—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Mental Health page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 134 edges
Information Vertical · Treasure Valley

Mental Health

0 Research Entities
134 Wikipedia Articles
134 Semantic Edges
0 Sections

Mental health in the Treasure Valley is not a single industry but a regulated regional system linking psychiatric hospitals, outpatient medical groups, independent therapists, federally qualified health centers, crisis facilities, Medicaid contractors, county courts, schools, universities, law enforcement agencies, housing providers, social-service organizations, and state licensing boards. Idaho’s Department of Health and Welfare defines behavioral health administratively as an integrated system addressing mental-health and substance-use disorders, and its Division of Behavioral Health oversees publicly financed outpatient systems and Idaho’s state psychiatric hospitals at https://healthandwelfare.idaho.gov/services-programs/behavioral-health and https://healthandwelfare.idaho.gov/about-dhw/leadership-bios-and-photos. State-funded adult mental-health treatment is delivered primarily through contracts with community providers, while regional behavioral-health offices perform court-ordered evaluations and treatment-related functions under Idaho criminal-competency, sentencing, civil-commitment, and mental-health-court statutes, as described at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-adult-behavioral-health.

The Treasure Valley’s public behavioral-health geography is divided between Region 4, centered on Ada County and Boise, and Region 3, covering Canyon County and the western counties surrounding Caldwell and Nampa. Idaho’s official crisis-resource directory identifies the Western Idaho Community Crisis Center as Region 3’s adult community crisis facility at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/behavioral-health-crisis-resources, while the center states that it serves Adams, Canyon, Gem, Payette, Owyhee, and Washington counties from 524 Cleveland Boulevard in Caldwell and provides free, walk-in crisis care continuously without an appointment at https://www.widccc.org/. Southwest District Health links its behavioral-health work directly to the center and its referral network at https://swdh.id.gov/family-and-clinic-services/behavioral-health/adult-crisis-center-services/. Ada County’s crisis infrastructure includes Clarvida’s Community Crisis and Support Center, whose Idaho operation reports statewide mental-health, counseling, foster-care, case-management, community-based, and crisis services and identifies a crisis-access line at https://www.clarvida.com/idaho/.

The Western Idaho Youth Support Center added a distinct youth-crisis layer to the western Treasure Valley system by operating continuously for children and adolescents ages five through seventeen, admitting medically stable youth for free stays of up to twenty-three hours and fifty-nine minutes while providing food, rest, recreation, assessment, and connection to further care at https://westernidahoyouthsupportcenter.org/. Idaho’s broader children’s system is Youth Empowerment Services, or YES, which the Department of Health and Welfare describes as Idaho’s children’s mental-health system of care and which is administered within the Idaho Behavioral Health Plan at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-childrens-behavioral-health. The state’s crisis continuum also includes the nationwide 988 Suicide & Crisis Lifeline, which became available in Idaho on July 16, 2022, for calls and texts involving behavioral-health crises, according to the state implementation announcement at https://healthandwelfare.idaho.gov/news/988-suicide-crisis-lifeline-now-available-anyone-having-behavioral-health-crisis.

Idaho consolidated major Medicaid and non-Medicaid behavioral-health functions under the Idaho Behavioral Health Plan, managed by Magellan Healthcare for the Department of Health and Welfare. The state’s office directory states that Magellan coordinates behavioral-health benefits for Medicaid members and other Idaho residents and supplies continuous member access and provider-support channels at https://healthandwelfare.idaho.gov/offices, while the children’s behavioral-health page explicitly identifies Magellan as manager of the YES system of care at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-childrens-behavioral-health. The Medicaid-provider framework, including plan structure and participation information, is maintained at https://healthandwelfare.idaho.gov/providers/idaho-medicaid-providers/information-medicaid-providers, and provider-facing behavioral-health standards, reimbursement resources, participation information, and substance-use-program materials are organized at https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers. The result is a financing structure in which a Treasure Valley clinic’s ability to accept Medicaid, satisfy credentialing rules, document medical necessity, and operate within covered service definitions can be as consequential as its clinical capacity.

Acute psychiatric capacity is concentrated among several major Treasure Valley institutions. Intermountain Hospital in Boise operates inpatient psychiatric treatment for adolescents, adults, and seniors, along with adult chemical-dependency treatment, partial-hospitalization services, adolescent psychiatric programming, and continuous assessment and referral functions at https://intermountainhospital.com/. Cottonwood Creek Behavioral Hospital in Meridian provides hospital-based behavioral-health treatment and structured continuing-care programs at https://oceanshealthcare.com/location/cottonwood-creek-behavioral-hospital/; the Meridian Chamber’s institutional profile describes it as a ninety-two-bed inpatient and outpatient facility serving adults and adolescents aged twelve and older at https://business.meridianchamber.org/list/member/cottonwood-creek-behavioral-hospital-1951. Cottonwood Creek opened for patients in January 2019 as a seventy-two-bed psychiatric hospital before subsequent expansion, marking a major addition to the region’s private inpatient capacity, as documented contemporaneously at https://www.ktvb.com/article/news/local/people-are-already-essentially-lining-up-new-psychiatric-hospital-opens-for-patients-on-jan-14-in-meridian/277-f3adb549-539a-4814-9b9b-0f06d352c8b5.

Saint Alphonsus and St. Luke’s connect specialty behavioral health to the Treasure Valley’s dominant general-health systems. Saint Alphonsus operates an outpatient behavioral-health location on Emerald Street in Boise at https://www.saintalphonsus.org/location/saint-alphonsus-behavioral-health-emerald. The University of Washington Boise Psychiatry Residency describes Saint Alphonsus’s behavioral-health service as including adult and child inpatient psychiatry beds, outpatient visits, psychotherapy, psychopharmacology, and addiction treatment at https://www.uwboisepsychiatryresidency.info/clinical-sites/. St. Luke’s Behavioral Health clinic on Myrtle Street provides psychiatric care for children, adolescents, adults, and families and treats conditions including depression, anxiety, attention-deficit/hyperactivity disorder, obsessive-compulsive disorder, psychosis, panic disorder, bipolar disorder, and dual diagnoses at https://stlukesonline.org/en/get-care/locations/clinics/st-lukes-clinic-behavioral-health-boise-w-myrtle-st/. These systems create cross-domain connections among emergency medicine, primary care, pediatrics, obstetrics, neurology, addiction treatment, inpatient psychiatry, pharmacy, insurance contracting, and outpatient follow-up because psychiatric conditions frequently enter the system through general medical settings rather than specialty clinics.

Terry Reilly Health Services is one of the region’s foundational safety-net operators, integrating medical, dental, and behavioral healthcare throughout the Treasure Valley at https://www.trhs.org/. Its model links mental-health treatment to primary care, economic access, preventive medicine, family services, and community-health-center financing. In April 2023, Terry Reilly launched a Certified Community Behavioral Health Clinic system at its Caldwell Behavioral Health location, establishing a federally modeled framework intended to integrate crisis response, assessment, treatment, care coordination, and access regardless of ability to pay, as recorded by the Department of Health and Welfare at https://healthandwelfare.idaho.gov/news/terry-reilly-health-services-launches-certified-community-behavioral-health-clinic-system. Central District Health also provides counseling and telehealth from its Boise clinic, explicitly directing urgent cases to Idaho’s 988 system, at https://cdh.idaho.gov/healthcare-appointments/mental-health-counseling/. These public-health and community-health-center channels are critical where mental illness overlaps with poverty, unstable insurance, chronic disease, pregnancy, communicable disease, homelessness, transportation barriers, and limited access to private psychiatric practices.

The outpatient private-practice market is fragmented across psychiatry, psychiatric nursing, counseling, psychology, clinical social work, marriage and family therapy, trauma treatment, medication management, telehealth, and specialized group practices. Meridian Advanced Psychiatry advertises evidence-based psychiatric treatment and telemedicine at https://www.map-clinic.com/. Mental Health Clinic of Idaho serves Boise and Meridian with a primary emphasis on psychiatric medication management at https://mymhci.com/. Treasure Valley Family Medicine connects psychiatric medication management with family-medicine infrastructure for patients in Meridian, Boise, and Nampa at https://www.tvfammed.com/mental-health/. Journey Mental Health reports participation in Idaho Medicaid and private insurance arrangements at https://www.journeymentalhealth.com/. Treasure Valley Mental Health provides counseling and referral support for anxiety, depression, trauma, eating disorders, grief, identity, relationships, and life transitions at https://www.treasurevalleymentalhealth.com/. Treasure Valley Therapy operates as a training clinic with licensed therapists serving trauma-recovery, court-related, relationship, sexual-behavior, and minority-stress needs at https://www.treasurevalleytherapy.com/. The Counseling Center at Tree City is an independent nonprofit offering in-person and telemental-health counseling at https://www.treecitycounselorsboise.com/. These operators illustrate the sector’s movement away from a hospital-only model toward mixed networks of prescribers, therapists, supervised trainees, integrated family practices, nonprofit clinics, and virtual-care providers.

Professional counseling and marriage and family therapy are regulated by the Idaho Licensing Board of Professional Counselors and Marriage and Family Therapists within the Division of Occupational and Professional Licenses at https://dopl.idaho.gov/cou/. The board administers applications, renewals, supervision, complaints, continuing education, license verification, registered postgraduate practice, and professional discipline. Its statutes-and-rules portal identifies Idaho Code Title 54, Chapter 34 as the governing statutory chapter and IDAPA 24.15.01 as the operative rule chapter at https://dopl.idaho.gov/cou/cou-statutes-rules-and-guidance/. The full current rule is published at https://adminrules.idaho.gov/rules/current/24/241501.pdf and governs professional counselors, clinical professional counselors, associate marriage and family therapists, marriage and family therapists, and registered interns. The rule requires qualifying graduate education and national examinations; requires one thousand supervised hours for professional-counselor qualification, including four hundred direct-client-contact hours; requires clinical professional counselors to complete two thousand direct-contact hours with specified supervision; requires marriage and family therapists to complete two thousand postgraduate client-contact hours over at least two years; and requires continuing education in ethics, professional boundaries, and suicide assessment or intervention.

Psychologists are regulated by the Idaho State Board of Psychologist Examiners at https://dopl.idaho.gov/psy/. The governing current rule, IDAPA 24.12.01, is published at https://adminrules.idaho.gov/rules/current/24/241201.pdf and implements Idaho Code sections 54-2301 through 54-2320. It requires the Examination for Professional Practice in Psychology, governs temporary practice, supervised experience, ethics, service extenders, continuing education, and standards of practice, and includes a framework for psychologists holding prescriptive authority under Idaho law. Idaho’s inclusion of prescribing psychologists creates a distinctive overlap between psychology, pharmacology, medical supervision, and psychiatric workforce policy because qualifying psychologists may perform functions that remain physician- or advanced-practice-nurse-centered in many jurisdictions.

Clinical social work is regulated by the Idaho State Board of Social Work Examiners at https://dopl.idaho.gov/swo/. IDAPA 24.14.01, published at https://adminrules.idaho.gov/rules/current/24/241401.pdf, implements Idaho Code sections 54-3201 through 54-3217 and distinguishes bachelor’s, master’s, independent, and clinical practice. The rule defines psychotherapy as a specialized clinical interaction for diagnosing and treating mental, emotional, behavioral, and addiction-related disorders; prohibits bachelor-level social workers from performing psychotherapy; permits nonclinical master’s-level social workers to provide psychotherapy only under authorized clinical supervision; and requires clinical-social-work applicants to complete three thousand hours of supervised clinical experience, including at least 1,750 direct-client-contact hours and one hundred hours of supervision. The rules permit part of the supervision to be provided by a psychologist, psychiatrist, clinical professional counselor, or marriage and family therapist, creating formal workforce edges across otherwise separate licensing professions.

Psychiatrists operate under Idaho’s medical-licensure system, while psychiatric mental-health nurse practitioners operate within nursing and advanced-practice regulation, making the mental-health workforce dependent on medical-board, nursing-board, controlled-substance, prescribing, hospital-credentialing, malpractice, and payer rules in addition to behavioral-health-specific law. Facilities receiving Medicaid reimbursement must also comply with Idaho Medicaid provider requirements at https://healthandwelfare.idaho.gov/providers/idaho-medicaid-providers/information-medicaid-providers. Facilities that provide publicly supported behavioral-health services must navigate Division of Behavioral Health standards and provider requirements at https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers. Counselors and marriage and family therapists must document informed consent, confidentiality limits, treatment methods, risks, benefits, fees, complaint rights, and supervision status under https://adminrules.idaho.gov/rules/current/24/241501.pdf, while psychologists and social workers are bound by profession-specific ethics and competence provisions under https://adminrules.idaho.gov/rules/current/24/241201.pdf and https://adminrules.idaho.gov/rules/current/24/241401.pdf.

The educational pipeline is anchored by Boise State University, Idaho State University’s Meridian campus, regional clinical placements, and the University of Washington Boise Psychiatry Residency. Boise State’s Institute for the Study of Behavioral Health and Addiction provides professional training and houses the Idaho Regional Alcohol Drug Awareness Resource Center, identified as Idaho’s specialized clearinghouse for prevention and addiction-treatment materials, at https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/. Boise State’s School of Social Work trains bachelor’s- and master’s-level practitioners, while its counselor-education infrastructure supports the licensure pipeline for professional counselors and school counselors. Boise State researcher Nathaniel Williams has led state-supported work on children’s mental-health workforce development and mental-health service implementation, including the 2017 Idaho Workforce Development Plan for Children’s Mental Health, as documented at https://www.boisestate.edu/socialwork/nate-williams/ and https://www.boisestate.edu/socialwork/wp-content/uploads/sites/74/2015/08/Nathaniel-Williams-CV-website-CV-2025.pdf. The University of Washington Boise Psychiatry Residency uses Treasure Valley clinical sites, including Saint Alphonsus behavioral-health services, to train physicians in inpatient, outpatient, addiction, child, and adult psychiatry at https://www.uwboisepsychiatryresidency.info/clinical-sites/.

Idaho State University contributes to the behavioral-health labor pipeline through health-science, counseling, nursing, psychology, pharmacy, and community-health education, including a Community Health Worker Training Academy that offers core, advanced, apprenticeship, and supervisor training at https://healthandwelfare.idaho.gov/providers/diabetes-heart-disease-stroke-prevention-program/community-health-workers. Community health workers are not substitutes for licensed clinicians, but they extend the mental-health system by helping patients navigate benefits, housing, transportation, primary care, chronic disease, language barriers, and referral networks. This role is especially relevant in the Treasure Valley’s expanding suburban fringe and western rural service area, where the effective availability of treatment depends on navigation and continuity as much as on the nominal existence of a clinic.

The Boise metropolitan labor market demonstrates substantial demand for behavioral-health personnel. The Bureau of Labor Statistics’ May 2023 Boise City metropolitan estimates reported approximately 660 substance-abuse, behavioral-disorder, and mental-health counselors with mean annual wages of $58,550; approximately 220 mental-health and substance-abuse social workers with mean annual wages of $54,530; approximately 390 child, family, and school social workers with mean annual wages of $58,750; and approximately 250 healthcare social workers with mean annual wages of $68,850 at https://www.bls.gov/oes/2023/may/oes_14260.htm. The estimates also reported a location quotient of 1.785 for substance-abuse, behavioral-disorder, and mental-health counselors, indicating that this occupation had a greater concentration in the Boise metropolitan workforce than in the national workforce. The same data carry material sampling error, including relative standard errors approaching twenty percent for some occupations, so they should be treated as labor-market estimates rather than precise practitioner counts.

Comparison with the May 2020 Boise estimates illustrates both growth and classification volatility. The 2020 table reported approximately 1,180 substance-abuse, behavioral-disorder, and mental-health counselors, 350 mental-health and substance-abuse social workers, 400 child, family, and school social workers, and 320 healthcare social workers at https://www.bls.gov/oes/2020/may/oes_14260.htm. The difference between 2020 and 2023 cannot be interpreted straightforwardly as a collapse in the workforce because Occupational Employment and Wage Statistics estimates are sample-based and may reflect employer reporting, occupational reclassification, sampling variation, and changes in establishment coverage. The defensible conclusion is that the Treasure Valley maintains a sizable specialized behavioral-health labor market but still depends on supervised trainees, telehealth, primary-care integration, imported clinicians, and cross-licensed supervision to meet demand.

The region’s rapid population expansion is a central demand driver. Boise recorded 235,685 residents in the 2020 census, while Meridian recorded 117,635 and had become Idaho’s second-largest city, with the respective demographic reference pages at https://en.wikipedia.org/wiki/Boise%2C_Idaho and https://en.wikipedia.org/wiki/Meridian%2C_Idaho. Population growth expands absolute demand for psychiatric beds, school-based counseling, autism and developmental services, maternal mental-health care, geriatric psychiatry, crisis response, substance-use treatment, and outpatient therapy. Growth also raises commercial rents, housing costs, commuting distances, and clinician recruitment costs, linking behavioral-health capacity directly to real estate, transportation, workforce compensation, childcare, and land-use planning.

Mental health intersects directly with criminal justice through competency evaluations, civil commitment, sentencing, jail diversion, specialty courts, probation, and law-enforcement crisis response. Idaho’s adult behavioral-health program performs court-ordered evaluations and treatment-related functions under Idaho Code sections governing competency, sentencing, civil commitment, and mental-health courts at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-adult-behavioral-health. The Idaho Behavioral Health Council explicitly connects access to treatment with reduced risk of criminal-justice involvement and healthier and safer communities at https://behavioralhealthcouncil.idaho.gov/. This creates operational dependencies among clinicians, designated examiners, hospitals, prosecutors, public defenders, judges, sheriffs, county detention facilities, probation offices, crisis centers, and supported-housing providers.

Mental health intersects with housing because hospitalization and crisis stabilization cannot produce durable recovery when patients are discharged into homelessness, unsafe housing, domestic violence, overcrowding, or unstable tenancy. It intersects with education because schools identify behavioral distress, employ counselors and social workers, implement individualized education programs, respond to suicide risk, and refer students into community care. It intersects with employment because employer-sponsored insurance, paid leave, disability accommodation, workers’ compensation, occupational trauma, and employee-assistance programs determine whether many adults obtain care. It intersects with technology because telehealth expands reach while requiring compliant records, secure communications, licensure analysis, reliable broadband, and careful handling of sensitive patient data. It intersects with public health because social determinants such as income, education, food access, transportation, social isolation, and neighborhood conditions shape both illness risk and treatment continuity; Boise State’s Idaho-focused social-determinants research connects clinical outcomes to community systems at https://www.boisestate.edu/sps-ipi/our-research/social-determinants-of-health-in-idaho-evidence-based-models-for-bridging-the-clinical-to-community-gap/.

Mental health also intersects with child welfare and foster care. Clarvida’s Idaho operation combines counseling, crisis services, foster care, case management, and community-based treatment at https://www.clarvida.com/idaho/, demonstrating that children with behavioral-health needs often move through multiple institutional systems simultaneously. YES links state Medicaid, family support, clinical treatment, and child-serving agencies through the system described at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-childrens-behavioral-health. The Western Idaho Youth Support Center provides an alternative to emergency departments, detention, family displacement, or immediate inpatient admission for medically stable youth in crisis at https://westernidahoyouthsupportcenter.org/. These connections make family preservation, respite, kinship care, school coordination, juvenile justice, and developmental-disability services part of the mental-health knowledge graph rather than peripheral topics.

Idaho’s mental-health governance includes the Idaho Behavioral Health Council, the Department of Health and Welfare, the Division of Behavioral Health, Idaho Medicaid, the Division of Occupational and Professional Licenses, profession-specific licensing boards, Central District Health, Southwest District Health, county courts, and local emergency-response institutions. The Idaho Behavioral Health Council’s stated mission is to coordinate a system in which adults, children, and families receive needed mental-health and addiction treatment when needed at https://behavioralhealthcouncil.idaho.gov/. DOPL’s central portal lists and administers the state’s occupational boards at https://dopl.idaho.gov/. The Counselor and Marriage and Family Therapist Board is at https://dopl.idaho.gov/cou/, the Psychologist Examiners Board is at https://dopl.idaho.gov/psy/, and the Social Work Examiners Board is at https://dopl.idaho.gov/swo/. Practitioners and researchers must distinguish regulatory authority from advocacy organizations: licensing boards determine legal permission and discipline, while organizations such as the Idaho Counseling Association, Idaho School Counselor Association, and Mental Health Providers Association of Idaho perform professional representation, education, networking, or advocacy functions identified through Boise State RADAR’s professional-resource directory at https://www.boisestate.edu/radar/resource-links-main/professionals-resource-links/.

The sector’s history reflects successive institutional layers rather than one founding event: hospital psychiatry and state mental institutions formed the older core; private psychiatric hospitals and health-system outpatient clinics expanded specialty capacity; federally qualified health centers integrated behavioral health with primary care; community crisis centers created alternatives to emergency departments and incarceration; 988 established a universal crisis-entry number in July 2022; Terry Reilly introduced the Certified Community Behavioral Health Clinic framework in Caldwell in April 2023; Magellan assumed integrated behavioral-health-plan responsibilities; and youth-specific crisis facilities extended the continuum beyond adult-centered services. Intermountain Hospital’s current institutional role is documented at https://intermountainhospital.com/, Cottonwood Creek’s 2019 opening is documented at https://www.ktvb.com/article/news/local/people-are-already-essentially-lining-up-new-psychiatric-hospital-opens-for-patients-on-jan-14-in-meridian/277-f3adb549-539a-4814-9b9b-0f06d352c8b5, Idaho’s 988 implementation is documented at https://healthandwelfare.idaho.gov/news/988-suicide-crisis-lifeline-now-available-anyone-having-behavioral-health-crisis, and the Caldwell CCBHC launch is documented at https://healthandwelfare.idaho.gov/news/terry-reilly-health-services-launches-certified-community-behavioral-health-clinic-system.

The operational bottleneck is not simply public awareness of therapy. Capacity depends on graduate-program throughput, supervised-practice placements, supervisor availability, national examinations, licensing processing, continuing education, hospital privileges, payer credentialing, reimbursement rates, documentation systems, crisis-center funding, psychiatric-bed availability, discharge housing, transportation, and the availability of prescribers. Idaho’s counseling rule requires extensive supervised experience and specific national examinations at https://adminrules.idaho.gov/rules/current/24/241501.pdf; the social-work rule requires three thousand supervised clinical hours for clinical licensure at https://adminrules.idaho.gov/rules/current/24/241401.pdf; and the psychology rule requires doctoral-level preparation, examination, and supervised practice at https://adminrules.idaho.gov/rules/current/24/241201.pdf. These safeguards protect patients, but they also mean that workforce expansion requires multi-year investment rather than rapid hiring alone.

The Treasure Valley mental-health system therefore operates as a high-dependency graph. A crisis call may connect 988 to a mobile or walk-in crisis provider; the provider may connect the patient to a hospital, Medicaid contractor, psychiatrist, therapist, pharmacy, court, school, foster-care agency, shelter, or primary-care clinic; discharge may depend on housing, transportation, family support, insurance authorization, and follow-up availability; and every licensed clinician is connected upstream to education, examination, supervision, state regulation, ethics, continuing education, and payer credentialing. The region’s strongest institutions are those that bridge these nodes rather than provide only an isolated service. That systems-level classification is necessary for a provenance-driven Treasure Valley knowledge graph because a directory that records only “therapist,” “hospital,” or “crisis center” misses the legal authority, financing mechanism, population served, referral relationships, geographic jurisdiction, workforce constraints, and infrastructure dependencies that determine what each entity can actually do.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health — Idaho Department of Health and Welfare’s principal behavioral-health portal describing the state Division of Behavioral Health and its service system.

https://healthandwelfare.idaho.gov/about-dhw/leadership-bios-and-photos — Official leadership page identifying the administrator and responsibilities of the Division of Behavioral Health.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-adult-behavioral-health — Official description of Idaho’s adult mental-health system, contracted community services, crisis work, and court-ordered functions.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-childrens-behavioral-health — Official description of Youth Empowerment Services and the children’s behavioral-health system administered through Magellan.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/behavioral-health-crisis-resources — Official statewide directory of crisis lines and adult community crisis centers, including the western Idaho facility.

https://healthandwelfare.idaho.gov/news/988-suicide-crisis-lifeline-now-available-anyone-having-behavioral-health-crisis — Official announcement documenting Idaho’s July 2022 implementation of the 988 crisis line.

https://healthandwelfare.idaho.gov/offices — Official service-location and Idaho Behavioral Health Plan contact directory.

https://healthandwelfare.idaho.gov/providers/idaho-medicaid-providers/information-medicaid-providers — Idaho Medicaid’s official provider-information and plan-structure page.

https://healthandwelfare.idaho.gov/providers/behavioral-health-providers/behavioral-health-service-providers — Official behavioral-health provider standards, reimbursement, participation, and program information.

https://behavioralhealthcouncil.idaho.gov/ — Official Idaho Behavioral Health Council site describing statewide behavioral-health coordination and policy objectives.

https://www.widccc.org/ — Western Idaho Community Crisis Center’s official site documenting its Caldwell location, regional jurisdiction, free access, and continuous operation.

https://swdh.id.gov/family-and-clinic-services/behavioral-health/adult-crisis-center-services/ — Southwest District Health’s official page connecting regional public health to adult crisis-center services.

https://westernidahoyouthsupportcenter.org/ — Official youth crisis-center site describing ages served, continuous access, eligibility, and stabilization model.

https://www.clarvida.com/idaho/ — Clarvida’s official Idaho page describing crisis, counseling, foster-care, case-management, and community behavioral-health services.

https://intermountainhospital.com/ — Intermountain Hospital’s official site describing inpatient and outpatient psychiatric and substance-use programs in Boise.

https://oceanshealthcare.com/location/cottonwood-creek-behavioral-hospital/ — Cottonwood Creek Behavioral Hospital’s official operator page describing hospital-level and structured behavioral-health treatment.

https://business.meridianchamber.org/list/member/cottonwood-creek-behavioral-hospital-1951 — Meridian Chamber profile documenting Cottonwood Creek’s inpatient and outpatient facility characteristics and bed count.

https://www.ktvb.com/article/news/local/people-are-already-essentially-lining-up-new-psychiatric-hospital-opens-for-patients-on-jan-14-in-meridian/277-f3adb549-539a-4814-9b9b-0f06d352c8b5 — Contemporary report documenting Cottonwood Creek’s January 2019 opening and initial capacity.

https://www.saintalphonsus.org/location/saint-alphonsus-behavioral-health-emerald — Official Saint Alphonsus outpatient behavioral-health location page for Boise.

https://www.uwboisepsychiatryresidency.info/clinical-sites/ — University of Washington Boise Psychiatry Residency page describing Treasure Valley psychiatric clinical sites and service capacity.

https://stlukesonline.org/en/get-care/locations/clinics/st-lukes-clinic-behavioral-health-boise-w-myrtle-st/ — Official St. Luke’s psychiatric clinic page describing populations and conditions treated.

https://www.trhs.org/ — Terry Reilly Health Services’ official site documenting integrated medical, dental, and behavioral-health care.

https://healthandwelfare.idaho.gov/news/terry-reilly-health-services-launches-certified-community-behavioral-health-clinic-system — Official state announcement documenting Terry Reilly’s Caldwell Certified Community Behavioral Health Clinic launch.

https://cdh.idaho.gov/healthcare-appointments/mental-health-counseling/ — Central District Health’s official counseling and telehealth service page.

https://www.map-clinic.com/ — Meridian Advanced Psychiatry’s official psychiatric and telemedicine service site.

https://mymhci.com/ — Mental Health Clinic of Idaho’s official Boise and Meridian psychiatric medication-management site.

https://www.tvfammed.com/mental-health/ — Treasure Valley Family Medicine’s official psychiatric medication-management page.

https://www.journeymentalhealth.com/ — Journey Mental Health’s official clinical and insurance-participation site.

https://www.treasurevalleymentalhealth.com/ — Treasure Valley Mental Health’s official counseling, specialty, and referral page.

https://www.treasurevalleytherapy.com/ — Treasure Valley Therapy’s official site describing its training-clinic and trauma-related services.

https://www.treecitycounselorsboise.com/ — Counseling Center at Tree City’s official nonprofit counseling and telehealth site.

https://dopl.idaho.gov/ — Idaho Division of Occupational and Professional Licenses’ official portal.

https://dopl.idaho.gov/cou/ — Official Idaho Board of Professional Counselors and Marriage and Family Therapists page.

https://dopl.idaho.gov/cou/cou-statutes-rules-and-guidance/ — Official statutes, rules, ethics, and guidance page for counselors and marriage and family therapists.

https://adminrules.idaho.gov/rules/current/24/241501.pdf — Current IDAPA 24.15.01 governing counselor and marriage and family therapist qualifications, examinations, supervision, ethics, continuing education, and practice.

https://dopl.idaho.gov/psy/ — Official Idaho State Board of Psychologist Examiners page.

https://adminrules.idaho.gov/rules/current/24/241201.pdf — Current IDAPA 24.12.01 governing psychology licensure, ethics, supervised practice, temporary practice, and prescriptive authority.

https://dopl.idaho.gov/swo/ — Official Idaho State Board of Social Work Examiners page.

https://adminrules.idaho.gov/rules/current/24/241401.pdf — Current IDAPA 24.14.01 governing social-work licensing, clinical supervision, psychotherapy scope, ethics, and continuing education.

https://www.boisestate.edu/healthsciences-instituteforthestudyofaddiction/ — Boise State’s Institute for the Study of Behavioral Health and Addiction and its statewide training and resource functions.

https://www.boisestate.edu/socialwork/nate-williams/ — Boise State faculty profile documenting Idaho children’s mental-health workforce and implementation research.

https://www.boisestate.edu/socialwork/wp-content/uploads/sites/74/2015/08/Nathaniel-Williams-CV-website-CV-2025.pdf — Academic curriculum vitae documenting Idaho-funded children’s mental-health workforce research and Treasure Valley clinical experience.

https://www.boisestate.edu/radar/resource-links-main/professionals-resource-links/ — Boise State RADAR directory identifying Idaho behavioral-health and school-counseling professional organizations.

https://www.boisestate.edu/sps-ipi/our-research/social-determinants-of-health-in-idaho-evidence-based-models-for-bridging-the-clinical-to-community-gap/ — Idaho-focused research connecting health outcomes to education, community, economic, and social-service systems.

https://healthandwelfare.idaho.gov/providers/diabetes-heart-disease-stroke-prevention-program/community-health-workers — Official description of Idaho State University’s community-health-worker training, advanced training, apprenticeship, and supervision programs.

https://www.bls.gov/oes/2023/may/oes_14260.htm — Bureau of Labor Statistics May 2023 Boise metropolitan occupational employment and wage estimates.

https://www.bls.gov/oes/2020/may/oes_14260.htm — Bureau of Labor Statistics May 2020 Boise metropolitan occupational employment and wage estimates.

https://en.wikipedia.org/wiki/Boise%2C_Idaho — Geographic and census reference for Boise’s 2020 population and regional role.

https://en.wikipedia.org/wiki/Meridian%2C_Idaho — Geographic and census reference for Meridian’s 2020 population, ranking, and growth context.

Smaller Treasure Valley operators reveal a market organized by specialty, payer mix, age group, treatment intensity, and professional license rather than by a simple division between hospitals and therapists. Full Circle Health embeds behavioral health inside a federally qualified primary-care structure and lists treatment for addictive behaviors, attention-deficit/hyperactivity disorder, anxiety, depression, dissociative disorders, grief, youth concerns, relationship conflict, pregnancy and postpartum conditions, suicidal ideation, trauma, and post-traumatic stress disorder at https://www.fullcircleidaho.org/behavioral-health/. That breadth means a patient can enter through family medicine and receive behavioral-health assessment without first identifying a stand-alone psychiatric practice, strengthening the clinical edge between primary care, reproductive health, pediatrics, chronic-disease management, and psychotherapy.

MidValley Healthcare operates a private behavioral-health clinic serving Boise and Meridian patients with mental-health and co-occurring-disorder services at https://midvalleyhealthcare.com/our-program. Its explicit treatment of co-occurring conditions places it between conventional psychotherapy and higher-acuity addiction or psychiatric care, where reimbursement, diagnosis, medication management, relapse prevention, and family support often must be coordinated rather than purchased as isolated services.

Treasure Valley Psychology identifies itself as a private psychology practice delivering services throughout Idaho at https://www.tvpsychology.com/, while Boise Counseling Center identifies licensed-counselor specialties in trauma recovery, anxiety, depression, identity exploration, and relationship change at https://boisecounselingctr.com/. Alturas Counseling serves individuals, couples, and families in Boise and the surrounding Treasure Valley and accepts private payment, commercial insurance, and Medicaid at https://alturascounseling.com/. Those three models occupy different positions in the market graph: doctoral psychology practice, licensed counseling group, and Medicaid-participating community outpatient provider. The distinction affects which assessments may be offered, which payer panels can be accessed, how supervision is structured, and whether the provider can absorb lower-reimbursement or higher-administrative-burden cases.

Treasure Wellness publishes a provider roster identifying licensed counselors and stated specialties including anxiety, depression, trauma, grief, anger, stress, life transitions, Christian counseling, and codependence at https://treasurewellness.com/licensed-counselors. Morgan Mental Health Care markets substance-use treatment, couples counseling, medication evaluation, and broader mental-health services to Meridian, Boise, the Treasure Valley, and southern Idaho at https://morganmentalhealth.com/contact/. These firms demonstrate that consumer-facing categories such as faith-informed counseling, medication evaluation, grief work, couples care, and substance-use treatment create niche demand pools even when all providers are broadly classified under “mental health.”

The Idaho State University Meridian Counseling Clinic functions simultaneously as a low-cost operator and a workforce-production site by providing individual, couple, family, and telecounseling services through counselors in training at https://www.isu.edu/clinics/counseling-meridian/. This dual role directly connects higher education to clinical capacity: each supervised appointment produces both community access and required experiential training, so shortages of practicum sites and qualified supervisors constrain both present treatment availability and the future licensed workforce.

Idaho State University’s clinical mental-health counseling curriculum is designed around the knowledge and skills needed to treat varied clinical circumstances and incorporates CACREP common-core and specialty requirements at https://www.isu.edu/counseling/programs/masters-program/clinical-mental-health-counseling/. The department’s broader master’s program includes clinical mental-health counseling, marriage, couple and family counseling, clinical rehabilitation counseling, and school counseling, with an objective that graduates obtain the applicable professional license or certification at https://www.isu.edu/counseling/programs/masters-program/. This creates separate but intersecting pipelines into private therapy, rehabilitation systems, schools, hospitals, community agencies, disability services, and family treatment rather than one interchangeable counselor labor pool.

Idaho State University also offers an athlete-counseling certificate that combines clinical mental-health approaches with sport-psychology strategies for resilience, pressure management, and healthy return to competition at https://www.isu.edu/counseling/programs/athlete-counseling-certificate/. That specialization creates a direct graph edge between mental health and the Treasure Valley’s school, collegiate-athletics, recreation, sports-medicine, physical-therapy, and coaching sectors because athletic performance concerns can mask or intensify anxiety, depression, trauma, eating disorders, injury-related distress, and identity disruption.

Boise State University’s counselor-education department offers a sixty-credit Master of Arts in Counseling designed to prepare licensed professional counselors, with school-counseling and addiction-counseling pathways, at https://www.boisestate.edu/healthsciences-counselored/. Its addiction-counseling curriculum addresses assessment, treatment, relapse prevention, prevention models, and intervention for individuals and families affected by addictive behavior at https://www.boisestate.edu/healthsciences-counselored/ma-counseling-addiction/. Boise State reports that the program requires at least a one-hundred-hour supervised practicum and a seven-hundred-hour internship in a clinical setting at https://www.boisestate.edu/provost-licensure/master-of-arts-in-counseling-addiction-counseling-cognate/. The implication is structural: a Treasure Valley employer that supplies internship placements and approved supervision is not merely hiring trainees but controlling a necessary gateway through which future counselors must pass.

Boise State’s school-counseling pathway is a CACREP-accredited minimum sixty-semester-hour program with competitive placement at https://www.boisestate.edu/healthsciences-counselored/ma-counseling-school/. Boise State Counseling Services itself employs licensed counselors, social workers, psychologists, supervised trainees, and postgraduate interns while emphasizing prevention, early detection, brief counseling, consultation, evaluation, teaching, and training at https://www.boisestate.edu/healthservices/counseling/. The university therefore acts as an educator, training site, employer, prevention provider, and referral node, linking the mental-health vertical to higher-education retention, disability accommodation, campus safety, student housing, academic performance, and crisis response.

Idaho’s involuntary-treatment framework remains a defining practice-area rule because it determines who can initiate proceedings, when liberty may be restricted, and which facilities must receive or evaluate a patient. Idaho Code section 66-329 permits involuntary-care proceedings to begin through a written application filed by specified relatives, guardians, medical professionals, prosecutors, public officials, or facility directors at https://law.justia.com/codes/idaho/title-66/chapter-3/section-66-329/. Idaho Code section 66-326 permits emergency custody or hospital detention when authorized personnel reasonably believe a person is gravely disabled because of mental illness or presents imminent danger, while prohibiting detention in a nonmedical penal unit, as reproduced with statutory attribution at https://www.tac.org/map_directory/idaho/. The legal distinction between emergency detention and longer-term judicial commitment shapes hospital admission protocols, law-enforcement transport, designated-examiner work, judicial calendars, civil-rights representation, and discharge planning.

Idaho Code Title 66, Chapter 3 organizes hospitalization law for people with mental illness, including definitions, emergency procedures, examination, commitment, treatment, transfer, release, and related judicial processes at https://law.justia.com/codes/idaho/title-66/chapter-3/. The statutory definition of an inpatient treatment facility includes a facility in which a person receives medical and mental treatment for a continuous period of at least twenty-four hours at https://codes.findlaw.com/id/title-66-state-charitable-institutions/id-st-sect-66-317/. That threshold separates inpatient institutions from crisis centers, partial-hospitalization programs, intensive outpatient programs, and ordinary offices, with consequences for licensure, building design, staffing, reimbursement, patient rights, and emergency-transfer obligations.

A newer Idaho crisis-hold statute effective October 1, 2024, created temporary hospital detention authority for certain persons experiencing acute crisis related to a neurocognitive disorder and an unidentified underlying medical condition, as analyzed with citation to Idaho Code section 56-2101 at https://hhhealthlawblog.com/idahos-new-crisis-hold-law/. This fills a practice gap between psychiatric commitment law and medical incapacity: delirium, dementia, intoxication, metabolic disturbance, neurological illness, and other medical causes can produce dangerous behavior without satisfying a conventional mental-illness commitment theory. Hospitals must therefore distinguish psychiatric detention from medically driven neurocognitive crisis rather than treating all behavioral disturbance as one legal category.

Municipal land-use systems determine whether a provider can translate a state license into a physical practice location. Meridian’s records show that the city issued a certificate of zoning compliance for the Meridian Counseling and Wellness Center at 934 East Bower Street in 2006 at https://weblink.meridiancity.org/WebLink/DocView.aspx?dbid=0&id=62739&repo=MeridianCity. A later Meridian land-use record classifies offices of mental-health practitioners within healthcare and social-service uses under NAICS Code 62 at https://weblink.meridiancity.org/WebLink/DocView.aspx?dbid=0&id=386429&repo=MeridianCity. These records show how local zoning converts a clinical business into a land-use category governing site approval, parking, occupancy, compatibility, signage, and neighborhood placement. A practitioner can satisfy state licensing requirements yet remain unable to operate at a chosen address without municipal land-use compliance.

Meridian’s consolidated housing plan records municipal participation in a Continuum of Care containing housing authorities, health officials, mental-health providers, law enforcement, and corrections agencies; it states that coordinated entry serves Ada County and that case conferencing occurs weekly at https://meridiancity.org/media/w4jjellq/py22-action-plan-submitted.pdf. The same plan connects homelessness prevention to people discharged from mental-health facilities, foster care, healthcare institutions, and correctional programs. This makes housing an operating component of the behavioral-health system rather than merely a social determinant: discharge success depends on a receiving address, rental stability, transportation, benefits, and coordinated case management.

Meridian’s later action-plan documentation states that Idaho Youth Ranch provides outpatient care, counseling centers, mental telehealth, equine-assisted psychotherapy, adoption services, and residential shelters in the Treasure Valley at https://meridiancity.org/media/ok1hnlht/py24-action-plan-final.pdf. The operator therefore sits at the intersection of youth mental health, child welfare, adoption, residential care, homelessness prevention, animal-assisted treatment, and family services, illustrating how youth providers frequently span systems that are separately regulated and financed.

The Idaho Behavioral Health Council’s statewide Sequential Intercept Model report documents Canyon County workshops held March 14–15, 2022, and Ada and Boise County workshops held January 31–February 1, 2023, at https://behavioralhealthcouncil.idaho.gov/wp-content/uploads/2024/03/IBHC-Statewide-SIM-Report-March-2024.pdf. The report defines the relevant network as community services, crisis response, law enforcement, emergency medicine, initial detention, courts, jails, reentry, probation, parole, housing, and transportation. The implication is direct: a Treasure Valley mental-health directory that omits courts, sheriffs, emergency medical services, public defenders, prosecutors, jails, probation agencies, and housing providers cannot represent the actual pathway followed by many high-acuity patients.

Idaho’s school-suicide-prevention system has become a procurement and educational-technology market as well as a clinical-policy field. The Idaho Department of Education reports that the 2024 Legislature appropriated $350,000 for expanded K–12 suicide prevention through text-messaging services and that a competitive procurement awarded SchoolPulse a $340,000 contract in August 2024 at https://www.sde.idaho.gov/wp-content/uploads/2026/01/33-136-Suicide-Prevention-FY25.pdf. The program provides supports for students in grades six through twelve and requires parental opt-in under Idaho Code section 32-1010. This creates a cross-vertical edge among mental health, public procurement, education technology, parental-consent law, school administration, student privacy, and data analytics.

Idaho recorded 437 suicide deaths in 2024, with a state suicide rate reported as 1.6 times the national rate, at https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-suicide-prevention. This statewide burden increases operational demand on Treasure Valley emergency departments, crisis centers, schools, primary-care clinics, firearm-safety initiatives, veterans’ services, coroners, medical examiners, bereavement providers, and public-health surveillance. The measure also cautions against evaluating the regional market only through provider counts, because need can rise faster than licensed capacity or manifest first in institutions outside formal psychiatric care.

The Youth Empowerment Services quality-management system publishes information about children and families receiving mental-health care primarily through Medicaid, the Idaho Behavioral Health Plan, the Division of Behavioral Health, and associated inpatient and outpatient networks at https://yes.idaho.gov/yes-quality-management-improvement-and-accountability/. These reports are critical operator-level evidence because they shift analysis from the existence of programs to utilization, access, quality, accountability, and outcomes inside the publicly financed children’s system.

Idaho’s 2024 Maternal Mortality Review report is issued by the Board of Medicine under Idaho Code section 54-1806(12) and identifies the committee as independent from Board disciplinary proceedings at https://dopl.idaho.gov/wp-content/uploads/2026/04/MMR-Report-2024.pdf. Maternal mortality review belongs in the mental-health graph because pregnancy and postpartum periods can involve depression, anxiety, psychosis, substance use, intimate-partner violence, medication changes, and suicide risk, while obstetric clinics and hospitals frequently become the first detection points. The governing structure also distinguishes quality review from professional discipline, allowing system failures to be studied without automatically converting every finding into a licensing case.

Private consolidation is visible in the region’s psychiatric-hospital market. Cottonwood Creek was developed and originally owned by Haven Behavioral Healthcare, as documented by the project record at https://www.andersen-const.com/portfolio/project/cottonwood-creek-behavioral-hospital. Oceans Healthcare announced on January 2, 2025, that it acquired all outstanding shares of Haven Behavioral Healthcare, adding seven behavioral hospitals and entering Idaho and four other states, at https://www.prnewswire.com/news-releases/oceans-healthcare-acquires-haven-behavioral-healthcare-inc-302341420.html. Cottonwood Creek’s current local market position is therefore part of a multistate acquisition rather than an isolated Meridian hospital. Ownership consolidation can centralize capital, compliance, procurement, branding, staffing systems, payer negotiation, and clinical protocols while moving strategic control outside the Treasure Valley.

Intermountain Hospital is part of Universal Health Services’ national hospital structure. Universal Health Services’ 2025 annual report describes the corporation as a holding company operating healthcare and management businesses through subsidiaries at https://www.sec.gov/Archives/edgar/data/352915/000119312526148816/uhs_123125_ars.pdf, while an institutional hospital profile identifies Intermountain as a proprietary Boise hospital affiliated with Universal Health Services at https://payerprice.com/hospitals/intermountain-hospital-134002. The Treasure Valley’s major inpatient psychiatric capacity is therefore substantially influenced by national corporate operators, making Securities and Exchange Commission filings, corporate debt, investor strategy, labor policy, payer contracting, and national expansion relevant to local service analysis.

Cottonwood Creek Wellness Center provides intensive outpatient behavioral-health services for adolescents aged twelve and older and adults who need more structure than conventional weekly therapy at https://www.cottonwoodcreekwc.com/. Its place in the same local brand ecosystem as the hospital demonstrates a vertically connected care ladder from inpatient treatment to structured outpatient care. Such ladders can improve continuity, but they also concentrate referrals and follow-up inside an ownership network, affecting independent therapists and competing outpatient programs.

Consumer discovery is heavily mediated by commercial directories rather than government registries alone. Psychology Today maintains a Boise therapist directory at https://www.psychologytoday.com/us/therapists/id/boise and a Boise psychiatric directory filtered for eating-disorder care at https://www.psychologytoday.com/us/psychiatrists/id/boise?category=eating-disorders. GoodTherapy maintains a Boise therapist directory organized around provider profiles and treatment approaches at https://www.goodtherapy.org/therapists/id/boise. These platforms influence which providers appear visible, which specialties consumers recognize, and how clinicians describe themselves. Their prominence means profile completeness, subscription status, location targeting, reviews, photographs, insurance labels, telehealth claims, and specialty keywords can shape demand independently of clinical quality or official licensure standing.

The official licensing system and commercial discovery system serve different truth functions. State boards establish whether a practitioner is legally authorized and whether discipline has occurred, while commercial directories organize self-presented specialties and consumer search. A rigorous knowledge graph should never treat a paid profile as proof of licensure or a license record as proof that a clinician accepts new patients, treats a stated condition, participates in a given insurance network, or maintains a particular office. The divergence between legal status and market availability is one of the central classification problems in this vertical.

https://www.fullcircleidaho.org/behavioral-health/ — Full Circle Health’s behavioral-health service page describing integrated primary-care and counseling specialties.

https://midvalleyhealthcare.com/our-program — MidValley Healthcare’s official description of mental-health and co-occurring-disorder services.

https://www.tvpsychology.com/ — Treasure Valley Psychology’s official operator page for private psychological services.

https://boisecounselingctr.com/ — Boise Counseling Center’s official page describing licensed counseling specialties.

https://alturascounseling.com/ — Alturas Counseling’s official page describing family, couple, individual, Medicaid, insurance, and private-pay services.

https://www.isu.edu/clinics/counseling-meridian/ — Idaho State University Meridian’s low-cost community counseling and counselor-training clinic page.

https://www.isu.edu/counseling/programs/masters-program/clinical-mental-health-counseling/ — Idaho State University’s clinical mental-health counseling curriculum page.

https://www.isu.edu/counseling/programs/masters-program/ — Idaho State University’s master’s counseling pathways and licensure objectives.

https://www.isu.edu/counseling/programs/athlete-counseling-certificate/ — Idaho State University’s athlete-counseling certificate and sport-mental-health scope.

https://www.boisestate.edu/healthsciences-counselored/ — Boise State University’s counselor-education degree overview.

https://www.boisestate.edu/healthsciences-counselored/ma-counseling-addiction/ — Boise State University’s addiction-counseling curriculum page.

https://www.boisestate.edu/provost-licensure/master-of-arts-in-counseling-addiction-counseling-cognate/ — Boise State University’s practicum, internship, accreditation, and professional-licensure disclosure.

https://www.boisestate.edu/healthsciences-counselored/ma-counseling-school/ — Boise State University’s CACREP-accredited school-counseling program description.

https://www.boisestate.edu/healthservices/counseling/ — Boise State Counseling Services’ prevention, treatment, training, and staffing page.

https://law.justia.com/codes/idaho/title-66/chapter-3/section-66-329/ — Idaho Code section governing initiation of involuntary commitment proceedings.

https://www.tac.org/map_directory/idaho/ — Idaho emergency-evaluation and commitment-law summary quoting Idaho Code section 66-326.

https://law.justia.com/codes/idaho/title-66/chapter-3/ — Consolidated text and index for Idaho’s hospitalization-of-mentally-ill statutes.

https://codes.findlaw.com/id/title-66-state-charitable-institutions/id-st-sect-66-317/ — Idaho statutory definitions applicable to mental-health hospitalization, including inpatient treatment facilities.

https://hhhealthlawblog.com/idahos-new-crisis-hold-law/ — Legal analysis of Idaho’s 2024 neurocognitive crisis-hold statute.

https://weblink.meridiancity.org/WebLink/DocView.aspx?dbid=0&id=62739&repo=MeridianCity — Meridian zoning-compliance record for a counseling and wellness center.

https://weblink.meridiancity.org/WebLink/DocView.aspx?dbid=0&id=386429&repo=MeridianCity — Meridian land-use record classifying mental-health practitioners within healthcare and social-service uses.

https://meridiancity.org/media/w4jjellq/py22-action-plan-submitted.pdf — Meridian housing plan connecting behavioral health, institutional discharge, homelessness prevention, coordinated entry, and case conferencing.

https://meridiancity.org/media/ok1hnlht/py24-action-plan-final.pdf — Meridian action plan describing Idaho Youth Ranch behavioral-health, telehealth, residential, adoption, and equine-assisted services.

https://behavioralhealthcouncil.idaho.gov/wp-content/uploads/2024/03/IBHC-Statewide-SIM-Report-March-2024.pdf — Idaho Sequential Intercept Model report documenting Ada, Boise, and Canyon County behavioral-health and criminal-justice mapping.

https://www.sde.idaho.gov/wp-content/uploads/2026/01/33-136-Suicide-Prevention-FY25.pdf — Idaho Department of Education report on school suicide-prevention procurement, funding, consent, and program delivery.

https://healthandwelfare.idaho.gov/services-programs/behavioral-health/about-suicide-prevention — Idaho suicide-prevention page reporting 2024 statewide mortality statistics.

https://yes.idaho.gov/yes-quality-management-improvement-and-accountability/ — Youth Empowerment Services quality, utilization, and accountability reporting portal.

https://dopl.idaho.gov/wp-content/uploads/2026/04/MMR-Report-2024.pdf — Idaho Board of Medicine’s 2024 Maternal Mortality Review report.

https://www.andersen-const.com/portfolio/project/cottonwood-creek-behavioral-hospital — Construction and ownership record identifying Haven Behavioral Healthcare as Cottonwood Creek’s original owner.

https://www.prnewswire.com/news-releases/oceans-healthcare-acquires-haven-behavioral-healthcare-inc-302341420.html — Acquisition announcement documenting Oceans Healthcare’s purchase of Haven Behavioral Healthcare.

https://www.sec.gov/Archives/edgar/data/352915/000119312526148816/uhs_123125_ars.pdf — Universal Health Services’ 2025 SEC-filed annual report describing its subsidiary-based corporate structure.

https://payerprice.com/hospitals/intermountain-hospital-134002 — Institutional profile identifying Intermountain Hospital as a proprietary Boise facility affiliated with Universal Health Services.

https://www.cottonwoodcreekwc.com/ — Cottonwood Creek Wellness Center’s intensive outpatient behavioral-health service page.

https://www.psychologytoday.com/us/therapists/id/boise — Psychology Today’s consumer-facing Boise therapist directory.

https://www.psychologytoday.com/us/psychiatrists/id/boise?category=eating-disorders — Psychology Today’s Boise psychiatric-provider directory filtered for eating-disorder treatment.

https://www.goodtherapy.org/therapists/id/boise — GoodTherapy’s consumer-facing Boise therapist directory.

https://treasurewellness.com/licensed-counselors — Treasure Wellness’s licensed-counselor roster and specialty descriptions.

https://morganmentalhealth.com/contact/ — Morgan Mental Health Care’s Treasure Valley service and contact page.


SEMANTIC EDGE LEDGER · MENTAL_HEALTH · refinery-treasurevalley-v1.0.0
65 🌲 EVERGREEN · 69 🌿 BRANCH · 0 🫐 BERRY · 0 🌱 SEED
65 🌲 EVERGREEN
69 🌿 BRANCH
0 🫐 BERRY
0 🌱 SEED
Articles raw: 136 · Deduped: 134 · Entities: 0 · Sections: 0 · Noise filtered: 3 · Dropped noise: 0 · Dropped dupes: 2
KW HIGH 69 EXACT TITLE 65
◈ 🌲 EVERGREEN 65 EDGES
1.00
vertical-level
mental health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mental health". Entity: vertical-level.
1.00
vertical-level
bipolar disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "bipolar disorder". Entity: vertical-level.
1.00
vertical-level
boise metropolitan
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise metropolitan". Entity: vertical-level.
1.00
vertical-level
boise state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise state university". Entity: vertical-level.
1.00
vertical-level
case management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "case management". Entity: vertical-level.
1.00
vertical-level
certified community behavioral health clinic
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "certified community behavioral health clinic". Entity: vertical-level.
1.00
vertical-level
involuntary commitment
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "involuntary commitment". Entity: vertical-level.
1.00
vertical-level
clinical social work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "clinical social work". Entity: vertical-level.
1.00
vertical-level
clinical supervision
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "clinical supervision". Entity: vertical-level.
1.00
vertical-level
community health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community health". Entity: vertical-level.
1.00
vertical-level
community health worker
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community health worker". Entity: vertical-level.
1.00
vertical-level
confidentiality
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "confidentiality". Entity: vertical-level.
1.00
vertical-level
continuing education
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "continuing education". Entity: vertical-level.
1.00
vertical-level
criminal justice
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "criminal justice". Entity: vertical-level.
1.00
Delirium ↗ Q160796 EXACT TITLE
vertical-level
delirium
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "delirium". Entity: vertical-level.
1.00
Dementia ↗ Q83030 EXACT TITLE
vertical-level
dementia
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "dementia". Entity: vertical-level.
1.00
Disability ↗ Q12131 EXACT TITLE
vertical-level
disability
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "disability". Entity: vertical-level.
1.00
vertical-level
dissociative disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "dissociative disorder". Entity: vertical-level.
1.00
vertical-level
eating disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "eating disorder". Entity: vertical-level.
1.00
vertical-level
emergency department
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency department". Entity: vertical-level.
1.00
vertical-level
emergency medical
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency medical". Entity: vertical-level.
1.00
vertical-level
family therapy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "family therapy". Entity: vertical-level.
1.00
vertical-level
federally qualified health center
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "federally qualified health center". Entity: vertical-level.
1.00
vertical-level
foster care
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "foster care". Entity: vertical-level.
1.00
Grief ↗ Q1026040 EXACT TITLE
vertical-level
grief
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "grief". Entity: vertical-level.
1.00
vertical-level
healthcare in
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "healthcare in". Entity: vertical-level.
1.00
vertical-level
health care
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "health care". Entity: vertical-level.
1.00
vertical-level
homelessness
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "homelessness". Entity: vertical-level.
1.00
vertical-level
idaho department of health and welfare
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho department of health and welfare". Entity: vertical-level.
1.00
vertical-level
idaho state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho state university". Entity: vertical-level.
1.00
vertical-level
idaho youth ranch
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho youth ranch". Entity: vertical-level.
1.00
Idaho ↗ Q1221 EXACT TITLE
vertical-level
idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho". Entity: vertical-level.
1.00
vertical-level
informed consent
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "informed consent". Entity: vertical-level.
1.00
vertical-level
intensive outpatient program
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "intensive outpatient program". Entity: vertical-level.
1.00
vertical-level
law enforcement
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "law enforcement". Entity: vertical-level.
1.00
vertical-level
licensed professional counselor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "licensed professional counselor". Entity: vertical-level.
1.00
vertical-level
magellan health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "magellan health". Entity: vertical-level.
1.00
Medicaid ↗ Q1141363 EXACT TITLE
vertical-level
medicaid
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "medicaid". Entity: vertical-level.
1.00
vertical-level
mental health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mental health". Entity: vertical-level.
1.00
vertical-level
mental health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mental health". Entity: vertical-level.
1.00
vertical-level
neurocognitive disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "neurocognitive disorder". Entity: vertical-level.
1.00
vertical-level
occupational employment and wage statistics
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "occupational employment and wage statistics". Entity: vertical-level.
1.00
Parole ↗ Q5357120 EXACT TITLE
vertical-level
parole
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "parole". Entity: vertical-level.
1.00
vertical-level
post-traumatic stress disorder
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "post-traumatic stress disorder". Entity: vertical-level.
1.00
vertical-level
primary care
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "primary care". Entity: vertical-level.
1.00
Probation ↗ Q13961 EXACT TITLE
vertical-level
probation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "probation". Entity: vertical-level.
1.00
vertical-level
psychiatric hospital
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychiatric hospital". Entity: vertical-level.
1.00
vertical-level
mental health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mental health". Entity: vertical-level.
1.00
vertical-level
psychiatrist
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychiatrist". Entity: vertical-level.
1.00
vertical-level
psychologist
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychologist". Entity: vertical-level.
1.00
vertical-level
psychology today
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychology today". Entity: vertical-level.
1.00
vertical-level
psychopharmacology
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychopharmacology". Entity: vertical-level.
1.00
Psychosis ↗ Q170082 EXACT TITLE
vertical-level
psychosis
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychosis". Entity: vertical-level.
1.00
vertical-level
psychotherapy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "psychotherapy". Entity: vertical-level.
1.00
vertical-level
public health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "public health". Entity: vertical-level.
1.00
vertical-level
relapse prevention
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "relapse prevention". Entity: vertical-level.
1.00
vertical-level
residency
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "residency". Entity: vertical-level.
1.00
vertical-level
school counselor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "school counselor". Entity: vertical-level.
1.00
Social work ↗ Q205398 EXACT TITLE
vertical-level
social work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "social work". Entity: vertical-level.
1.00
vertical-level
substance use
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "substance use". Entity: vertical-level.
1.00
vertical-level
suicidal ideation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "suicidal ideation". Entity: vertical-level.
1.00
vertical-level
suicide prevention
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "suicide prevention". Entity: vertical-level.
1.00
Telehealth ↗ Q46994 EXACT TITLE
vertical-level
telehealth
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "telehealth". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
1.00
vertical-level
universal health services
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "universal health services". Entity: vertical-level.
◈ 🌿 BRANCH 69 EDGES
0.6800
vertical-level
advocacyassociationcontinuingeducationgeneralguidanceinformationinsurancemalpracticemembersnationalobtainprofessionalresearchresourcessocialworkers
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advocacy", "association", "continuing", "education", "general", "guidance", "information", "insurance", "malpractice", "members", "national", "obtain", "professional", "research", "resources", "social", "workers". Score: 0.6800. Entity: vertical-level.
0.6667
vertical-level
accreditationcacrepcouncilcounselingeducationeducationalhigherprogramsrelateduniversities
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accreditation", "cacrep", "council", "counseling", "education", "educational", "higher", "programs", "related", "universities". Score: 0.6667. Entity: vertical-level.
0.6429
vertical-level
adaamongboisecapitalcensusidahomakingmeridianpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "census", "idaho", "making", "meridian", "population". Score: 0.6429. Entity: vertical-level.
0.6364
vertical-level
adaadamsboisecanyoncountiesgemidahometropolitanowyheepayetteregiontreasurevalleywashington
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "adams", "boise", "canyon", "counties", "gem", "idaho", "metropolitan", "owyhee", "payette", "region", "treasure", "valley", "washington". Score: 0.6364. Entity: vertical-level.
0.6000
vertical-level
boisecaldwellcanyoncensusidahomakingmetropolitannampapopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "caldwell", "canyon", "census", "idaho", "making", "metropolitan", "nampa", "population". Score: 0.6000. Entity: vertical-level.
0.5753
vertical-level
academicadolescentsanalysisassessmentbehaviorbehavioralbenefitscarrychildrencodescombinescommunityconsultationcounselingcreatecreatingdevelopmentaldifferenteducationalemotionalfamiliesfieldfullinterventionlegalmeetmembersneedspreventionprofessionalspsychologicalpsychologistpsychologistspsychologyreachschoolskillssocialstudentstudentssupportwork
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "adolescents", "analysis", "assessment", "behavior", "behavioral", "benefits", "carry", "children", "codes", "combines", "community", "consultation", "counseling", "create", "creating", "developmental", "different", "educational", "emotional", "families", "field", "full", "intervention", "legal", "meet", "members", "needs", "prevention", "professionals", "psychological", "psychologist", "psychologists", "psychology", "reach", "school", "skills", "social", "student", "students", "support", "work". Score: 0.5753. Entity: vertical-level.
0.5556
vertical-level
administrationdepartmentdescribedescribeseducationemergencyenforcementgoverninghealthcarejurisdictionlawlicenselicensinglimitsmedicalnationalpracticepractitionerpractitionersprofessionalrequirementssafetyscopetrainingtransportation
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "department", "describe", "describes", "education", "emergency", "enforcement", "governing", "healthcare", "jurisdiction", "law", "license", "licensing", "limits", "medical", "national", "practice", "practitioner", "practitioners", "professional", "requirements", "safety", "scope", "training", "transportation". Score: 0.5556. Entity: vertical-level.
0.5532
vertical-level
additioncallcallscarecentercenterscodecounselingcounselorscrisisemergencyimmediatejulylaunchedlifelinelinelocalnationalnetworkoperationpreventionprovidereferralsuicidesupportswritten
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addition", "call", "calls", "care", "center", "centers", "code", "counseling", "counselors", "crisis", "emergency", "immediate", "july", "launched", "lifeline", "line", "local", "national", "network", "operation", "prevention", "provide", "referral", "suicide", "supports", "written". Score: 0.5532. Entity: vertical-level.
0.5370
vertical-level
agencyassociationauthorityautomaticallyboardcertainclinicalcompetencedocumentationgovernmentgraduatejurisdictionslegallylicenselicensesmedicalmedicineoccupationalpermitspersonphysicianpracticeprofessionalreceiverequiredrequiresschoolscopespecified
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "association", "authority", "automatically", "board", "certain", "clinical", "competence", "documentation", "government", "graduate", "jurisdictions", "legally", "license", "licenses", "medical", "medicine", "occupational", "permits", "person", "physician", "practice", "professional", "receive", "required", "requires", "school", "scope", "specified". Score: 0.5370. Entity: vertical-level.
0.5366
vertical-level
academicbecomecontinuingeducationeducationalfieldinitialinternshipmedicalmovingphysicianpracticepractitionerprofessionalrelatedrequirementsresearchresidencyschoolspecificteachingtraining
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "become", "continuing", "education", "educational", "field", "initial", "internship", "medical", "moving", "physician", "practice", "practitioner", "professional", "related", "requirements", "research", "residency", "school", "specific", "teaching", "training". Score: 0.5366. Entity: vertical-level.
0.5333
vertical-level
broadlycarefacilitieshealthcarehospitalhospitalsinstitutionsmedicalmeetneedsnetworkpublicregionresourcesservedsystem
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "broadly", "care", "facilities", "healthcare", "hospital", "hospitals", "institutions", "medical", "meet", "needs", "network", "public", "region", "resources", "served", "system". Score: 0.5333. Entity: vertical-level.
0.5233
vertical-level
academicaddictionadolescentsadultanxietyassessmentsawaybipolarbuildingcarecenterchildchildrencommunitydepressiondiseasedisorderdisordersfamiliesgeriatricgroupgroupshospitalhospitalizationillnessindividualintendedlocalpatientpatientsplaceproblemsprogramprogramsprovidedpsychologicalschoolsettingsubstancetherapytowardtreattreatmentunablework
KEYWORD OVERLAP (high): 45 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "addiction", "adolescents", "adult", "anxiety", "assessments", "away", "bipolar", "building", "care", "center", "child", "children", "community", "depression", "disease", "disorder", "disorders", "families", "geriatric", "group", "groups", "hospital", "hospitalization", "illness", "individual", "intended", "local", "patient", "patients", "place", "problems", "program", "programs", "provided", "psychological", "school", "setting", "substance", "therapy", "toward", "treat", "treatment", "unable", "work". Score: 0.5233. Entity: vertical-level.
0.5200
vertical-level
alcoholbehavioralco-occurringconditionsconsequencescounselingdelivereddisordersdruggeneralgroupslegalmedicalparticipationpatientpresentprocessesprofessionalspsychiatricpsychologicalrecoveryrehabilitationsocialstreetsubstancetreatment
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "alcohol", "behavioral", "co-occurring", "conditions", "consequences", "counseling", "delivered", "disorders", "drug", "general", "groups", "legal", "medical", "participation", "patient", "present", "processes", "professionals", "psychiatric", "psychological", "recovery", "rehabilitation", "social", "street", "substance", "treatment". Score: 0.5200. Entity: vertical-level.
0.5200
vertical-level
amongbecomebenefitsbusinesscarecertaincodeshealthcareinformationlawlegallistmedicalpatientpatientspersonsprivilegesprofessionalsprotectprovidereceivereceivingrightssimplysupporttreatment
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "become", "benefits", "business", "care", "certain", "codes", "healthcare", "information", "law", "legal", "list", "medical", "patient", "patients", "persons", "privileges", "professionals", "protect", "provide", "receive", "receiving", "rights", "simply", "support", "treatment". Score: 0.5200. Entity: vertical-level.
0.5132
vertical-level
administeredboardcentercenterscertificationchildrencompletecontinuingcontinuumcostsdegreedepartmenteducationformalfundinggovernmentgraduatehospitalhospital-basedhospitalsindependentlyinternshiplicensuremedicaidmedicalmedicinephysicianphysicianspracticeprimarilyprogramprogramsrelativeresidencyschoolsupportsteachingtrainingveterans
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "board", "center", "centers", "certification", "children", "complete", "continuing", "continuum", "costs", "degree", "department", "education", "formal", "funding", "government", "graduate", "hospital", "hospital-based", "hospitals", "independently", "internship", "licensure", "medicaid", "medical", "medicine", "physician", "physicians", "practice", "primarily", "program", "programs", "relative", "residency", "school", "supports", "teaching", "training", "veterans". Score: 0.5132. Entity: vertical-level.
0.5104
vertical-level
accordingawarenessbuildingcarecommunitycorecriticaldevelopmentdirectevaluationfacilityfieldfurtheridentifiedimproveinformationmanagementmedicalnursingoutcomespatientperformancepersonnelphysiciansplanningpolicyprimaryprofessionalsprofessionsprovideprovidersrecordsrecruitmentreportresearchresourcesretentionrolesectorshortagessocialstrengtheningsupportsystemsystemstrainingwhoseworkersworkforce
KEYWORD OVERLAP (high): 49 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "awareness", "building", "care", "community", "core", "critical", "development", "direct", "evaluation", "facility", "field", "further", "identified", "improve", "information", "management", "medical", "nursing", "outcomes", "patient", "performance", "personnel", "physicians", "planning", "policy", "primary", "professionals", "professions", "provide", "providers", "records", "recruitment", "report", "research", "resources", "retention", "role", "sector", "shortages", "social", "strengthening", "support", "system", "systems", "training", "whose", "workers", "workforce". Score: 0.5104. Entity: vertical-level.
0.5050
vertical-level
carecenterscommitmentcommunitycomplianceconsumerdevelopeddevelopmentdisordersearlyeffectivefacilityfullgeneralgovernmentgroupshospitalhospitalizationhospitalshouseshousingillnessindividualslegallocalmedicalmovementorganizationsoutpatientpatientprimaryprivateprofessionalsprovidedproviderprovidingpsychiatricpsychosisreceivingrightssettingsimplysocialspecializedspecificsupervisionsupportsupportedsystemtreattreatment
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "care", "centers", "commitment", "community", "compliance", "consumer", "developed", "development", "disorders", "early", "effective", "facility", "full", "general", "government", "groups", "hospital", "hospitalization", "hospitals", "houses", "housing", "illness", "individuals", "legal", "local", "medical", "movement", "organizations", "outpatient", "patient", "primary", "private", "professionals", "provided", "provider", "providing", "psychiatric", "psychosis", "receiving", "rights", "setting", "simply", "social", "specialized", "specific", "supervision", "support", "supported", "system", "treat", "treatment". Score: 0.5050. Entity: vertical-level.
0.5000
vertical-level
alcoholaloneanxietybroadlycategoryco-occurringconditiondependentdepressiondiagnosingdiagnosisdisorderdisordersdrugdualgrouphomelessnesshospitalizationillnessindividualsitselfmakingnecessaryneedspanicpersonprimaryproblemspsychiatricpsychosisratesrelapserestrictedsinglesubstancesurroundingvaried
KEYWORD OVERLAP (high): 37 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "alcohol", "alone", "anxiety", "broadly", "category", "co-occurring", "condition", "dependent", "depression", "diagnosing", "diagnosis", "disorder", "disorders", "drug", "dual", "group", "homelessness", "hospitalization", "illness", "individuals", "itself", "making", "necessary", "needs", "panic", "person", "primary", "problems", "psychiatric", "psychosis", "rates", "relapse", "restricted", "single", "substance", "surrounding", "varied". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
advancedassessmentscarecertifieddiagnosisdisordersemergencyfamiliesindependentlylicensedlimitsmedicalmedicationnursepatientpatientsphysicalphysicianpracticepractitionerpractitionersprescribingproblemsprovidepsychiatricpsychiatristreducedregisteredrequiringrestrictedscopeservesettingsstandardsubstancesupervisiontherapytreattreatment
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advanced", "assessments", "care", "certified", "diagnosis", "disorders", "emergency", "families", "independently", "licensed", "limits", "medical", "medication", "nurse", "patient", "patients", "physical", "physician", "practice", "practitioner", "practitioners", "prescribing", "problems", "provide", "psychiatric", "psychiatrist", "reduced", "registered", "requiring", "restricted", "scope", "serve", "settings", "standard", "substance", "supervision", "therapy", "treat", "treatment". Score: 0.5000. Entity: vertical-level.
0.4821
vertical-level
academicaddressagenciesassessmentscounselingcounselorsemergencyevenfollow-upfreegovernmenthelpingneedsofferedorganizationsoutsideproblemsprogramprogramsreferralsresponserolesupervisorssupporttraumaviolencework
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "address", "agencies", "assessments", "counseling", "counselors", "emergency", "even", "follow-up", "free", "government", "helping", "needs", "offered", "organizations", "outside", "problems", "program", "programs", "referrals", "response", "role", "supervisors", "support", "trauma", "violence", "work". Score: 0.4821. Entity: vertical-level.
0.4737
vertical-level
approximatelyboisecaldwellcanyoncensuseastidahometropolitanpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "caldwell", "canyon", "census", "east", "idaho", "metropolitan", "population". Score: 0.4737. Entity: vertical-level.
0.4630
vertical-level
accessadditionagenciesarticleauthoritiesbeyondchildchildrencommunitycomponentcoordinationcreatecreatingdangerdefinesdelivereddesigneddevelopmenteconomiceducationeffectiveemotionalespeciallyevenextendfamiliesfamilyfreefuturegovernmentgroupshealthcareholdingidentifyidentifyingindividualindividualsjusticelocalmakingmeansnecessaryneededneedsorganizationsphysicalplacepreventionprimaryprotectprovidedprovidersprovidingpsychologicalqualityreferralrequiredresearchresourcesrespondresponseresponsibilitiesrightsriskriskssafetysectorssocialstabilitystrengtheningsupportsystemsystemsviolencewelfare
KEYWORD OVERLAP (high): 75 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "addition", "agencies", "article", "authorities", "beyond", "child", "children", "community", "component", "coordination", "create", "creating", "danger", "defines", "delivered", "designed", "development", "economic", "education", "effective", "emotional", "especially", "even", "extend", "families", "family", "free", "future", "government", "groups", "healthcare", "holding", "identify", "identifying", "individual", "individuals", "justice", "local", "making", "means", "necessary", "needed", "needs", "organizations", "physical", "place", "prevention", "primary", "protect", "provided", "providers", "providing", "psychological", "quality", "referral", "required", "research", "resources", "respond", "response", "responsibilities", "rights", "risk", "risks", "safety", "sectors", "social", "stability", "strengthening", "support", "system", "systems", "violence", "welfare". Score: 0.4630. Entity: vertical-level.
0.4602
vertical-level
additionagainstapproximatelyassociatedbenefitscannotcarechildrencommercialcostscoveragecoveringdescribedifferentdisabilityexpansiongovernmentindividualsinsurancemajormedicaidmedicalmeetneedsnursingpaidpaypoolspopulationpracticesprivateprogramprogramsprotectprovideprovidingpublicpurchasedreducedreferregulatoryreportedreportingresourcesriskscopesocialsubstantiallysupportsystemtimeswelfare
KEYWORD OVERLAP (high): 52 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addition", "against", "approximately", "associated", "benefits", "cannot", "care", "children", "commercial", "costs", "coverage", "covering", "describe", "different", "disability", "expansion", "government", "individuals", "insurance", "major", "medicaid", "medical", "meet", "needs", "nursing", "paid", "pay", "pools", "population", "practices", "private", "program", "programs", "protect", "provide", "providing", "public", "purchased", "reduced", "refer", "regulatory", "reported", "reporting", "resources", "risk", "scope", "social", "substantially", "support", "system", "times", "welfare". Score: 0.4602. Entity: vertical-level.
0.4545
vertical-level
crisisimmediateinterventionspecificstabilization
KEYWORD OVERLAP (high): 5 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "crisis", "immediate", "intervention", "specific", "stabilization". Score: 0.4545. Entity: vertical-level.
0.4380
vertical-level
affectsaroundassociatedautismbehaviorbehavioralbipolarcasescauseschangesclinicalclinicscommunityconditioncontextdementiadepressiondetentiondevelopmentaldiagnosisdifferentdisabilitydisorderdisordersdistressdisturbanceearlyemotionalfunctionshospitalshyperactivityillnessindividualinvoluntarymajormakingmedicalmedicationmethodsnurseoccursoutpatientparticularperiodpreventionprofessionalprofessionalsprogramsprovidedpsychiatricpsychiatristpsychologistpsychotherapyregulationsinglesocialspecificsupporttreatmentworker
KEYWORD OVERLAP (high): 60 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affects", "around", "associated", "autism", "behavior", "behavioral", "bipolar", "cases", "causes", "changes", "clinical", "clinics", "community", "condition", "context", "dementia", "depression", "detention", "developmental", "diagnosis", "different", "disability", "disorder", "disorders", "distress", "disturbance", "early", "emotional", "functions", "hospitals", "hyperactivity", "illness", "individual", "involuntary", "major", "making", "medical", "medication", "methods", "nurse", "occurs", "outpatient", "particular", "period", "prevention", "professional", "professionals", "programs", "provided", "psychiatric", "psychiatrist", "psychologist", "psychotherapy", "regulation", "single", "social", "specific", "support", "treatment", "worker". Score: 0.4380. Entity: vertical-level.
0.4286
vertical-level
academicaccessalternativeapproachesautismbehavioralcommunitycurriculumdesigneddevelopmentaldifferentdisorderdisorderseducationeducationalemotionalgeneralgivenhigherimproveindividualindividualsintegrationmaterialsmethodsneedsphysicalpracticeproceduresprovideresourceschoolseparateservedsettingssocialstudentstudentssuccessteachingtechnologywestern
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "access", "alternative", "approaches", "autism", "behavioral", "community", "curriculum", "designed", "developmental", "different", "disorder", "disorders", "education", "educational", "emotional", "general", "given", "higher", "improve", "individual", "individuals", "integration", "materials", "methods", "needs", "physical", "practice", "procedures", "provide", "resource", "school", "separate", "served", "settings", "social", "student", "students", "success", "teaching", "technology", "western". Score: 0.4286. Entity: vertical-level.
0.4237
vertical-level
accountabilityadditionadministersadministrationagencycarecenterscertificationchildrenclinicaldepartmentfacilitiesfinancinggovhealthcareinsurancemedicaidnursingprogramprogramsqualityreportsresponsibilitiesstandardssystem
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "addition", "administers", "administration", "agency", "care", "centers", "certification", "children", "clinical", "department", "facilities", "financing", "gov", "healthcare", "insurance", "medicaid", "nursing", "program", "programs", "quality", "reports", "responsibilities", "standards", "system". Score: 0.4237. Entity: vertical-level.
0.4127
vertical-level
angerbehavioralbroaderchangecontextdeliveredexplicitlygroupgroupshelpingmanagementmechanismplacepsychiatristpsychotherapyreferrelationshipsskillssocialspecializedsupporttherapiststherapytrainingtreattreatment
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "anger", "behavioral", "broader", "change", "context", "delivered", "explicitly", "group", "groups", "helping", "management", "mechanism", "place", "psychiatrist", "psychotherapy", "refer", "relationships", "skills", "social", "specialized", "support", "therapists", "therapy", "training", "treat", "treatment". Score: 0.4127. Entity: vertical-level.
0.4103
vertical-level
administrationadministratorannouncedavailabilitybuildingdepartmentdirectlydisabilityhealthyillnessintegratedoutsidequalityreportssubstancetreatment
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "administrator", "announced", "availability", "building", "department", "directly", "disability", "healthy", "illness", "integrated", "outside", "quality", "reports", "substance", "treatment". Score: 0.4103. Entity: vertical-level.
0.4028
vertical-level
actionchronicconditionsdangerousdiseasedocumentationdrugeducationespeciallyfollow-uphelpingimproveindividualinterventionmanagementmedicalmedicationmedicinemultipleolderoutcomesplanprovidedprovidingrecordreferralreviewtherapytreat
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "action", "chronic", "conditions", "dangerous", "disease", "documentation", "drug", "education", "especially", "follow-up", "helping", "improve", "individual", "intervention", "management", "medical", "medication", "medicine", "multiple", "older", "outcomes", "plan", "provided", "providing", "record", "referral", "review", "therapy", "treat". Score: 0.4028. Entity: vertical-level.
0.4026
vertical-level
businesscapitalcategorychangescontroldescribeddevelopmentevaluationsexpansionfinancingfirmsgeneralinvestmentinvestorlimitedmanagementmixedofferedoperationalotherwiseownershipprivateprovidepublicratherreferrolespecializedspecificstrategiesstrategy
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "business", "capital", "category", "changes", "control", "described", "development", "evaluations", "expansion", "financing", "firms", "general", "investment", "investor", "limited", "management", "mixed", "offered", "operational", "otherwise", "ownership", "private", "provide", "public", "rather", "refer", "role", "specialized", "specific", "strategies", "strategy". Score: 0.4026. Entity: vertical-level.
0.3973
vertical-level
advocacyaffectedaroundawarenesscommunitycorporateeducationfamiliesfamilyfundinggrouphealthyidentifiesillnessindividualindividualslocalmembersmissionnationalnonprofitoriginallyprofessionalsprovidingpublicpublishessupportsupportedwashington
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advocacy", "affected", "around", "awareness", "community", "corporate", "education", "families", "family", "funding", "group", "healthy", "identifies", "illness", "individual", "individuals", "local", "members", "mission", "national", "nonprofit", "originally", "professionals", "providing", "public", "publishes", "support", "supported", "washington". Score: 0.3973. Entity: vertical-level.
0.3939
vertical-level
arrangementsawaycarecoordinateddeliveryfragmentedhealthcareintegratedmodelmovingresponsesocialsystems
KEYWORD OVERLAP (high): 13 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "arrangements", "away", "care", "coordinated", "delivery", "fragmented", "healthcare", "integrated", "model", "moving", "response", "social", "systems". Score: 0.3939. Entity: vertical-level.
0.3933
vertical-level
administrationadvancedassessmentbehavioralcentralclinicclinicalcliniciansconsultationdevelopeddevelopmentdiagnosisdifferentdisordersdistresseducationalfamilyfieldgivengrowthheavilyidahointegratingintegrationknowledgemastermedicalmedicinemethodsmodelmodelsneedopeningpracticepractitionersprimarilyprimaryproceduresprogramprovidingpsychiatristspsychiatrypsychologicalpsychologistspsychologypsychotherapyregulatedresearchspecialtystandardsystemsteachingtheorytherapytraintrainingtreattreatmentuniversity
KEYWORD OVERLAP (high): 59 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "advanced", "assessment", "behavioral", "central", "clinic", "clinical", "clinicians", "consultation", "developed", "development", "diagnosis", "different", "disorders", "distress", "educational", "family", "field", "given", "growth", "heavily", "idaho", "integrating", "integration", "knowledge", "master", "medical", "medicine", "methods", "model", "models", "need", "opening", "practice", "practitioners", "primarily", "primary", "procedures", "program", "providing", "psychiatrists", "psychiatry", "psychological", "psychologists", "psychology", "psychotherapy", "regulated", "research", "specialty", "standard", "systems", "teaching", "theory", "therapy", "train", "training", "treat", "treatment", "university". Score: 0.3933. Entity: vertical-level.
0.3913
vertical-level
agencycertificationeducationalperformpersonprofessionalpublicqualificationsimply
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "certification", "educational", "perform", "person", "professional", "public", "qualification", "simply". Score: 0.3913. Entity: vertical-level.
0.3889
vertical-level
associationcounselingcounselorsdevelopmentlicensedlifemembermissionpracticeprofessionalprofessionalsqualitystatedstudents
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "association", "counseling", "counselors", "development", "licensed", "life", "member", "mission", "practice", "professional", "professionals", "quality", "stated", "students". Score: 0.3889. Entity: vertical-level.
0.3846
vertical-level
additionaddressesarticleathleticbehavioralcertaincompetitioncomponentdefinitioneducationemotionalexperiencehelpinginfluenceknowledgelifemajormultipleparticipationperformancephysicalprocessesprofessionalprogrampsychologicalpsychologistpsychologistspsychologyrecreationrehabilitationrelatedrelationshipsriskschoolskillssocialstudytrainingtransitionswork
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addition", "addresses", "article", "athletic", "behavioral", "certain", "competition", "component", "definition", "education", "emotional", "experience", "helping", "influence", "knowledge", "life", "major", "multiple", "participation", "performance", "physical", "processes", "professional", "program", "psychological", "psychologist", "psychologists", "psychology", "recreation", "rehabilitation", "related", "relationships", "risk", "school", "skills", "social", "study", "training", "transitions", "work". Score: 0.3846. Entity: vertical-level.
0.3846
vertical-level
accessassociatedcallscarechangesconcernsconditionseffectiveemergencygreaterimplementationimprovemakingmental-healthnecessarypovertyproblemspsychiatricrepresentresearchriskskillstechnologytelemedicinetreating
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "associated", "calls", "care", "changes", "concerns", "conditions", "effective", "emergency", "greater", "implementation", "improve", "making", "mental-health", "necessary", "poverty", "problems", "psychiatric", "represent", "research", "risk", "skills", "technology", "telemedicine", "treating". Score: 0.3846. Entity: vertical-level.
0.3824
vertical-level
adaboisecapitalcensusdistricteastidahojurisdictionlocalmetropolitanpopulationprivatewashington
KEYWORD OVERLAP (high): 13 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "capital", "census", "district", "east", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "washington". Score: 0.3824. Entity: vertical-level.
0.3805
vertical-level
accordingadministeredadministrationageagedalternativeannualbenefitscarecenterscostscovereddifferentdiseasedivideddruggovernmentgrouphealthcarehospitalindividualsinsurancelimitsmedicaidnursingolderoutpatientpaidpatientspercentplanprimarilyprivateprogramprovideprovidedreceivereportreportsresearchrestsocialtable
KEYWORD OVERLAP (high): 43 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "administered", "administration", "age", "aged", "alternative", "annual", "benefits", "care", "centers", "costs", "covered", "different", "disease", "divided", "drug", "government", "group", "healthcare", "hospital", "individuals", "insurance", "limits", "medicaid", "nursing", "older", "outpatient", "paid", "patients", "percent", "plan", "primarily", "private", "program", "provide", "provided", "receive", "report", "reports", "research", "rest", "social", "table". Score: 0.3805. Entity: vertical-level.
0.3800
vertical-level
accountabilityaugustauthorizedbusinessescarecaseschangeconfidentialityconsentcoveragecoveredentityestablishmentfamiliesfamilygovernsgrouphealthcareindividualsinformationinsurancelawlifelimitedmaintainedmedicalmembersnationalpatientpatientsprohibitsprovidersprovisionsrequiresstandardstitletransferworkers
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountability", "august", "authorized", "businesses", "care", "cases", "change", "confidentiality", "consent", "coverage", "covered", "entity", "establishment", "families", "family", "governs", "group", "healthcare", "individuals", "information", "insurance", "law", "life", "limited", "maintained", "medical", "members", "national", "patient", "patients", "prohibits", "providers", "provisions", "requires", "standards", "title", "transfer", "workers". Score: 0.3800. Entity: vertical-level.
0.3793
vertical-level
annualassociationcliniciansdifferentgroupsmembersprofessionalpsychologicalpsychologistspsychologystudents
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "annual", "association", "clinicians", "different", "groups", "members", "professional", "psychological", "psychologists", "psychology", "students". Score: 0.3793. Entity: vertical-level.
0.3784
vertical-level
associationconditionsdiagnosingdisordersmemberspatientspopulationpracticeprofessionalpsychiatricpsychiatristspublishesresearchwashington
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "association", "conditions", "diagnosing", "disorders", "members", "patients", "population", "practice", "professional", "psychiatric", "psychiatrists", "publishes", "research", "washington". Score: 0.3784. Entity: vertical-level.
0.3692
vertical-level
absorbaccessadministrationagencyannouncedassociationcapacitycenterschangescommunicationscontroldepartmentdesigneddisabilitydiseaseeducationalespeciallyfebruaryfoodfoundinggovernmenthealthyimproveinformationinstituteinstitutionalleadershipmaintainedmajormedicalmembermortalitymovenationaloccupationalorganizationspreventionprogramprogramspublicreportresearchresponsesafetystabilitystrategictemporaryweekly
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absorb", "access", "administration", "agency", "announced", "association", "capacity", "centers", "changes", "communications", "control", "department", "designed", "disability", "disease", "educational", "especially", "february", "food", "founding", "government", "healthy", "improve", "information", "institute", "institutional", "leadership", "maintained", "major", "medical", "member", "mortality", "move", "national", "occupational", "organizations", "prevention", "program", "programs", "public", "report", "research", "response", "safety", "stability", "strategic", "temporary", "weekly". Score: 0.3692. Entity: vertical-level.
0.3690
vertical-level
agenciesagencyalcoholassessmentcommunitycomponentcrisisdisabilitydistressemergencyevaluationshospitalindividualinvolvingjailsjurisdictionsleastlegallocalmobilenursingotherwisepersonprovidingpsychosisservestatussuicidesupportthemselvestreatment
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agencies", "agency", "alcohol", "assessment", "community", "component", "crisis", "disability", "distress", "emergency", "evaluations", "hospital", "individual", "involving", "jails", "jurisdictions", "least", "legal", "local", "mobile", "nursing", "otherwise", "person", "providing", "psychosis", "serve", "status", "suicide", "support", "themselves", "treatment". Score: 0.3690. Entity: vertical-level.
0.3673
vertical-level
chroniccommunitydepartmentsdevelopeddifferentdisordersfamiliesfundinghomelessnesshousingillnessindividualsintendedprofessionalstablesubstancesupportedwork
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "chronic", "community", "departments", "developed", "different", "disorders", "families", "funding", "homelessness", "housing", "illness", "individuals", "intended", "professional", "stable", "substance", "supported", "work". Score: 0.3673. Entity: vertical-level.
0.3611
vertical-level
accordingboisecanyoncensusidahomeridianmetropolitannampapopulationprincipalstudentuniversitywestern
KEYWORD OVERLAP (high): 13 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "boise", "canyon", "census", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western". Score: 0.3611. Entity: vertical-level.
0.3590
vertical-level
agencyauthorizedbecomebehaviorcentersclinicalcurrentdepartmentdiscoveryestablishedexperiencefosterfullfurthergovernmentillnessinstituteinstitutionslawmissionnationalorganizationspreventionprimaryrecoveryresearchthroughouttreatment
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "authorized", "become", "behavior", "centers", "clinical", "current", "department", "discovery", "established", "experience", "foster", "full", "further", "government", "illness", "institute", "institutions", "law", "mission", "national", "organizations", "prevention", "primary", "recovery", "research", "throughout", "treatment". Score: 0.3590. Entity: vertical-level.
0.3571
vertical-level
approximatelyassociatedassociationbecomebehaviorcasescausescertainchangeschronicclinicalcliniciansconditionconditionsdepressiondiagnosisdisabilitydisorderdisorderseatingeducationexaminationfamilygeneralgrouphistoryhospitalizationintroducedinvoluntaryleastlifemajormedicationnecessarypersonphysicalproblemspsychiatricpsychologicalpsychotherapyreportreportedreportingriskrulestatussubstancetreatedtreatmentwork
KEYWORD OVERLAP (high): 50 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "associated", "association", "become", "behavior", "cases", "causes", "certain", "changes", "chronic", "clinical", "clinicians", "condition", "conditions", "depression", "diagnosis", "disability", "disorder", "disorders", "eating", "education", "examination", "family", "general", "group", "history", "hospitalization", "introduced", "involuntary", "least", "life", "major", "medication", "necessary", "person", "physical", "problems", "psychiatric", "psychological", "psychotherapy", "report", "reported", "reporting", "risk", "rule", "status", "substance", "treated", "treatment", "work". Score: 0.3571. Entity: vertical-level.
0.3389
vertical-level
addressadolescentsanxietyapproachesassociatedassociationbehaviorbehavioralbehaviorschildrencombinescommitmentconditionconditionsdepressiondesigneddevelopeddevelopmentdisorderdisorderseatingeffectiveemotionalespeciallyestablishmentevidence-basedfindinghelpinghyperactivityidentifiedimproveindividualinfluencedlimitedlinemedicalmovementnationaloriginallypatientsplaceproblemsprocessingpsychiatricpsychologicalpsychologypsychotherapyratesratherregulationresearchrolestrategiessubstancetheorytherapisttherapytrainingtreattreatmentunderlying
KEYWORD OVERLAP (high): 61 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "address", "adolescents", "anxiety", "approaches", "associated", "association", "behavior", "behavioral", "behaviors", "children", "combines", "commitment", "condition", "conditions", "depression", "designed", "developed", "development", "disorder", "disorders", "eating", "effective", "emotional", "especially", "establishment", "evidence-based", "finding", "helping", "hyperactivity", "identified", "improve", "individual", "influenced", "limited", "line", "medical", "movement", "national", "originally", "patients", "place", "problems", "processing", "psychiatric", "psychological", "psychology", "psychotherapy", "rates", "rather", "regulation", "research", "role", "strategies", "substance", "theory", "therapist", "therapy", "training", "treat", "treatment", "underlying". Score: 0.3389. Entity: vertical-level.
0.3375
vertical-level
becomecompetitionconsolidationconsumerscorporationdescribeddifferentdirectlyfreeintegratedintegrationmakingmanagementmarketmemberneedneededownedownershippositionproduceproducesratherrelatedsatisfysuppliesvertical
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "become", "competition", "consolidation", "consumers", "corporation", "described", "different", "directly", "free", "integrated", "integration", "making", "management", "market", "member", "need", "needed", "owned", "ownership", "position", "produce", "produces", "rather", "related", "satisfy", "supplies", "vertical". Score: 0.3375. Entity: vertical-level.
0.3333
vertical-level
adaannualboisecapitalcensuscountieseastidahomajormetropolitanpopulationsectorstechnologytreasurevalley
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "annual", "boise", "capital", "census", "counties", "east", "idaho", "major", "metropolitan", "population", "sectors", "technology", "treasure", "valley". Score: 0.3333. Entity: vertical-level.
0.3333
vertical-level
accordingaffectedageanxietybeginbehaviorcasecasescausescounselingdeathsdescribeddiagnosisdisorderdisorderseffectiveespeciallyexperienceformalfurthergeneralhigherhistoryhomelessnesshospitalhospitalizationhospitalsimproveinitialinvoluntaryleastlifelimitedmedicationneedobjectiveofferedpersonphysicalpopulationpovertypregnancypresentproblemspsychiatricraterehabilitationreportedreportsrespondrisksocialstayssubstancesuicidetrainingtreatment
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "affected", "age", "anxiety", "begin", "behavior", "case", "cases", "causes", "counseling", "deaths", "described", "diagnosis", "disorder", "disorders", "effective", "especially", "experience", "formal", "further", "general", "higher", "history", "homelessness", "hospital", "hospitalization", "hospitals", "improve", "initial", "involuntary", "least", "life", "limited", "medication", "need", "objective", "offered", "person", "physical", "population", "poverty", "pregnancy", "present", "problems", "psychiatric", "rate", "rehabilitation", "reported", "reports", "respond", "risk", "social", "stays", "substance", "suicide", "training", "treatment". Score: 0.3333. Entity: vertical-level.
0.3273
vertical-level
callchildrencircumstancescounselingcrisescrisisdisorderseatingemergencyemotionalexpandedidentifyimmediateleastmajoroperateprovidingsuicide
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "call", "children", "circumstances", "counseling", "crises", "crisis", "disorders", "eating", "emergency", "emotional", "expanded", "identify", "immediate", "least", "major", "operate", "providing", "suicide". Score: 0.3273. Entity: vertical-level.
0.3226
vertical-level
consumersevaluationexperienceinformedprofessionalpurchasedreviewreviewssitesthemselves
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "consumers", "evaluation", "experience", "informed", "professional", "purchased", "review", "reviews", "sites", "themselves". Score: 0.3226. Entity: vertical-level.
0.3182
vertical-level
addictionapproachesbehaviorscarecommunicationsconsequencescreatingdangerdangerouseducationexpandingframeworkhelpingindividualsinformationintegratedlawmedicinemodelneedorganizationspracticepresentprocessingpsychologyratherrelationshiprelationshipssafetyscopesingleskillsstatedsupporttrauma
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "approaches", "behaviors", "care", "communications", "consequences", "creating", "danger", "dangerous", "education", "expanding", "framework", "helping", "individuals", "information", "integrated", "law", "medicine", "model", "need", "organizations", "practice", "present", "processing", "psychology", "rather", "relationship", "relationships", "safety", "scope", "single", "skills", "stated", "support", "trauma". Score: 0.3182. Entity: vertical-level.
0.3133
vertical-level
actsadolescentsagainstageamongbehaviorbehaviorscausescontrolcontrollingcouplecouplescurrentdefinesdomesticeconomicemotionalmedicalphysicalpsychologicalrelationshipreportresultsheltersimplyviolence
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acts", "adolescents", "against", "age", "among", "behavior", "behaviors", "causes", "control", "controlling", "couple", "couples", "current", "defines", "domestic", "economic", "emotional", "medical", "physical", "psychological", "relationship", "report", "result", "shelter", "simply", "violence". Score: 0.3133. Entity: vertical-level.
0.3087
vertical-level
addictionageassociationbeginbehavioralcliniciansconditioncurrentdeathsdiagnosisdifferentdisorderdisordersfamilygrouphistoryindividualjanuarymedicalmedicationoccursphysicalprescribingproblemsprofessionalprofessionalsprogramspsychiatricpsychologicalreferrelapserelativereportedresponsibilitiesrisksocialstandardstatussubstancesuicidesupporttherapytraumatreatedtreatingtreatment
KEYWORD OVERLAP (high): 46 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "age", "association", "begin", "behavioral", "clinicians", "condition", "current", "deaths", "diagnosis", "different", "disorder", "disorders", "family", "group", "history", "individual", "january", "medical", "medication", "occurs", "physical", "prescribing", "problems", "professional", "professionals", "programs", "psychiatric", "psychological", "refer", "relapse", "relative", "reported", "responsibilities", "risk", "social", "standard", "status", "substance", "suicide", "support", "therapy", "trauma", "treated", "treating", "treatment". Score: 0.3087. Entity: vertical-level.
0.3013
vertical-level
actsadultadultsageauthoritybehaviorcapacitychangeschildchildrencontextcourtcourtscreatecriminaldatadevelopmentearlyfurthergeneralimplementationincreasesinitiativesinterventioninvolvejurisdictionjusticejuvenilelegalmodelneedspasspracticeproceedingsprominenceprotectreportedresponserightsrulesseparateseparatelyshiftsystemstreatedtreatingyouth
KEYWORD OVERLAP (high): 47 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acts", "adult", "adults", "age", "authority", "behavior", "capacity", "changes", "child", "children", "context", "court", "courts", "create", "criminal", "data", "development", "early", "further", "general", "implementation", "increases", "initiatives", "intervention", "involve", "jurisdiction", "justice", "juvenile", "legal", "model", "needs", "pass", "practice", "proceedings", "prominence", "protect", "reported", "response", "rights", "rules", "separate", "separately", "shift", "systems", "treated", "treating", "youth". Score: 0.3013. Entity: vertical-level.
0.2941
vertical-level
addedassessmentassociatedbehaviorbipolarbriefcasescategorycauseschangesclinicalconcernsconditioncontextdeliverydepressiondevelopmentdiagnosesdiagnosisdisorderdisordersdisruptionemergencyespeciallyevidencefamilyfrequentlygivenhistoryhospitalizationillnessindependentlyindividualmedicationoccurspatientperiodphysicianpostpartumprocedurespsychiatricpsychosisraisesrapidratherrelatedrequiringreviewsriskrolesafetytherapythroughouttreatmenturgent
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "added", "assessment", "associated", "behavior", "bipolar", "brief", "cases", "category", "causes", "changes", "clinical", "concerns", "condition", "context", "delivery", "depression", "development", "diagnoses", "diagnosis", "disorder", "disorders", "disruption", "emergency", "especially", "evidence", "family", "frequently", "given", "history", "hospitalization", "illness", "independently", "individual", "medication", "occurs", "patient", "period", "physician", "postpartum", "procedures", "psychiatric", "psychosis", "raises", "rapid", "rather", "related", "requiring", "reviews", "risk", "role", "safety", "therapy", "throughout", "treatment", "urgent". Score: 0.2941. Entity: vertical-level.
0.2931
vertical-level
careclinicscontinuingemploysfacilitieshealthcarehospitalhospitalsidahonetworkoperatesoperatingoutpatientpatientsphysicianssupportsystem
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "care", "clinics", "continuing", "employs", "facilities", "healthcare", "hospital", "hospitals", "idaho", "network", "operates", "operating", "outpatient", "patients", "physicians", "support", "system". Score: 0.2931. Entity: vertical-level.
0.2885
vertical-level
affectedcarechangeschildclinicalconditiondangerousdepressiondevelopmentdistressearlyeconomicemotionaleveneventexperienceexperiencingfamilyhistoryinvolvelifemedicalpatientplaceplacespostpartumpregnancyproviderstresstreated
KEYWORD OVERLAP (high): 30 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affected", "care", "changes", "child", "clinical", "condition", "dangerous", "depression", "development", "distress", "early", "economic", "emotional", "even", "event", "experience", "experiencing", "family", "history", "involve", "life", "medical", "patient", "place", "places", "postpartum", "pregnancy", "provider", "stress", "treated". Score: 0.2885. Entity: vertical-level.
0.2850
vertical-level
addictiveaffectedaffectsalcoholamonganxietyassociatedbehavioralcauseschildclinicalconsequencescontextcostsdeathsdefinitionsdementiadevelopmentdiagnosisdirectlydisorderdisordersespeciallyevidencefurthergroupgroupshigherillnessincreasesindividualinformationledlifemedicalmedicallyparticipationpersonphysicalpregnancyproblemsratesrecordsreferresponseresultreviewrisksocialstresssupportsystemsystemstherapytimestreatmenttwelve
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addictive", "affected", "affects", "alcohol", "among", "anxiety", "associated", "behavioral", "causes", "child", "clinical", "consequences", "context", "costs", "deaths", "definitions", "dementia", "development", "diagnosis", "directly", "disorder", "disorders", "especially", "evidence", "further", "group", "groups", "higher", "illness", "increases", "individual", "information", "led", "life", "medical", "medically", "participation", "person", "physical", "pregnancy", "problems", "rates", "records", "refer", "response", "result", "review", "risk", "social", "stress", "support", "system", "systems", "therapy", "times", "treatment", "twelve". Score: 0.2850. Entity: vertical-level.
0.2828
vertical-level
accessaccordingassociatedcarecategoriescausescommunitiescommunityconditionconditionsdeathsdefinesdefinitiondifferentdirecteffectiveemergencyexperiencefamilygrowthhigherinfrastructurelabormanagementmaternalmedicineminutesmortalityobstetricorganizationsperiodplanningpopulationpregnancyrateratesreflectsrelatedreportresourceunderlying
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "according", "associated", "care", "categories", "causes", "communities", "community", "condition", "conditions", "deaths", "defines", "definition", "different", "direct", "effective", "emergency", "experience", "family", "growth", "higher", "infrastructure", "labor", "management", "maternal", "medicine", "minutes", "mortality", "obstetric", "organizations", "period", "planning", "population", "pregnancy", "rate", "rates", "reflects", "related", "report", "resource", "underlying". Score: 0.2828. Entity: vertical-level.
0.2628
vertical-level
addictionassociatedcasescauseschangeconditionscontextcontinuousdisorderdisordersdistinctearlyeffectiveemotionaleventhyperactivityindividualinitiationlifemajormanagementmultipleoccursperformanceperiodprecisepregnancyprimarilyprofessionalpsychotherapyqualityraterelatedrelationshipresponseriskriskssinglesocialsupportedtreatment
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "addiction", "associated", "cases", "causes", "change", "conditions", "context", "continuous", "disorder", "disorders", "distinct", "early", "effective", "emotional", "event", "hyperactivity", "individual", "initiation", "life", "major", "management", "multiple", "occurs", "performance", "period", "precise", "pregnancy", "primarily", "professional", "psychotherapy", "quality", "rate", "related", "relationship", "response", "risk", "risks", "single", "social", "supported", "treatment". Score: 0.2628. Entity: vertical-level.
0.2609
vertical-level
concernsdisordersequine-assistedevidenceevidence-basedinvolvephysicalproblemsresourcesreviewtherapytreatment
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "concerns", "disorders", "equine-assisted", "evidence", "evidence-based", "involve", "physical", "problems", "resources", "review", "therapy", "treatment". Score: 0.2609. Entity: vertical-level.
0.2595
vertical-level
adultsalcoholanxietycannotclinicaldepressiondiagnosingdisorderdisordersdistincteffectiveemotionalevaluateexperiencingfunctionsgeneralgroupidentifiedillnessindividuallifemedicaloccupationalpanicpersonphysicalpopulationprofessionalrateresponsesocialspecificsubstancetreatment
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adults", "alcohol", "anxiety", "cannot", "clinical", "depression", "diagnosing", "disorder", "disorders", "distinct", "effective", "emotional", "evaluate", "experiencing", "functions", "general", "group", "identified", "illness", "individual", "life", "medical", "occupational", "panic", "person", "physical", "population", "professional", "rate", "response", "social", "specific", "substance", "treatment". Score: 0.2595. Entity: vertical-level.
0.2165
vertical-level
abilityadultsaffectedaloneanxietyassociatedbehaviorscasescausescertainchildrenchronicclinicalcontemporarydescribedescribeddiagnosisdisorderdistressfollowedgeneralimproveindividualinvolvingleastlifemanagedneedpatientsperformperiodspresentpreventionprocessesqualityrecognizeresponsestructurethemselvestraumatreatmentyet
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "adults", "affected", "alone", "anxiety", "associated", "behaviors", "cases", "causes", "certain", "children", "chronic", "clinical", "contemporary", "describe", "described", "diagnosis", "disorder", "distress", "followed", "general", "improve", "individual", "involving", "least", "life", "managed", "need", "patients", "perform", "periods", "present", "prevention", "processes", "quality", "recognize", "response", "structure", "themselves", "trauma", "treatment", "yet". Score: 0.2165. Entity: vertical-level.
0.1525
vertical-level
advancedalternativearoundcannotcompletecreatedevelopeddifferententerenteringentryevenexperienceinfluenceitselflinemethodsmovementoccursreachreentryrelativerestsimplysmallerstresstoward
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advanced", "alternative", "around", "cannot", "complete", "create", "developed", "different", "enter", "entering", "entry", "even", "experience", "influence", "itself", "line", "methods", "movement", "occurs", "reach", "reentry", "relative", "rest", "simply", "smaller", "stress", "toward". Score: 0.1525. Entity: vertical-level.
Provenance
Mental Health refinery-treasurevalley-v1.0.0 64,142 chars · 0 entities · 0 sections 134 articles · 134 edges fa5c68041eb54d09