuals", "itself", "making", "mental", "needs", "opioids", "people", "person", "primary", "problems", "psychiatric", "rates", "relapse", "restricted", "severe", "single", "substance", "substances". Score: 0.4474. Entity: vertical-level.
0.4465
vertical-level
absenceacademicaccessagenciesagreementalonearchivearchivedcodecommunicationcommunityconfidentialityconstitutecriteriadatadevelopmentdisseminationenableestablishedfailfoundfoundationalfullfundingfurthergoverninggovernmentshistoryidentifiedincreasinglyinformationinstitutionsjournalsmechanismmediamethodsmodelsmodernnationalpatientpeer-reviewedplatformpoliciesportionpracticepreventpubliclypublishedrapidrecentrecognizedreflectingrequestedrequirerequirementrequirementsresearchresponserestrictedrisksecurityseekingsocialsourcestatementsstatisticalstudysubjecttechnologyunavailableupon
KEYWORD OVERLAP (high): 71 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absence", "academic", "access", "agencies", "agreement", "alone", "archive", "archived", "code", "communication", "community", "confidentiality", "constitute", "criteria", "data", "development", "dissemination", "enable", "established", "fail", "found", "foundational", "full", "funding", "further", "governing", "governments", "history", "identified", "increasingly", "information", "institutions", "journals", "mechanism", "media", "methods", "models", "modern", "national", "patient", "peer-reviewed", "platform", "policies", "portion", "practice", "prevent", "publicly", "published", "rapid", "recent", "recognized", "reflecting", "requested", "require", "requirement", "requirements", "research", "response", "restricted", "risk", "security", "seeking", "social", "source", "statements", "statistical", "study", "subject", "technology", "unavailable", "upon". Score: 0.4465. Entity: vertical-level.
0.4423
vertical-level
activitybehavioralchangescognitiveconsistentdependencedisorderdrivendrugengagementenvironmentalexposureformfrequentinvolvingmotivationalongoingpreventreinforcementrequiringsubstancesuponwithdrawal
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "behavioral", "changes", "cognitive", "consistent", "dependence", "disorder", "driven", "drug", "engagement", "environmental", "exposure", "form", "frequent", "involving", "motivational", "ongoing", "prevent", "reinforcement", "requiring", "substances", "upon", "withdrawal". Score: 0.4423. Entity: vertical-level.
0.4413
vertical-level
adherenceadultsapproachesbehaviorbenefitschallengeschildrenclientclinicalclinicallyconditionconditionscontrolledcounselorsdesigneddifferdifferentdisordersdriverseffecteffectsevaluatingevidence-basedfamiliesfamilyformsfoundgeneralgroupsimproveincreaseindividualindividualizedinteractioninvolvingitselfleadingleastlegallylicensedlimitedmarriagemechanismsmedicationsmentalmethodsminornursesoutcomesparticularlypersonpotentialproblemsproduceprofessionalprofessionalsprotectedpsychologistspsychologyquestionsratesregulatedrelationshiprelationshipsresearchreviewsessionsshiftskillssmallsocialsupporttherapiststherapytreatingtreatmenttreatmentstypesworkers
KEYWORD OVERLAP (high): 79 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adherence", "adults", "approaches", "behavior", "benefits", "challenges", "children", "client", "clinical", "clinically", "condition", "conditions", "controlled", "counselors", "designed", "differ", "different", "disorders", "drivers", "effect", "effects", "evaluating", "evidence-based", "families", "family", "forms", "found", "general", "groups", "improve", "increase", "individual", "individualized", "interaction", "involving", "itself", "leading", "least", "legally", "licensed", "limited", "marriage", "mechanisms", "medications", "mental", "methods", "minor", "nurses", "outcomes", "particularly", "person", "potential", "problems", "produce", "professional", "professionals", "protected", "psychologists", "psychology", "questions", "rates", "regulated", "relationship", "relationships", "research", "review", "sessions", "shift", "skills", "small", "social", "support", "therapists", "therapy", "treating", "treatment", "treatments", "types", "workers". Score: 0.4413. Entity: vertical-level.
0.4396
vertical-level
activitiesanotherapprovedaroundauthoritybecomecareclientclinicalcoachingcompetencecomponentconsultationcontrolcontrolleddefineddeliveringdirecteducationeffectsendevidenceexaminedexperienceexpertisefinancialformalfoundgeneralgoodhealthcareinvestmentleavemainmaintainingmeetingmentalmentorshipmethodsnecessarilynursesnursingoccupationaloptionaloutcomesoversightpatientpatientspeopleperformanceplanningpracticepractitionerpractitionersprocessprofessionalprofessionsprovisionpsychologistspurposequalityreducedrelatedrelationshipsrequiresretentionseniorskillssomeonestructuredsupervisedsupervisionsupervisorssupportstherapiststhereforethoughtrainingwhitework
KEYWORD OVERLAP (high): 80 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "another", "approved", "around", "authority", "become", "care", "client", "clinical", "coaching", "competence", "component", "consultation", "control", "controlled", "defined", "delivering", "direct", "education", "effects", "end", "evidence", "examined", "experience", "expertise", "financial", "formal", "found", "general", "good", "healthcare", "investment", "leave", "main", "maintaining", "meeting", "mental", "mentorship", "methods", "necessarily", "nurses", "nursing", "occupational", "optional", "outcomes", "oversight", "patient", "patients", "people", "performance", "planning", "practice", "practitioner", "practitioners", "process", "professional", "professions", "provision", "psychologists", "purpose", "quality", "reduced", "related", "relationships", "requires", "retention", "senior", "skills", "someone", "structured", "supervised", "supervision", "supervisors", "supports", "therapists", "therefore", "though", "training", "white", "work". Score: 0.4396. Entity: vertical-level.
0.4385
vertical-level
accessactionsactivitiesadministrationagencyannouncedassociationattentioncapacitycenterschangescontrolcooperationdepartmentdesigneddisabilityeducationalenvironmentalfederalfoodfoundinggovernmenthealthyhhshumanimproveindependenceinformationinjuryinstituteinstitutionalinternationalleadershipmainmajormedicalmembernationaloccupationalordersorganizationorganizationspreventionprogramprogramsprotectionpublicremoverepeatedreportresearchresponserestrictrestrictionssafetystabilitystrategic
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "actions", "activities", "administration", "agency", "announced", "association", "attention", "capacity", "centers", "changes", "control", "cooperation", "department", "designed", "disability", "educational", "environmental", "federal", "food", "founding", "government", "healthy", "hhs", "human", "improve", "independence", "information", "injury", "institute", "institutional", "international", "leadership", "main", "major", "medical", "member", "national", "occupational", "orders", "organization", "organizations", "prevention", "program", "programs", "protection", "public", "remove", "repeated", "report", "research", "response", "restrict", "restrictions", "safety", "stability", "strategic". Score: 0.4385. Entity: vertical-level.
0.4348
vertical-level
agencyappointedcertificationdesignationeducationaljobpersonprofessionalpublictask
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "appointed", "certification", "designation", "educational", "job", "person", "professional", "public", "task". Score: 0.4348. Entity: vertical-level.
0.4331
vertical-level
adoptedbeyondchangingcommunitycontinuumdefinitiondemonstratingdependencedependencydevelopeddevelopmentdifferentdisorderseffectsempowermentevenexplicitlygoalshopeindividualslifelimitationslivingmeaningmeasuresmentalmodelmodelsmovementoriginatingoutcomepeoplepersonpoliciespotentialpracticalprocessproviderspsychiatricpurposeratherrecoveryrecovery-orientedrehabilitationrelationshipsresponseskillssocialsocietystandardizedstudiessubstancesupportsupportivesupports
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adopted", "beyond", "changing", "community", "continuum", "definition", "demonstrating", "dependence", "dependency", "developed", "development", "different", "disorders", "effects", "empowerment", "even", "explicitly", "goals", "hope", "individuals", "life", "limitations", "living", "meaning", "measures", "mental", "model", "models", "movement", "originating", "outcome", "people", "person", "policies", "potential", "practical", "process", "providers", "psychiatric", "purpose", "rather", "recovery", "recovery-oriented", "rehabilitation", "relationships", "response", "skills", "social", "society", "standardized", "studies", "substance", "support", "supportive", "supports". Score: 0.4331. Entity: vertical-level.
0.4255
vertical-level
actingagainstauthorityauthorizedbecomecasecauseconditionsdetentiondirectedemployedendevenevidenceforceformsgovernmentharmhumanimplyincarcerationitselfjudiciallawlikelymovementnecessarilyofficeropenpeoplepersonplaceplacingpolicepositionprovisionspurposeratesrecognizedrights
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acting", "against", "authority", "authorized", "become", "case", "cause", "conditions", "detention", "directed", "employed", "end", "even", "evidence", "force", "forms", "government", "harm", "human", "imply", "incarceration", "itself", "judicial", "law", "likely", "movement", "necessarily", "officer", "open", "people", "person", "place", "placing", "police", "position", "provisions", "purpose", "rates", "recognized", "rights". Score: 0.4255. Entity: vertical-level.
0.4211
vertical-level
amonganalysisapplicationappropriateassessmentbetterclinicalcollectioncomparisonsconditionconditionsdatadecisionsdefineddescribedescriptiondesigndisseminationdistinctiondistributioneffectsenvironmentalepidemiologicalevidence-basedexaminedexposurefunctiongeneralhealthcarehistoricallyhumanidentifyinginteractionknowledgemajormeaningmentaloccupationalpatternpatternspeerpeoplepolicypopulationpopulationspracticepreventprocessespublicrelatedrelyresearchresultsreviewriskscreeningsocialstatisticalstudiesstudysurveillancethereforetreatmentupon
KEYWORD OVERLAP (high): 64 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "analysis", "application", "appropriate", "assessment", "better", "clinical", "collection", "comparisons", "condition", "conditions", "data", "decisions", "defined", "describe", "description", "design", "dissemination", "distinction", "distribution", "effects", "environmental", "epidemiological", "evidence-based", "examined", "exposure", "function", "general", "healthcare", "historically", "human", "identifying", "interaction", "knowledge", "major", "meaning", "mental", "occupational", "pattern", "patterns", "peer", "people", "policy", "population", "populations", "practice", "prevent", "processes", "public", "related", "rely", "research", "results", "review", "risk", "screening", "social", "statistical", "studies", "study", "surveillance", "therefore", "treatment", "upon". Score: 0.4211. Entity: vertical-level.
0.4185
vertical-level
activitiesadoptedanotherapplyarticleauthorityauthorizedbenefitsboardbriefcapacitycaseschildclinicalcognateconditionsconsentdecision-makingdecisionsdefinitionsdisabilitydisclosedisorderethicalevidencefactsforceformfreehealthcareimpactindividualinformationinstitutionalinsufficientintendedinternationalinterventionintoxicationlawlegallevelslimitedmakingmarchmedicalmentalnationalparentspatientpermitspersonprocessprofessionalprovidersqualifyrelevantrequiredrequirementresearchresponsibilityreviewrightsriskrisksroleseverestandardstandardssubjectsufficientsystemsthoughtreatmenttreatmentsuponvary
KEYWORD OVERLAP (high): 77 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "adopted", "another", "apply", "article", "authority", "authorized", "benefits", "board", "brief", "capacity", "cases", "child", "clinical", "cognate", "conditions", "consent", "decision-making", "decisions", "definitions", "disability", "disclose", "disorder", "ethical", "evidence", "facts", "force", "form", "free", "healthcare", "impact", "individual", "information", "institutional", "insufficient", "intended", "international", "intervention", "intoxication", "law", "legal", "levels", "limited", "making", "march", "medical", "mental", "national", "parents", "patient", "permits", "person", "process", "professional", "providers", "qualify", "relevant", "required", "requirement", "research", "responsibility", "review", "rights", "risk", "risks", "role", "severe", "standard", "standards", "subject", "sufficient", "systems", "though", "treatment", "treatments", "upon", "vary". Score: 0.4185. Entity: vertical-level.
0.4173
vertical-level
affectaffectsaroundattentionbehaviorbehavioralcaseschangesclinicalclinicallyclinicscommunityconditioncontextdetentiondifferentdisabilitydisorderdisordersearlyepisodesfunctioningfunctionshospitalsimpairmentincreaseindividualinterventionsleadingmajormakingmedicalmedicationmentalmethodsobservationoptionsoutpatientpatternpeerpeoplepersistentpreventionprofessionalprofessionalsprogramspsychiatricreduceregulationsignificantsinglesocialspecificsupporttreatmenttreatmentstypesvary
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affect", "affects", "around", "attention", "behavior", "behavioral", "cases", "changes", "clinical", "clinically", "clinics", "community", "condition", "context", "detention", "different", "disability", "disorder", "disorders", "early", "episodes", "functioning", "functions", "hospitals", "impairment", "increase", "individual", "interventions", "leading", "major", "making", "medical", "medication", "mental", "methods", "observation", "options", "outpatient", "pattern", "peer", "people", "persistent", "prevention", "professional", "professionals", "programs", "psychiatric", "reduce", "regulation", "significant", "single", "social", "specific", "support", "treatment", "treatments", "types", "vary". Score: 0.4173. Entity: vertical-level.
0.4167
vertical-level
boisecanyoncollegehomeidahomeaningmeridianmetropolitannampapopulationprincipalprominentstudentuniversitywestern
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "prominent", "student", "university", "western". Score: 0.4167. Entity: vertical-level.
0.4074
vertical-level
alcoholcontroldrugdrugsduieffectinfluencemultipleoperatingprescriptionterms
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "alcohol", "control", "drug", "drugs", "dui", "effect", "influence", "multiple", "operating", "prescription", "terms". Score: 0.4074. Entity: vertical-level.
0.4074
vertical-level
addictionaddressadmittingalcoholismassociationbehaviorbehavioralcannotcodecontroldevelopeddrugexaminingfoundedhelpinglifelivemakingmembermenorganizationsproblemsprocessprogramprogramspublishedrecoveredrecoverysponsorsubstancesupportingtwelveversion
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "address", "admitting", "alcoholism", "association", "behavior", "behavioral", "cannot", "code", "control", "developed", "drug", "examining", "founded", "helping", "life", "live", "making", "member", "men", "organizations", "problems", "process", "program", "programs", "published", "recovered", "recovery", "sponsor", "substance", "supporting", "twelve", "version". Score: 0.4074. Entity: vertical-level.
0.4000
vertical-level
advocacyburdencommunityestablishingevaluatingexperiencesformgroupinformationmembersnetworkspeopleprovidingpublicrelevantsocialstrategiessupporttypeswork
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advocacy", "burden", "community", "establishing", "evaluating", "experiences", "form", "group", "information", "members", "networks", "people", "providing", "public", "relevant", "social", "strategies", "support", "types", "work". Score: 0.4000. Entity: vertical-level.
0.3919
vertical-level
actadaagainstbroadbusinesschangescoalitioncostscouncilcovereddisabilityemployersfinalhouseidentityimposesindividualslaterlawnationalprotectionprotectionspublicrecommendedrequirementsrequiresrightsunlikeversion
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "ada", "against", "broad", "business", "changes", "coalition", "costs", "council", "covered", "disability", "employers", "final", "house", "identity", "imposes", "individuals", "later", "law", "national", "protection", "protections", "public", "recommended", "requirements", "requires", "rights", "unlike", "version". Score: 0.3919. Entity: vertical-level.
0.3831
vertical-level
accessamonganalyzingbeganbehavioralcarecasecaseschildcommunitiescommunitycomprehensivecontrolcountrycrisesdesigneddevelopeddevelopmentdifferentdisabilitydistributioneducationeffortsenvironmentalevenevolvinghealthcarehealthyhumanimplementationimportantincreasingindicatorsindividualsinfrastructureinitiativesinterdisciplinaryinterventionsknowledgelifelimitedmajormanagementmedicalmentalmodernoccupationalorganizationsorganizedpeoplepoliciespolicypopulationpopulationspreventingpreventionprimaryprivatepromotingpublicqualityreducerelevantresourcesriskriskssafetysignificantsmallsocialsocietysufficientsurveillancesystemsystemstrainedworkers
KEYWORD OVERLAP (high): 77 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "among", "analyzing", "began", "behavioral", "care", "case", "cases", "child", "communities", "community", "comprehensive", "control", "country", "crises", "designed", "developed", "development", "different", "disability", "distribution", "education", "efforts", "environmental", "even", "evolving", "healthcare", "healthy", "human", "implementation", "important", "increasing", "indicators", "individuals", "infrastructure", "initiatives", "interdisciplinary", "interventions", "knowledge", "life", "limited", "major", "management", "medical", "mental", "modern", "occupational", "organizations", "organized", "people", "policies", "policy", "population", "populations", "preventing", "prevention", "primary", "private", "promoting", "public", "quality", "reduce", "relevant", "resources", "risk", "risks", "safety", "significant", "small", "social", "society", "sufficient", "surveillance", "system", "systems", "trained", "workers". Score: 0.3831. Entity: vertical-level.
0.3775
vertical-level
administrationassessmentattentionbehavioralcentralchangedclinicclinicalclinicianscognitiveconsultationdevelopeddevelopmentdifferentdisorderseducationalequivalentfallsfamilyheavilyhumanidahoincreaseintegrationknowledgemainmastermedicalmedicationsmedicinementalmethodsmodelmodelsneedpracticepractitionersprescribepreventingprimaryproceduresprofessionprogrampromotingprovidingpsychologistspsychologyregulatedresearchspecialtystandardsystemstherapytrainedtrainingtreatmentuniversity
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "assessment", "attention", "behavioral", "central", "changed", "clinic", "clinical", "clinicians", "cognitive", "consultation", "developed", "development", "different", "disorders", "educational", "equivalent", "falls", "family", "heavily", "human", "idaho", "increase", "integration", "knowledge", "main", "master", "medical", "medications", "medicine", "mental", "methods", "model", "models", "need", "practice", "practitioners", "prescribe", "preventing", "primary", "procedures", "profession", "program", "promoting", "providing", "psychologists", "psychology", "regulated", "research", "specialty", "standard", "systems", "therapy", "trained", "training", "treatment", "university". Score: 0.3775. Entity: vertical-level.
0.3697
vertical-level
actionaffectedallowedbecomecombinationscriticaldangerousdevelopeddrugdrugselectronicemergenceharmidentificationidentifyingimplementinformationlaterlegallylimitslocalnationalopioidpeoplepossessionprogramspublicrecentreducereductionresultsrisksrolesafesinglesitessmallsmallersubstancessupplytestingthemtrendsusers
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "action", "affected", "allowed", "become", "combinations", "critical", "dangerous", "developed", "drug", "drugs", "electronic", "emergence", "harm", "identification", "identifying", "implement", "information", "later", "legally", "limits", "local", "national", "opioid", "people", "possession", "programs", "public", "recent", "reduce", "reduction", "results", "risks", "role", "safe", "single", "sites", "small", "smaller", "substances", "supply", "testing", "them", "trends", "users". Score: 0.3697. Entity: vertical-level.
0.3684
vertical-level
actapplicableaprilchildchildrencodeconcerningdevelopmentdifferentenactedenforcementexpandedfairfamiliesfamilyfederalfelonyfinancingforcefundinghousinglawlegislationmakesmembernationalorganizedpeopleprivateprogramsprotectedprotectsprovisionprovisionsrentalrightssalestatustitletodayviolencewomen
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "applicable", "april", "child", "children", "code", "concerning", "development", "different", "enacted", "enforcement", "expanded", "fair", "families", "family", "federal", "felony", "financing", "force", "funding", "housing", "law", "legislation", "makes", "member", "national", "organized", "people", "private", "programs", "protected", "protects", "provision", "provisions", "rental", "rights", "sale", "status", "title", "today", "violence", "women". Score: 0.3684. Entity: vertical-level.
0.3656
vertical-level
accountabilityaccountablebusinesscommunityentityfaithfurtherhavinghospitalsinstitutionlocalmeaningmissionnonprofitnonprofitsoperatedoperatesoperationsorganizationorganizationspersonprivateprogrampublicpurposequalifyratherresultrevenueschoolsseekssocialstatussubject
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "accountable", "business", "community", "entity", "faith", "further", "having", "hospitals", "institution", "local", "meaning", "mission", "nonprofit", "nonprofits", "operated", "operates", "operations", "organization", "organizations", "person", "private", "program", "public", "purpose", "qualify", "rather", "result", "revenue", "schools", "seeks", "social", "status", "subject". Score: 0.3656. Entity: vertical-level.
0.3617
vertical-level
abuseactaddictionbehaviorconsequencescriminalfallformerfrequentlyindividualmedicinemodelpersonrecurringrelapsesubstancetrained
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "act", "addiction", "behavior", "consequences", "criminal", "fall", "former", "frequently", "individual", "medicine", "model", "person", "recurring", "relapse", "substance", "trained". Score: 0.3617. Entity: vertical-level.
0.3590
vertical-level
costdrugexchangeharmparaphernaliaprogramprovidingreducereductionrisksocialsyringeunusedusers
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cost", "drug", "exchange", "harm", "paraphernalia", "program", "providing", "reduce", "reduction", "risk", "social", "syringe", "unused", "users". Score: 0.3590. Entity: vertical-level.
0.3556
vertical-level
adaannualblockboisecapitalcountiesemployershomeidaholocallymajormetropolitanpopulationtechnologytreasurevalley
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley". Score: 0.3556. Entity: vertical-level.
0.3529
vertical-level
adaboisecapitaldistricthomeidaholargestlocalmetropolitanpopulationprivatewashington
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "capital", "district", "home", "idaho", "largest", "local", "metropolitan", "population", "private", "washington". Score: 0.3529. Entity: vertical-level.
0.3523
vertical-level
abuseaddictionbecomesbehaviorbehavioralconsequencesdisorderdrugexpandedexperiencefinancialformframeworkidenticalidentifiedimplyindividualleadmentalmodernpersonprocessprocessesratherrelatedriskscansocialsolelysubstancesystem
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "addiction", "becomes", "behavior", "behavioral", "consequences", "disorder", "drug", "expanded", "experience", "financial", "form", "framework", "identical", "identified", "imply", "individual", "lead", "mental", "modern", "person", "process", "processes", "rather", "related", "risk", "scan", "social", "solely", "substance", "system". Score: 0.3523. Entity: vertical-level.
0.3493
vertical-level
accessactivebodyburdencapacitycollaborationcommunitycounterfeitcreatedrugdrugseducationenforcementgenerichealthcarehumanimpactincreasedincreasinglyindexinsufficientinternationalmeasuresmedicationmedicinespediatricpreventpreventionproblemproducedproductsprotectionqualityrecentreduceregulationsregulatoryrelatedreportingrequiresrightsriskssafetysoldstrategystudysubjectsupplysurveillancesystemstesting
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "active", "body", "burden", "capacity", "collaboration", "community", "counterfeit", "create", "drug", "drugs", "education", "enforcement", "generic", "healthcare", "human", "impact", "increased", "increasingly", "index", "insufficient", "international", "measures", "medication", "medicines", "pediatric", "prevent", "prevention", "problem", "produced", "products", "protection", "quality", "recent", "reduce", "regulations", "regulatory", "related", "reporting", "requires", "rights", "risks", "safety", "sold", "strategy", "study", "subject", "supply", "surveillance", "systems", "testing". Score: 0.3493. Entity: vertical-level.
0.3409
vertical-level
becomecontactsdesigneddistinctfamilyinfluenceinformationmarketingprimaryprocessreferralreferralsstrategiessubsequentunlike
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "become", "contacts", "designed", "distinct", "family", "influence", "information", "marketing", "primary", "process", "referral", "referrals", "strategies", "subsequent", "unlike". Score: 0.3409. Entity: vertical-level.
0.3307
vertical-level
activityadultsaffectedagainstalcoholalcoholismamongcentralclassifiedcontainingcontainscountrydeathdependencedistinctdivideddrinkingdrugdrugseffectsexactgroupincreasedindustryleadlegallong-termmovementnewsopportunityorganizationoverdosepointproduceproductionreducesregulationsrequirerisksalesystemtypes
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "adults", "affected", "against", "alcohol", "alcoholism", "among", "central", "classified", "containing", "contains", "country", "death", "dependence", "distinct", "divided", "drinking", "drug", "drugs", "effects", "exact", "group", "increased", "industry", "lead", "legal", "long-term", "movement", "news", "opportunity", "organization", "overdose", "point", "produce", "production", "reduces", "regulations", "require", "risk", "sale", "system", "types". Score: 0.3307. Entity: vertical-level.
0.3276
vertical-level
actadministrationagencyappointedassistedauthoritybeganconsentcontrolcurrentdepartmentdirectlydrugdrugsenforcingfederalfoodformerhhshouseholdhumanmedicalmedicationsprescriptionprimaryproductspromotingprotectingpublicregulatedregulationsrelatedreportssafetysupervisionuseswhitework
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administration", "agency", "appointed", "assisted", "authority", "began", "consent", "control", "current", "department", "directly", "drug", "drugs", "enforcing", "federal", "food", "former", "hhs", "household", "human", "medical", "medications", "prescription", "primary", "products", "promoting", "protecting", "public", "regulated", "regulations", "related", "reports", "safety", "supervision", "uses", "white", "work". Score: 0.3276. Entity: vertical-level.
0.3273
vertical-level
arisingcausedisorderdrugdrugseffectselevatedleadmedicationsopioidopioidspathwaysprescriptionrapidreducedreductiontherapywithdrawal
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "arising", "cause", "disorder", "drug", "drugs", "effects", "elevated", "lead", "medications", "opioid", "opioids", "pathways", "prescription", "rapid", "reduced", "reduction", "therapy", "withdrawal". Score: 0.3273. Entity: vertical-level.
0.3195
Heroin ↗ Q60168 KW HIGH
vertical-level
addictionadministrationamongapproximatelyaroundbehavioralbuprenorphineclinicalcontextcontrolleddrugdrugseffecteffectsfentanylformfunctionhistoryhoursincreasedinfectionslicenselong-termmedicallymedicationsmentalmethadonemixednaloxonenaltrexoneopioidopioidsoverdosepainpeoplepercentpointpossessproducedproductionrapidresultschedulessidesinglesoldsubstancesubstancestherapytreatmentusersvariablewhitewithdrawal
KEYWORD OVERLAP (high): 54 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "administration", "among", "approximately", "around", "behavioral", "buprenorphine", "clinical", "context", "controlled", "drug", "drugs", "effect", "effects", "fentanyl", "form", "function", "history", "hours", "increased", "infections", "license", "long-term", "medically", "medications", "mental", "methadone", "mixed", "naloxone", "naltrexone", "opioid", "opioids", "overdose", "pain", "people", "percent", "point", "possess", "produced", "production", "rapid", "result", "schedules", "side", "single", "sold", "substance", "substances", "therapy", "treatment", "users", "variable", "white", "withdrawal". Score: 0.3195. Entity: vertical-level.
0.3187
vertical-level
abstinenceactionsactiveaddressedadmittingalcoholalcoholismassistancebettercontinuedcontinuouscontrolcostdistinctdrinkingexperiencefoundfreegainsgoverninggrouphavinghealthcarehopeinstitutionskeeplaterliteraturemeetingmembersmenneedongoingopenorganizationsoxfordprimaryprogrampublicratesrecoveredrecoveryrequiredrestrictreviewstudiestherapytreatmentstwelvevarywomen
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abstinence", "actions", "active", "addressed", "admitting", "alcohol", "alcoholism", "assistance", "better", "continued", "continuous", "control", "cost", "distinct", "drinking", "experience", "found", "free", "gains", "governing", "group", "having", "healthcare", "hope", "institutions", "keep", "later", "literature", "meeting", "members", "men", "need", "ongoing", "open", "organizations", "oxford", "primary", "program", "public", "rates", "recovered", "recovery", "required", "restrict", "review", "studies", "therapy", "treatments", "twelve", "vary", "women". Score: 0.3187. Entity: vertical-level.
0.2973
vertical-level
acuteaddictionagealcoholbeganbenzodiazepinesconditiondegreedependencedisabilitydrugdrugsearlieremploymentindividualmedicationsopioidspatternrelapseseverestimulantswithdrawal
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acute", "addiction", "age", "alcohol", "began", "benzodiazepines", "condition", "degree", "dependence", "disability", "drug", "drugs", "earlier", "employment", "individual", "medications", "opioids", "pattern", "relapse", "severe", "stimulants", "withdrawal". Score: 0.2973. Entity: vertical-level.
0.2874
vertical-level
abuseacuteadministeradministeredadministrationaffectamongapproximatelybegancausecentraldependencedevelopeddirectlydrugeffecteffectsfamilyfoundfrequentlygenerichoursincreaseisolationlaborlistlong-termmarketingmedicationmedicinesmethodsmultipleopioidopioidsorganizationpainpotentiallyprimaryproducedpurposereducedrepeatedresponsesidesoldsourcesubstancesyringesystemwithdrawal
KEYWORD OVERLAP (high): 50 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "acute", "administer", "administered", "administration", "affect", "among", "approximately", "began", "cause", "central", "dependence", "developed", "directly", "drug", "effect", "effects", "family", "found", "frequently", "generic", "hours", "increase", "isolation", "labor", "list", "long-term", "marketing", "medication", "medicines", "methods", "multiple", "opioid", "opioids", "organization", "pain", "potentially", "primary", "produced", "purpose", "reduced", "repeated", "response", "side", "sold", "source", "substance", "syringe", "system", "withdrawal". Score: 0.2874. Entity: vertical-level.
0.2792
vertical-level
abuseacuteadministrationaffectbackbegancausecentralcompetecontrolcostdeathdependencedevelopmentdrugeffectsexpandingexposuregroupshistoricallyincreasedinternationalleadleastleaveslegallimitedlocalmarketmedicalmedicationmedicinesorganizedoverdosepossessionpotentialproducingproductionpropertiespsychiatricreducedregulatedremainsresultriseriskssmallsouthstandardstatussystemthoughviolencewesternwithdrawal
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "acute", "administration", "affect", "back", "began", "cause", "central", "compete", "control", "cost", "death", "dependence", "development", "drug", "effects", "expanding", "exposure", "groups", "historically", "increased", "international", "lead", "least", "leaves", "legal", "limited", "local", "market", "medical", "medication", "medicines", "organized", "overdose", "possession", "potential", "producing", "production", "properties", "psychiatric", "reduced", "regulated", "remains", "result", "rise", "risks", "small", "south", "standard", "status", "system", "though", "violence", "western", "withdrawal". Score: 0.2792. Entity: vertical-level.
0.2789
vertical-level
actionsactivitiesadultsaffectedaffordableapplicationcarecausechildrencostcounselingdecisionsdisabilitydisorderseducationenvironmentalevengoodhealthcarehealthyhomeidentifyimportantincreaseindexindividualindividualsinformationinjuriesleadingmeasuresmethodsorganizationoutsideparentspeoplepreventpreventionprimaryprocessesproviderqualityrecommendedrelatedrelationshipriseriskscreeningscreeningsstudytestingthemtypes
KEYWORD OVERLAP (high): 53 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actions", "activities", "adults", "affected", "affordable", "application", "care", "cause", "children", "cost", "counseling", "decisions", "disability", "disorders", "education", "environmental", "even", "good", "healthcare", "healthy", "home", "identify", "important", "increase", "index", "individual", "individuals", "information", "injuries", "leading", "measures", "methods", "organization", "outside", "parents", "people", "prevent", "prevention", "primary", "processes", "provider", "quality", "recommended", "related", "relationship", "rise", "risk", "screening", "screenings", "study", "testing", "them", "types". Score: 0.2789. Entity: vertical-level.
0.2768
vertical-level
abuseaddictionamongdependencedrugeffecteffectsequivalentfifteenformgenerichourslaterlistmedicallymedicationmedicinesnaloxonenaltrexoneopioidorganizationpainproducedproductsroughlyseveresidesoldsubstancetreatmentwithdrawal
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "addiction", "among", "dependence", "drug", "effect", "effects", "equivalent", "fifteen", "form", "generic", "hours", "later", "list", "medically", "medication", "medicines", "naloxone", "naltrexone", "opioid", "organization", "pain", "produced", "products", "roughly", "severe", "side", "sold", "substance", "treatment", "withdrawal". Score: 0.2768. Entity: vertical-level.
0.2647
vertical-level
behavioralcomplianceconditionscreditsearlyformofficersoriginatingoutsidepaperpeopleplaceprobationratherservingsupervisedsupervisionsystem
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "behavioral", "compliance", "conditions", "credits", "early", "form", "officers", "originating", "outside", "paper", "people", "place", "probation", "rather", "serving", "supervised", "supervision", "system". Score: 0.2647. Entity: vertical-level.
0.2632
vertical-level
amongapprovedclassifiedcontrolleddevelopeddrugeffectsequivalentformitselfmedicalmedicationopioidpainproductionrecommendedrequireresultseveresidesoldsubstancesupplywithdrawalwork
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "approved", "classified", "controlled", "developed", "drug", "effects", "equivalent", "form", "itself", "medical", "medication", "opioid", "pain", "production", "recommended", "require", "result", "severe", "side", "sold", "substance", "supply", "withdrawal", "work". Score: 0.2632. Entity: vertical-level.
0.2564
vertical-level
administrationaffectalcoholbenzodiazepinescasescauseconditionconditionsconsequencedependencedescribedevelopeddifferentdirecteddrugdrugsevenformgroupincreasedindividualsinfectionsjointlegallikelymedicalmedicationopioidpainpersonprescriptionratherremovedrolesubstancesubstancesthemuponvarywithdrawal
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "affect", "alcohol", "benzodiazepines", "cases", "cause", "condition", "conditions", "consequence", "dependence", "describe", "developed", "different", "directed", "drug", "drugs", "even", "form", "group", "increased", "individuals", "infections", "joint", "legal", "likely", "medical", "medication", "opioid", "pain", "person", "prescription", "rather", "removed", "role", "substance", "substances", "them", "upon", "vary", "withdrawal". Score: 0.2564. Entity: vertical-level.
0.2381
vertical-level
financialgroupmemberssupporttypes
KEYWORD OVERLAP (high): 5 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "financial", "group", "members", "support", "types". Score: 0.2381. Entity: vertical-level.
0.2350
vertical-level
abuseactiveactivityamongattentionavailabilitybelongsbeyondcentralchangesclassifiedcontinuouslycontrolleddependencedisorderdistributiondrugdrugseffectsformsfreefunctionhumanidenticalincreaseinjuryinvolvingleadliabilitylimitsoverdoseplacementpossesspossessionpotentialproducedproductionrapidreduceregulatoryrelatedreportedrestrictedsalesoldspecificstructuresubstancesubstancessystemtreatmenttypicalusersvolumewithdrawal
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "active", "activity", "among", "attention", "availability", "belongs", "beyond", "central", "changes", "classified", "continuously", "controlled", "dependence", "disorder", "distribution", "drug", "drugs", "effects", "forms", "free", "function", "human", "identical", "increase", "injury", "involving", "lead", "liability", "limits", "overdose", "placement", "possess", "possession", "potential", "produced", "production", "rapid", "reduce", "regulatory", "related", "reported", "restricted", "sale", "sold", "specific", "structure", "substance", "substances", "system", "treatment", "typical", "users", "volume", "withdrawal". Score: 0.2350. Entity: vertical-level.
0.1605
vertical-level
accepteddrugfamilyhistoryleaveslevelsoriginatingprincipalproduceproductsrecognizedsingleterms
KEYWORD OVERLAP (high): 13 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accepted", "drug", "family", "history", "leaves", "levels", "originating", "principal", "produce", "products", "recognized", "single", "terms". Score: 0.1605. Entity: vertical-level.
Provenance
Substance Use Recovery refinery-treasurevalley-v1.0.0 94,108 chars · 0 entities · 0 sections 147 articles · 147 edges 47650d0f06832b5d