—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Nonprofits Community page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 155 edges
Information Vertical · Treasure Valley

Nonprofits Community

0 Research Entities
155 Wikipedia Articles
155 Semantic Edges
0 Sections

The Treasure Valley nonprofit and community sector is not a single industry but a distributed civic operating system composed of charitable corporations, private foundations, religious institutions, mutual-aid networks, membership associations, healthcare and educational nonprofits, federally funded service providers, local-government contractors, neighborhood organizations, volunteer groups, and philanthropic intermediaries. Federal law recognizes multiple tax-exempt organizational classes, including charities, religious organizations, educational institutions, social-welfare organizations, civic leagues, labor organizations, social clubs, and business leagues; the Internal Revenue Service’s current classification framework is published at https://www.irs.gov/charities-and-nonprofits and https://www.irs.gov/charities-non-profits/exempt-organization-types. Organizations seeking the dominant charitable classification under Internal Revenue Code §501(c)(3) must be organized and operated exclusively for recognized exempt purposes, may not distribute net earnings to private shareholders or individuals, must serve public rather than private interests, and may not participate in political campaigns, as described at https://www.irs.gov/charities-non-profits/charitable-organizations/exemption-requirements-501c3-organizations and https://www.irs.gov/charities-non-profits/charitable-organizations/exempt-purposes-internal-revenue-code-section-501c3. The recognized purposes include charitable, religious, educational, scientific, literary, public-safety-testing, amateur-sports, and anti-cruelty purposes, creating the federal legal envelope within which most Treasure Valley community organizations operate.

Idaho nonprofit corporations are created and maintained through the Idaho Secretary of State under Title 30, Chapters 21 and 30, Idaho Code. The official nonprofit articles form is available at https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Incorp%20nonprofit.pdf and requires a corporate name, organizational purpose, Idaho registered agent, incorporator, mailing address, governance choice concerning voting members, dissolution provision, and, except for corporations organized for religious purposes, an initial board containing at least three people under Idaho Code §30-30-603. The form expressly directs applicants seeking federal charitable status to include an exempt-purpose clause and a dissolution-of-assets provision. Idaho’s business forms, amendments, dissolutions, annual-report system, entity records, and supporting publications are maintained at https://sos.idaho.gov/business-forms/, https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Amend%20NonProfit.pdf, https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Dissolution%20Nonprofit.pdf, https://sos.idaho.gov/annual-report-help/, https://sos.idaho.gov/business-services-resources/, and https://sos.idaho.gov/business-services-resources/business-entity-publications/. The Secretary of State’s guidance states that entity filings are public records and that organizations intending to qualify under §501(c)(3) must place the required purpose and asset-dissolution provisions in their organizing documents, establishing the state corporate layer beneath federal exemption. https://sos.idaho.gov/business-services-resources/business-entities-faq/

Federal exemption is not automatic for most organizations. A qualifying organization normally applies electronically through the Form 1023 series, generally within twenty-seven months of formation when retroactive recognition from the formation date is required; churches, integrated auxiliaries, conventions or associations of churches, and certain organizations with normally less than $5,000 in annual gross receipts are recognized exceptions. https://www.irs.gov/charities-non-profits/application-for-recognition-of-exemption and https://www.irs.gov/charities-non-profits/churches-integrated-auxiliaries-and-conventions-or-associations-of-churches. Organizing documents must restrict the entity to §501(c)(3) purposes and must not authorize substantial nonexempt activities. https://www.irs.gov/charities-non-profits/charitable-organizations/charity-required-provisions-for-organizing-documents. Exempt organizations remain subject to federal annual-return, public-disclosure, unrelated-business-income, private-benefit, lobbying, campaign-intervention, and excess-benefit rules; operating materially outside the exempt mission can jeopardize exemption. https://www.irs.gov/charities-non-profits/charitable-organizations and https://www.irs.gov/charities-non-profits/charitable-organizations/life-cycle-of-a-public-charity-jeopardizing-exemption.

Idaho’s principal charitable-asset enforcement authority is the Office of the Attorney General. The Idaho Charitable Assets Protection Act requires a charitable organization to notify the Attorney General before dissolving or terminating operations, converting to a noncharitable entity, or transferring, selling, or otherwise disposing of substantially all charitable assets, as stated in the Attorney General’s Idaho Code §48-1907(1) notice procedure at https://www.ag.idaho.gov/idaho-code-%C2%A7-48-19071-notice/. The Attorney General’s official frequently asked questions explain that the Act does not create a general statewide registration requirement for charitable organizations or professional solicitors. https://www.ag.idaho.gov/content/uploads/2020/05/ICAPA-Frequently-Asked-Questions.pdf. The office nevertheless receives charitable-organization complaints through https://www.ag.idaho.gov/consumer-protection/consumer-complaints/ and publishes fiduciary guidance for nonprofit directors at https://www.ag.idaho.gov/content/uploads/2018/04/ServiceOnNonprofit.pdf. The resulting Idaho compliance architecture is decentralized: corporate existence and annual records flow through the Secretary of State, federal exemption and information returns flow through the IRS, charitable assets and deceptive conduct fall within Attorney General jurisdiction, and specialized activities such as healthcare, childcare, housing, education, gambling, food distribution, professional services, and publicly funded social programs trigger additional agency and contract requirements.

The Idaho Community Foundation is the state’s central philanthropic intermediary and a major piece of Treasure Valley nonprofit infrastructure. It reports that it has distributed more than $220 million in grants and scholarships since 1988 and operates donor funds, competitive grantmaking, scholarships, planned-giving structures, regional funds, Idaho Gives, and nonprofit-capacity programs. https://www.idahocf.org/. Its Nonprofit Center supplies education, advocacy, community, operating resources, and membership infrastructure to more than 800 nonprofit members statewide. https://www.idahocf.org/nonprofit-center. Idaho Gives operates as a program of the Idaho Community Foundation and provides a shared discovery and fundraising environment for participating organizations. https://www.idahogives.org/search. The foundation’s Forever Idaho structure includes geographically and purpose-defined funds, including funds serving Ada and Canyon counties, converting philanthropic capital into place-based grantmaking rather than leaving local organizations dependent solely on direct donations or government contracts. https://www.idahocf.org/forever-idaho-funds.

United Way of Treasure Valley functions as a regional funder, convener, data-routing institution, and backbone organization linking health, education, housing, food access, family stability, and financial security. Its current public materials report that 221,724 children, families, and individuals received support through United Way-funded programs and identify the organization as the backbone of the Idaho Coalition for Community Schools. https://www.unitedwaytv.org/. The community-school initiative began in 2016 with four sites and treats schools as neighborhood service hubs where education connects directly to mental-health support, food, housing assistance, family services, and enrichment. United Way also leads the findhelpidaho.org partnership, a free and confidential resource-navigation system listing thousands of programs and recording hundreds of thousands of searches. https://www.unitedwaytv.org/. This model turns information infrastructure into community infrastructure: the organization does not merely finance providers but creates referral pathways among providers whose eligibility rules, service territories, and intake systems would otherwise remain fragmented.

The Idaho Foodbank is the dominant hunger-relief intermediary serving the Treasure Valley and the wider state. It reports serving approximately 179,000 people each month through more than 400 partners in all 44 Idaho counties, including church pantries, rescue missions, shelters, community kitchens, schools, and local food programs. https://idahofoodbank.org/. Its hunger analysis reports that 250,260 Idahoans, including 75,640 children, experienced food insecurity in 2023, representing statewide rates of 12.7 percent overall and 16.2 percent among children. https://idahofoodbank.org/hunger-in-idaho/. The same source identifies approximately 129,070 food-insecure residents and 40,170 food-insecure children across the defined Southwest Idaho service region, illustrating why Treasure Valley hunger response depends on a hub-and-network distribution model rather than independent pantry procurement. The Food Assistance Locator at https://idahofoodbank.org/get-help/getfood/ provides the public-facing access layer, while children’s programming connects food security to school attendance, learning, physical development, and family stability. https://idahofoodbank.org/wp-content/uploads/2025/10/IFB_childrens-programs_FINAL.pdf.

Food relief in the Treasure Valley is structurally connected to agriculture, meat processing, transportation, retail, education, and volunteer labor. The Idaho Foodbank’s Beef Counts program links cattle producers, livestock markets, the Idaho Cattle Association, Idaho CattleWomen, the Idaho Beef Council, Agri Beef, processors, donors, and emergency-food distributors in a system that converts donated livestock or cash into protein for households experiencing food insecurity. https://idahofoodbank.org/wp-content/uploads/2018/05/Beef-Counts-Impact-2017.pdf. Stamp Out Hunger links postal carriers and household donors to local pantry inventory by collecting shelf-stable food along delivery routes in the Treasure Valley and other Idaho communities. https://idahofoodbank.org/event/stamp-out-hunger/. Empty Bowls links artists, restaurants, Albertsons, donors, and hunger programs through a cultural fundraising event. https://idahofoodbank.org/empty-bowls-in-boise/. These relationships demonstrate that nonprofit food security depends on commercial logistics, agricultural surplus, cold and dry storage, school facilities, public transportation, donated labor, retail checkout campaigns, and reliable referral data rather than food donations alone.

Homelessness response is organized through a public-nonprofit continuum rather than a single shelter system. The City of Boise’s Our Path Home initiative coordinates prevention, emergency shelter, street outreach, health services, housing navigation, permanent housing, and trauma-informed case management with the stated objective of making homelessness rare, brief, and nonrecurring. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/homelessness/. The city’s Housing and Community Development division owns and operates income-qualified rental housing, works through partner organizations on homeownership and housing services, and administers federal and local housing resources. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/. Its annual public-service program distributes Community Development Block Grant funds to local organizations, with funding dependent upon the city’s allocation from the U.S. Department of Housing and Urban Development. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/public-services/. The city also subgrants HOME-American Rescue Plan funds through competitive notices to organizations providing supportive services for chronically homeless households. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/funding-opportunities/.

Boise’s 2025 program-year action plan identifies affordable housing as the city’s highest-priority community-development need and governs investment for homelessness, housing, and nonhousing community-development activities from October 1, 2025, through September 30, 2026. https://www.cityofboise.org/media/20125/py25-annual-action-plan-draft.pdf. Boise has administered Community Development Block Grant resources since the federal program’s creation under the Housing and Community Development Act of 1974 and HOME Investment Partnerships funding since receiving its first appropriation in 1992. https://www.cityofboise.org/media/19189/fy24-hud-pro-housing-application-for-comment.pdf. Nonprofits therefore operate inside a legal and financial chain connecting congressional appropriations, HUD regulations, municipal plans, competitive procurement, reimbursement rules, landlord and zoning law, data reporting, and direct client services. Organizations unable to satisfy federal documentation, procurement, nondiscrimination, environmental-review, financial-control, and performance-reporting requirements cannot function as interchangeable substitutes for established grantees even when they possess strong community support.

Interfaith Sanctuary represents the institutional evolution of emergency sheltering in Boise. It formed in 2005 following a crisis in which more than 200 people were displaced from Community House, and leaders from faith and conscience communities organized a replacement shelter response. https://interfaithsanctuary.org/blog/history-of-interfaith-sanctuary/ and https://interfaithsanctuary.org/blog/word-on-the-street-podcast-ep-2/. Its mission includes sheltering adults and families together without exclusion based on gender, race, religion, or sexual orientation and providing meals, safety, second chances, and supportive services. https://interfaithsanctuary.org/mission/. The Boise Faith Group, described as a coalition of nearly forty faith organizations that helped found the shelter, demonstrates how congregations function as volunteer, furnishing, donation, governance, and political-support infrastructure even when the operating nonprofit is institutionally separate from any single congregation. https://interfaithsanctuary.org/wp-content/uploads/2023/03/Word-on-the-Street_March_23.pdf. Shelter transportation connects homelessness services to hospitals, pharmacies, government identification, benefit enrollment, employment, and housing appointments. https://interfaithsanctuary.org/blog/transportation-at-interfaith-sanctuary/.

Affordable housing nonprofits occupy the intersection of charitable service, land use, construction, real estate finance, public subsidy, property management, and religious land ownership. The City of Boise’s housing programs depend on partner organizations to connect income-qualified households with affordable rentals and ownership opportunities. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/. Regional providers identified in Idaho Housing and Finance Association’s Southwest Idaho shelter and transitional-housing directory operate across Ada, Canyon, Boise, Elmore, Gem, Owyhee, Payette, Valley, and Washington counties. https://www.housingidaho.com/pdfs/ID_Southwest%203.pdf. Organizations historically identified within this system include CATCH in Boise, Advocates Against Family Violence–Hope’s Door in Caldwell, and Jesse Tree in Boise, which received Home Partnership Foundation support for homelessness-prevention work. https://www.idahohousing.com/news/1000-awarded-to-three-idaho-nonprofits-to-support-local-homeless-prevention-programs/. The sector’s binding constraints are not merely charitable demand but buildable land, zoning permission, construction costs, operating subsidies, rental assistance, case-management capacity, and long-term affordability controls.

Refugee and immigrant integration is coordinated through resettlement agencies, healthcare providers, schools, employers, housing organizations, faith communities, transportation providers, legal-services organizations, and volunteer coalitions. Neighbors United describes itself as a collaborative of individuals, community leaders, organizations, and companies strengthening refugee-resettlement resources across the Treasure Valley, with focus areas in housing, health, community connections, education, employment, and transportation. https://www.neighborsunitedboise.org/. This structure reflects the actual dependency graph of resettlement: housing cannot be stabilized without employment and transportation; employment cannot be stabilized without language access, childcare, documentation, and health support; school enrollment links children and parents to community institutions; and legal status determines access to work authorization and public programs. Catholic Charities of Idaho’s Treasure Valley Center is identified within the Immigration Advocates Network as providing or supporting immigration legal services and participating in national immigration-service networks. https://www.immigrationadvocates.org/nonprofit/volunteer/organization.392851-Catholic_Charities_of_Idaho_Treasure_Valley_Center.

Family preservation and child-welfare prevention include nonprofit programs designed to intervene before temporary crises become formal child-protection cases. Safe Families for Children–Treasure Valley surrounds families in crisis with volunteers who may supply basic goods, relationship support, or temporary host-family care while parents regain stability. https://lcsnw.org/program/safe-families-for-children-treasure-valley-idaho/. The model connects volunteer screening, churches, child safety, housing instability, behavioral health, transportation, employment, and material assistance. It occupies a preventive position between informal family support and state child-welfare intervention, showing why community-service classification must distinguish emergency material aid, licensed foster care, temporary voluntary hosting, legal guardianship, and formal protective custody rather than grouping all child placements under a single label.

Canyon County’s nonprofit landscape is strongly interwoven with county appropriations, community centers, public health, domestic-violence response, youth programs, veterans’ organizations, animal welfare, conservation districts, and national-service programs. County budget records from 2021 identify proposed or discussed support for Metro Community Services, National Service Programs of Jannus, Advocates Against Family Violence, the Canyon County Community Center, the Nampa Family Justice Center, the Canyon Soil Conservation District, the West Valley Humane Society, and other community entities. https://www.canyoncounty.id.gov/wp-content/uploads/2021/09/BP-JUN2021.pdf. The county’s parks, pathways, and cultural-resources planning process engaged local nonprofits, community-based organizations, recreation groups, tribal organizations, conservation interests, disability advocates, and municipal stakeholders. https://www.canyoncounty.id.gov/wp-content/uploads/2022/12/CC-Parks-Pathways-and-Cultural-Resources-Plan_DRAFT_11.29.pdf and https://www.canyoncounty.id.gov/elected-officials/commissioners/parks-cultural-natural-resources/parks-plan/. This creates cross-domain edges between community organizations and land management, historic preservation, active transportation, accessibility, tribal history, recreation, public health, and tourism.

Ada County’s community funding infrastructure includes ordinary county appropriations, public-health and justice systems, and temporary federal recovery programs. Ada County received $93,542,629 in State and Local Fiscal Recovery Funds under the American Rescue Plan Act, creating a major time-limited source of public capital for health, infrastructure, government operations, and community recovery. https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2025/07/ARPA-Recovery-Performance-Plan-2025.pdf. Earlier county reporting documented allocations for public-health services and administrative expenses associated with pandemic mitigation. https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2022/07/2022-ARPA-Recovery-Plan-Performance-Report.pdf. Nonprofit recipients and partners operating under such programs enter a public-accountability chain involving federal eligibility rules, county contracting, performance measures, expenditure deadlines, audit trails, procurement controls, and public-record exposure.

The Boise Metro Chamber is itself a nonprofit membership organization and illustrates the boundary between charitable organizations and tax-exempt business leagues. It describes its functions as advocacy, economic vitality, member education, networking, and regional business representation, reports more than 1,800 members and approximately 130,000 employees represented through member organizations, and operates alongside the Boise Valley Economic Partnership and Visit Boise. https://www.boisechamber.org/. Its role differs from a public charity because its primary constituency is the business community, yet its activities intersect with workforce development, civic leadership, philanthropy, transportation, housing, education, local-government policy, and nonprofit board recruitment. The IRS recognizes business leagues separately from §501(c)(3) charities, making entity subtype essential to any accurate regional knowledge graph. https://www.irs.gov/charities-and-nonprofits and https://www.irs.gov/charities-non-profits/exempt-organization-types.

The nonprofit workforce is occupationally heterogeneous. Executive directors, development officers, grant writers, accountants, attorneys, human-resource professionals, data analysts, communications personnel, volunteer coordinators, case managers, social workers, counselors, peer-support specialists, housing navigators, educators, food-logistics workers, drivers, facilities employees, healthcare personnel, and program evaluators operate under different educational, certification, licensure, and supervision requirements. Boise State University supplies a major regional education pipeline through more than 200 career-focused programs and an enrollment exceeding 28,000 students. https://www.boisestate.edu/. Nonprofit management itself generally has no Idaho occupational license, but regulated service delivery may require social-work, counseling, healthcare, childcare, education, food-safety, legal-practice, construction, or professional credentials. The practical labor pipeline therefore combines university and community-college education, professional licensing, internships, AmeriCorps and national service, faith-community volunteering, board service, continuing education, and organization-specific training. The Idaho Community Foundation Nonprofit Center’s training and advocacy functions provide sector-specific management capacity that degree programs and professional boards do not supply. https://www.idahocf.org/nonprofit-center.

Volunteer labor is a distinct infrastructure class rather than a costless substitute for employees. Food distribution, shelter operations, mentoring, refugee support, board governance, event production, fundraising, transportation, family hosting, neighborhood organizing, and disaster response require recruitment, screening, scheduling, training, insurance, supervision, retention, and safeguarding systems. Nonprofit directors remain fiduciaries responsible for organizational governance and should use professional legal and accounting advice where appropriate, according to the Idaho Attorney General’s board-service guidance. https://www.ag.idaho.gov/content/uploads/2018/04/ServiceOnNonprofit.pdf. Volunteer-heavy organizations therefore still require paid administrative capacity, risk management, background checks where vulnerable populations are involved, financial controls, data security, and clear separation between governance and day-to-day management.

The sector’s physical infrastructure includes shelters, food warehouses, kitchens, pantries, schools, clinics, community centers, affordable housing, offices, thrift stores, vehicles, donation-processing facilities, meeting spaces, cultural facilities, parks, and houses of worship. Its digital infrastructure includes donor databases, volunteer systems, client records, eligibility documentation, coordinated-entry platforms, accounting systems, case-management software, government grant portals, public resource directories, websites, social networks, and IRS Form 990 data. Its legal infrastructure includes nonprofit corporation law, federal exemption, charitable-asset protection, contracts, leases, zoning approvals, employment law, civil-rights obligations, insurance, safeguarding requirements, and professional licensing. Its financial infrastructure includes individual donations, foundation grants, corporate sponsorships, government reimbursements, fee-for-service revenue, membership dues, endowments, planned gifts, in-kind contributions, tax credits, donated land, fundraising events, and social-impact capital. Failure in any one layer can disable an otherwise effective direct-service program.

Healthcare and nonprofit services intersect through charitable hospitals, community clinics, mental-health providers, housing programs, food-security programs, disability organizations, and homelessness systems. Federal tax law treats qualifying nonprofit hospitals as charitable organizations only when they satisfy §501(c)(3)’s organizational and operational tests and the healthcare-specific community-benefit framework. https://www.irs.gov/charities-non-profits/charitable-hospitals-general-requirements-for-tax-exemption-under-section-501c3. In the Treasure Valley, homelessness services require hospital discharge coordination, prescription access, behavioral-health care, substance-use treatment, medical transportation, and permanent supportive housing; Interfaith Sanctuary’s transportation history explicitly describes taking shelter residents to hospitals, pharmacies, and the Department of Motor Vehicles. https://interfaithsanctuary.org/blog/transportation-at-interfaith-sanctuary/. United Way’s community-school and referral systems similarly connect health resources to education, housing, food, and family stability. https://www.unitedwaytv.org/.

Education and community services intersect through community schools, school pantries, youth mentoring, early-childhood services, parent support, language access, after-school activities, and college-service learning. United Way’s community-school structure treats the school building as an access point for mental-health care, housing help, food, education, and enrichment. https://www.unitedwaytv.org/. The Idaho Foodbank’s children’s programs treat inadequate nutrition as an educational and developmental problem rather than only a household-consumption problem. https://idahofoodbank.org/wp-content/uploads/2025/10/IFB_childrens-programs_FINAL.pdf. Boise State University contributes workforce training, research capacity, interns, volunteers, facilities, and institutional partnerships. https://www.boisestate.edu/. These connections imply that school districts, higher-education institutions, food providers, counseling organizations, parent groups, and housing agencies must be represented as linked entities when mapping educational outcomes.

Housing and land-use systems intersect with faith communities, nonprofit developers, local planning departments, lenders, contractors, property managers, and homelessness providers. Boise’s Housing and Community Development division governs municipal housing programs and channels federal resources to partner organizations. https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/. Interfaith Sanctuary’s State Street project required a conditional-use process for a shelter use that the organization described as unprecedented in Boise’s local development history. https://interfaithsanctuary.org/state-street-shelter/breaking-new-ground-learning-as-we-build/. This demonstrates that community need does not supersede planning law: a nonprofit may possess tax-exempt status, philanthropic capital, and service demand yet remain dependent on zoning classifications, conditional-use findings, neighborhood engagement, building codes, transportation access, utility capacity, financing, and litigation outcomes.

Arts and culture intersect with homelessness, fundraising, public identity, and social inclusion. Interfaith Sanctuary’s Homeless Art Collective began in 2019 after a shelter guest proposed using art to allow people experiencing homelessness to connect with the public through creative work rather than through the stigma of housing status. https://interfaithsanctuary.org/blog/art-on-the-street-a-documentary/. The Idaho Foodbank’s Empty Bowls event uses handmade and painted bowls, local food, retail partnership, and public participation to finance hunger relief. https://idahofoodbank.org/empty-bowls-in-boise/. Canyon County’s cultural-resources planning joins nonprofits, tribes, recreation groups, accessibility advocates, public agencies, and preservation interests. https://www.canyoncounty.id.gov/wp-content/uploads/2022/12/CC-Parks-Pathways-and-Cultural-Resources-Plan_DRAFT_11.29.pdf. Cultural activity therefore functions as direct programming, therapeutic practice, public education, fundraising infrastructure, placemaking, and historical preservation.

Environmental and recreation nonprofits connect community organizing to public land, transportation, tourism, health, and cultural preservation. Canyon County’s planning documentation identifies participation by organizations including Living Independence Network Corporation, the Southwest Idaho Mountain Biking Association, the Upper Snake River Tribes Foundation, the U.S. Fish and Wildlife Service, bicycle and pedestrian committees, trail groups, and other stakeholders. https://www.canyoncounty.id.gov/elected-officials/commissioners/parks-cultural-natural-resources/parks-plan/. The resulting network is not limited to recreation advocacy; it links accessibility, tribal history, wildlife management, trail construction, active transportation, rural land use, tourism, public health, and county capital planning.

The historical development of Treasure Valley nonprofits follows recurring waves: religious congregations and mutual-aid traditions supplied early charity and community support; twentieth-century service clubs, hospitals, educational institutions, cultural organizations, and national federated charities institutionalized philanthropy; federal housing, anti-poverty, nutrition, disability, aging, public-health, and community-development programs expanded the contract-funded service layer; population growth and metropolitan expansion increased demand for housing, transportation, refugee integration, food relief, behavioral health, and family support; and digital referral, crowdfunding, donor-advised funds, coordinated entry, and impact reporting created an information-intensive operating environment. The Idaho Community Foundation’s establishment in 1988 and subsequent statewide grantmaking created durable philanthropic intermediation. https://www.idahocf.org/. Boise’s receipt of HOME funds beginning in 1992 deepened the municipal-nonprofit housing partnership. https://www.cityofboise.org/media/19189/fy24-hud-pro-housing-application-for-comment.pdf. Interfaith Sanctuary’s 2005 formation followed a shelter crisis. https://interfaithsanctuary.org/blog/history-of-interfaith-sanctuary/. United Way’s community-school initiative began in 2016. https://www.unitedwaytv.org/. These dates mark the conversion of informal charitable responses into specialized, data-bearing institutions connected to public funding and regional planning.

The strongest regional classification model treats every organization as a typed entity with attributes for legal form, Internal Revenue Code subsection, Secretary of State status, service geography, mission domain, populations served, facilities, programs, government contracts, licenses, funders, referral partners, board members, parent or affiliate relationships, fiscal sponsorship, data systems, and historical events. Relationships should be represented as explicit edges such as funds, subgrants, contracts-with, refers-to, licenses, regulates, owns, leases, operates, fiscally-sponsors, supplies, distributes-through, trains, volunteers-for, advocates-before, shares-facility-with, and participates-in-coalition. A food pantry supplied by the Idaho Foodbank is not equivalent to the Idaho Foodbank; a city-funded shelter is not a city department; a church participating in a shelter coalition is not necessarily the shelter’s legal parent; a §501(c)(6) chamber is not a §501(c)(3) charity; a fiscally sponsored project is not necessarily an independent corporation; and a nonprofit healthcare system is simultaneously a charitable corporation, regulated healthcare provider, major employer, landowner, purchaser, and community-benefit institution.

The operational health of the Treasure Valley nonprofit sector depends on stable unrestricted revenue, competent boards, trained employees, reliable volunteers, affordable facilities, functioning referral networks, government reimbursement, philanthropic trust, legal compliance, and accurate public data. Restricted grants may finance programs without financing accounting, technology, executive leadership, insurance, maintenance, fundraising, cybersecurity, or reserves. Rapid regional growth raises demand while increasing rent, wages, construction costs, transportation distances, and competition for skilled staff. Organizations addressing housing, hunger, health, migration, domestic violence, disability, youth, aging, culture, recreation, and environmental stewardship therefore operate as interdependent nodes in the same regional resilience system. The sector’s defining strategic problem is not an absence of organizations but fragmentation among eligibility systems, funding streams, jurisdictions, records, and service pathways; the defining knowledge-graph opportunity is to make those relationships visible, current, typed, and verifiable.

https://www.irs.gov/charities-and-nonprofits — Federal overview of charities, foundations, social-welfare organizations, civic leagues, business leagues, and other tax-exempt entities.

https://www.irs.gov/charities-non-profits/exempt-organization-types — IRS classification page describing major categories of exempt organizations.

https://www.irs.gov/charities-non-profits/charitable-organizations/exemption-requirements-501c3-organizations — Federal organizational, operational, private-benefit, and inurement requirements for §501(c)(3) status.

https://www.irs.gov/charities-non-profits/charitable-organizations/exempt-purposes-internal-revenue-code-section-501c3 — Official list of purposes recognized as exempt under §501(c)(3).

https://www.irs.gov/charities-non-profits/application-for-recognition-of-exemption — IRS procedure and timing rules for applying for recognition through the Form 1023 series.

https://www.irs.gov/charities-non-profits/charitable-organizations/charity-required-provisions-for-organizing-documents — IRS requirements for exempt-purpose limitations in nonprofit organizing documents.

https://www.irs.gov/charities-non-profits/charitable-organizations/life-cycle-of-a-public-charity-jeopardizing-exemption — IRS explanation of activities that can jeopardize a public charity’s exemption.

https://www.irs.gov/charities-non-profits/churches-integrated-auxiliaries-and-conventions-or-associations-of-churches — Federal treatment of churches and related religious organizations under §501(c)(3).

https://www.irs.gov/charities-non-profits/charitable-hospitals-general-requirements-for-tax-exemption-under-section-501c3 — Federal exemption and community-benefit requirements applicable to nonprofit hospitals.

https://sos.idaho.gov/business-forms/ — Idaho Secretary of State forms for corporations, nonprofit entities, amendments, dissolutions, and related filings.

https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Incorp%20nonprofit.pdf — Official Idaho nonprofit articles-of-incorporation form and statutory instructions.

https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Amend%20NonProfit.pdf — Official form for amending an Idaho nonprofit corporation’s articles.

https://sos.idaho.gov/CORP/forms/CORP/Art%20of%20Dissolution%20Nonprofit.pdf — Official form and instructions for dissolving an Idaho nonprofit corporation.

https://sos.idaho.gov/business-services-resources/business-entities-faq/ — Idaho Secretary of State guidance on nonprofit formation and federal exemption clauses.

https://sos.idaho.gov/business-services-resources/business-entity-publications/ — Idaho publications covering nonprofit corporations, unincorporated nonprofit associations, and related entity law.

https://sos.idaho.gov/business-services-resources/ — Idaho business-record, filing, trademark, and entity-search resources.

https://sos.idaho.gov/annual-report-help/ — Idaho Secretary of State guidance concerning annual reports.

https://www.ag.idaho.gov/idaho-code-%C2%A7-48-19071-notice/ — Attorney General notice procedure under the Idaho Charitable Assets Protection Act.

https://www.ag.idaho.gov/content/uploads/2020/05/ICAPA-Frequently-Asked-Questions.pdf — Official explanation of Idaho charitable-asset law and the absence of a general charitable-registration requirement.

https://www.ag.idaho.gov/content/uploads/2018/04/ServiceOnNonprofit.pdf — Idaho Attorney General guidance for nonprofit directors and boards.

https://www.ag.idaho.gov/consumer-protection/consumer-complaints/ — Idaho Attorney General portal for charitable-organization and other consumer complaints.

https://www.idahocf.org/ — Idaho Community Foundation grantmaking, scholarships, donor funds, and statewide philanthropic history.

https://www.idahocf.org/nonprofit-center — Training, advocacy, membership, and capacity-building resources for Idaho nonprofits.

https://www.idahocf.org/forever-idaho-funds — Place-based and purpose-specific Idaho Community Foundation funds.

https://www.idahogives.org/search — Idaho Gives nonprofit discovery and fundraising portal.

https://www.unitedwaytv.org/ — United Way of Treasure Valley programs, community-school backbone work, referral infrastructure, and impact data.

https://idahofoodbank.org/ — Idaho Foodbank statewide distribution network, partner system, and organizational information.

https://idahofoodbank.org/hunger-in-idaho/ — Idaho and Southwest Idaho food-insecurity statistics derived from Map the Meal Gap.

https://idahofoodbank.org/get-help/getfood/ — Public food-assistance locator for Idaho Foodbank partner resources.

https://idahofoodbank.org/wp-content/uploads/2025/10/IFB_childrens-programs_FINAL.pdf — Idaho Foodbank description of child hunger and children’s nutrition programs.

https://idahofoodbank.org/wp-content/uploads/2018/05/Beef-Counts-Impact-2017.pdf — Impact report describing the agricultural, livestock, processing, and charitable partnership behind Beef Counts.

https://idahofoodbank.org/event/stamp-out-hunger/ — Treasure Valley and statewide postal food-collection partnership information.

https://idahofoodbank.org/empty-bowls-in-boise/ — Boise Empty Bowls arts-and-hunger fundraising program.

https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/ — City of Boise housing programs and nonprofit-partner structure.

https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/homelessness/ — Our Path Home homelessness-response system and service continuum.

https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/public-services/ — Boise Community Development Block Grant public-service funding program.

https://www.cityofboise.org/departments/planning-and-development-services/housing-and-community-development/funding-opportunities/ — Boise competitive housing and supportive-service funding opportunities.

https://www.cityofboise.org/media/20125/py25-annual-action-plan-draft.pdf — Boise program-year 2025 housing and community-development investment plan.

https://www.cityofboise.org/media/19189/fy24-hud-pro-housing-application-for-comment.pdf — Boise housing history, federal funding background, barriers, and proposed reforms.

https://interfaithsanctuary.org/blog/history-of-interfaith-sanctuary/ — Account of Interfaith Sanctuary’s formation following Boise’s 2005 shelter crisis.

https://interfaithsanctuary.org/blog/word-on-the-street-podcast-ep-2/ — Additional history of the coalition response that created Interfaith Sanctuary.

https://interfaithsanctuary.org/mission/ — Interfaith Sanctuary’s mission, populations served, and shelter model.

https://interfaithsanctuary.org/wp-content/uploads/2023/03/Word-on-the-Street_March_23.pdf — Description of Boise Faith Group participation and shelter-related community programs.

https://interfaithsanctuary.org/blog/transportation-at-interfaith-sanctuary/ — History of transportation services linking shelter guests to healthcare, prescriptions, identification, and programs.

https://interfaithsanctuary.org/state-street-shelter/breaking-new-ground-learning-as-we-build/ — Description of the State Street shelter development and conditional-use process.

https://interfaithsanctuary.org/blog/art-on-the-street-a-documentary/ — History of the Homeless Art Collective and its role in social inclusion.

https://www.housingidaho.com/pdfs/ID_Southwest%203.pdf — Southwest Idaho directory of emergency shelters and transitional-housing providers.

https://www.idahohousing.com/news/1000-awarded-to-three-idaho-nonprofits-to-support-local-homeless-prevention-programs/ — Historical funding record naming Boise and Caldwell homelessness-prevention organizations.

https://www.neighborsunitedboise.org/ — Treasure Valley refugee-resettlement coalition and its housing, health, education, employment, and transportation focus areas.

https://www.immigrationadvocates.org/nonprofit/volunteer/organization.392851-Catholic_Charities_of_Idaho_Treasure_Valley_Center — Immigration legal-services network profile for Catholic Charities of Idaho’s Treasure Valley Center.

https://lcsnw.org/program/safe-families-for-children-treasure-valley-idaho/ — Treasure Valley voluntary family-support and child-hosting program.

https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2025/07/ARPA-Recovery-Performance-Plan-2025.pdf — Ada County’s 2025 American Rescue Plan recovery and expenditure reporting.

https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2022/07/2022-ARPA-Recovery-Plan-Performance-Report.pdf — Ada County’s earlier recovery-fund allocations and public-health spending.

https://www.canyoncounty.id.gov/wp-content/uploads/2021/09/BP-JUN2021.pdf — Canyon County budget proceedings identifying community organizations and proposed public support.

https://www.canyoncounty.id.gov/elected-officials/commissioners/parks-cultural-natural-resources/parks-plan/ — Canyon County parks, pathways, cultural-resources, nonprofit, tribal, and recreation stakeholders.

https://www.canyoncounty.id.gov/wp-content/uploads/2022/12/CC-Parks-Pathways-and-Cultural-Resources-Plan_DRAFT_11.29.pdf — Canyon County planning document showing community-based and nonprofit participation.

https://www.boisechamber.org/ — Boise Metro Chamber’s nonprofit membership, advocacy, economic-development, and regional-convening functions.

https://www.boisestate.edu/ — Boise State University enrollment, educational programs, and regional workforce-pipeline information.

Treasure Valley Habitat for Humanity operates at the boundary between nonprofit housing, mortgage finance, volunteer construction, neighborhood stabilization, and municipal community development rather than functioning only as a homebuilding charity. The organization serves Ada and Canyon counties through affordable homeownership, critical home repairs, community cleanups, and beautification work, which means its service graph extends from household underwriting and construction materials to permitting, skilled trades, donated labor, land acquisition, and long-term owner occupancy https://tvhabitat.org/. Habitat’s repair activity preserves existing affordable units that would otherwise be lost through deferred maintenance, while its homeownership activity creates permanently rooted households; this distinction connects housing nonprofits to aging-in-place services, property-tax stability, neighborhood code compliance, and workforce housing rather than only to emergency homelessness.

The Home Partnership Foundation is a specialized housing-finance intermediary created within Idaho Housing and Finance Association’s institutional ecosystem to support shelters, homelessness prevention, eviction avoidance, economic independence, workforce housing, and tax-advantaged land donations https://www.idahohousing.com/about/foundation/. Its land-donation function establishes a direct edge between charitable estate planning and affordable-housing development because donated real property can reduce one of the largest costs in a housing project, while its eviction-prevention work establishes a direct edge between small emergency grants and reduced shelter demand. Housing nonprofits serving the Treasure Valley therefore operate on different positions along the housing continuum: some finance land and predevelopment, some construct or repair units, some subsidize rent, some negotiate with landlords, some provide legal defense, and some operate shelters.

Idaho Legal Aid Services supplies the civil-law layer that material-assistance organizations cannot replace. The organization provides civil legal help to low-income people, older adults, survivors, and other vulnerable Idaho residents when legal problems threaten housing, safety, healthcare, income, or financial stability https://idaholegalaid.org/. A household facing an unlawful eviction, benefits termination, consumer debt action, protection-order issue, or title defect may not be stabilized by food, rent assistance, or case management unless the underlying legal problem is resolved; this makes civil legal aid a receiving node for referrals from shelters, hospitals, domestic-violence organizations, senior-service providers, food programs, and housing navigators.

Faces of Hope operates a specialized survivor-services resource environment that links violence intervention to emergency housing, legal help, food assistance, healthcare, and mental-wellbeing services https://facesofhopeidaho.org/get-help/community-resources.html. Its resource architecture demonstrates that domestic and sexual violence are not isolated criminal-justice categories: violence can simultaneously produce homelessness, employment disruption, immigration complications, healthcare needs, child-custody disputes, and food insecurity. The originating-side fact that survivors require integrated assistance is reflected in the organization’s multi-domain resource categories https://facesofhopeidaho.org/get-help/community-resources.html, while the receiving-side legal infrastructure is supplied by Idaho Legal Aid Services’ housing, safety, health, and financial-stability practice https://idaholegalaid.org/. The graph implication is that domestic-violence response must connect law enforcement and prosecution records to confidential nonprofit services without exposing survivor location, identity, or intake data.

Area 3 Senior Services Agency serves as Southwest Idaho’s Area Agency on Aging and connects federal and state aging funds to older residents and family caregivers across the region https://www.a3ssa.com/. Its position differs from a direct-service senior center because an Area Agency on Aging performs planning, coordination, access, referral, and funding functions across a geographic service area. This creates edges to transportation, nutrition, caregiver respite, legal services, disability access, healthcare, long-term care, and elder-abuse prevention. The agency’s regional mandate also means that Treasure Valley senior services cannot be mapped only by Boise addresses; rural Canyon, Gem, Payette, Owyhee, Washington, Adams, Boise, Valley, and Elmore County residents may rely on the same administrative network while encountering materially different transportation and provider-access constraints.

Idaho Division of Veterans Services provides the government-side benefits, advocacy, education support, veterans-home, cemetery, outreach, and resource infrastructure to which nonprofit veteran organizations connect https://veterans.idaho.gov/. The distinction between government entitlement navigation and privately funded charitable assistance is operationally significant: a veterans nonprofit may provide emergency cash, peer support, transportation, housing assistance, or service-dog access, while the state division connects eligible veterans to statutory benefits, long-term-care institutions, burial services, and formal advocacy. Canyon County’s Treasure Valley Veterans Resource and Services Guide documents a broad regional network spanning employment, housing, transportation, legal, health, education, recreation, family, and emergency services https://www.canyoncounty.id.gov/wp-content/uploads/2016/05/Treasure-Valley-Veterans-Resource-Services-Guide.pdf. The guide’s age does not establish current provider status for every listed entry, but it remains an institutional record of how veteran support was already organized as a cross-sector referral system rather than as a single-purpose charity.

Safe Families for Children–Treasure Valley represents a specialized preventive model in which screened volunteers and host families support parents experiencing short-term crises before instability escalates into formal child-welfare involvement https://lcsnw.org/location/idaho/. The Treasure Valley program began serving Idaho families in 2019 and is operated within Lutheran Community Services Northwest’s broader regional structure https://lcsnw.org/location/idaho/. This organizational form illustrates nonprofit consolidation without private equity: a locally delivered program can operate under a multi-state nonprofit parent, sharing compliance, fundraising, insurance, safeguarding, finance, and executive infrastructure while maintaining local volunteer relationships. The local market implication is that an apparent Treasure Valley operator may not be an independent Idaho corporation, and entity records should distinguish the program name, legal parent, service location, fiscal structure, and national affiliate.

The Idaho Youth Ranch occupies a vertically integrated youth-services position because it combines behavioral-health and family services with a statewide donated-goods and thrift-retail network. Its model links consumer retail, donated inventory, logistics, property occupancy, youth employment preparation, behavioral-health staffing, and charitable fundraising. The organization’s Hands of Promise campus near Caldwell also places specialized youth treatment and equine-supported programming within Canyon County’s agricultural and exurban landscape, creating a direct land-use connection between therapeutic services and large-acreage facilities. The workforce implications extend beyond counselors to retail managers, donation attendants, truck drivers, facilities workers, animal-care personnel, case managers, educators, and licensed clinicians, meaning nonprofit labor data that counts only social-service occupations understates the sector’s operational workforce.

Genesis Community Health, Terry Reilly Health Services, and other safety-net medical providers appear in College of Western Idaho’s institutional resource materials as healthcare and social-service access points for students and community members https://cwi.edu/students/support-resources/counseling-wellness-services/safety-net-resources. The listing identifies Genesis as providing free medical, dental, mental-health, or social services to uninsured or lower-income residents and identifies Terry Reilly Health Services as an affordable comprehensive healthcare provider with Treasure Valley locations https://cwi.edu/students/support-resources/counseling-wellness-services/safety-net-resources. This creates a sourced edge from higher education to community healthcare: colleges are not merely workforce suppliers but also referral nodes for students whose housing, food, mental-health, insurance, or medical instability can interrupt educational completion.

St. Luke’s Foundation–Treasure Valley channels charitable giving into the regional St. Luke’s health mission https://stlukesonline.org/en/giving/our-foundations/treasure-valley-foundation/. Hospital foundations differ from independent grantmaking foundations because their capital is institutionally aligned with a healthcare system’s facilities, clinical programs, patient support, technology, and community-health priorities. This produces a concentration dynamic in which philanthropic gifts, naming opportunities, volunteer auxiliaries, and donor relationships reinforce the capital capacity of an already large healthcare institution. The market implication is not conventional private-equity ownership but philanthropic consolidation: donors who once might have supported small independent health charities can be recruited into system-affiliated foundations with professional fundraising operations and access to patient and physician networks.

The Idaho Community Foundation’s absorption of the Idaho Nonprofit Center created a major consolidation in statewide nonprofit infrastructure. The organizations announced their combination in 2024 to combine grantmaking, training, advocacy, and sector-support capacity, according to contemporaneous reporting at https://boisedev.com/news/2024/10/09/stronger-together-idaho-nonprofit-center-idaho-community-foundation-merge/. The resulting structure reduces the number of independent statewide intermediaries while concentrating nonprofit education, membership, convening, philanthropy, and advocacy inside a single institution. This consolidation can lower duplicated administration and give nonprofits a stronger statewide platform, but it also means one organization occupies more of the infrastructure through which training, funding relationships, sector data, and policy representation flow.

The College of Western Idaho social-work program supplies an associate-level workforce pathway grounded in social-welfare policy, human rights, social justice, culturally responsive practice, theory, research-informed practice, and helping-process instruction https://catalog.cwi.edu/programs-study/social-work/. CWI announced social work as a new degree program in 2020 alongside occupational-therapy assistant and fire-service management https://cwi.edu/news/cwi-announces-three-new-programs. This timing connects regional population growth and increasing service-system complexity to a local effort to produce entry-level and transfer-ready practitioners closer to Ada and Canyon County employers. Students can enter case-management, residential support, community outreach, behavioral-health technician, family-services, and administrative roles or transfer into bachelor-level professional education.

CWI’s service-learning partnerships turn nonprofit organizations into training sites rather than treating community engagement as extracurricular activity. Students in child and adolescent development courses completed more than 1,000 hours of service learning across community partnerships and independent projects during one semester, with the institution explicitly connecting that work to preparation for social-service and psychology careers https://cwi.edu/news/cwi-students-strengthen-families-through-service-learning-partnership. This establishes a workforce edge in which nonprofits receive supervised labor and project capacity while students receive field exposure, references, occupational knowledge, and contact with potential employers. The arrangement also shifts supervisory burden onto participating organizations, which must design appropriate work, protect client confidentiality, and distinguish student learning from unpaid replacement of regular staff.

Boise State University’s nonprofit-management minor comprises twenty-one credits, while its nonprofit-management certificate comprises twelve credits focused on nonprofit management and community-development work https://www.boisestate.edu/cobe-management/undergraduate-programs/nonprofit-management-minor-certificate/. The programs were introduced for launch in fall 2024 within Boise State Online’s business curriculum https://www.boisestate.edu/online/2024/04/04/boise-state-online-introduces-nonprofit-management-certificate-and-accountancy-minor/. Their placement inside the College of Business and Economics connects nonprofit administration to accounting, human resources, operations, finance, marketing, and organizational strategy rather than confining it to social work. This distinction matters because nonprofit executive failure often originates in governance, budgeting, cash flow, contracts, cybersecurity, fundraising systems, and personnel management rather than deficient commitment to mission.

Boise State’s Master of Public Administration prepares leaders for public and nonprofit organizations and grounds them in the theory and practice of public management https://www.boisestate.edu/sps-publicpolicy/mpa-student-handbook/. The curriculum requires an internship unless a student can document qualifying substantive administrative, professional, or management experience in or with the public or nonprofit sector https://www.boisestate.edu/sps-publicpolicy/resources/degree-requirements/. This structure creates a direct labor-market bridge between graduate education and Treasure Valley agencies because municipal departments, state agencies, foundations, advocacy groups, and direct-service nonprofits can function as training environments. It also reinforces the regional circulation of personnel between government and nonprofits, where the same practitioner may move among grant administration, public policy, program evaluation, advocacy, contracting, and executive leadership.

Boise State’s Master of Social Work requires forty-three credits of academic classes, laboratories, and seminars plus eighteen credits representing 1,000 hours of supervised field practicum for regular-standing students https://www.boisestate.edu/socialwork/students/msw-student-handbook/. The program’s mission encompasses practice with individuals, families, groups, organizations, and communities and explicitly incorporates human rights and social, economic, and environmental justice https://www.boisestate.edu/online/online-master-of-social-work/msw-online-student-handbook/. Field agencies must provide students with opportunities to practice assessment, engagement, intervention, community work, management, and policy activity rather than assigning only clerical tasks https://www.boisestate.edu/socialwork/fieldwork/agency-faqs/. This makes nonprofit agencies part of the credential-production system: they supply supervised cases and organizational exposure, while the university supplies curricular standards and faculty oversight.

The Idaho social-work labor pipeline is constrained by professional licensure rather than degree completion alone for positions using protected clinical or licensed titles. Idaho’s governing statute is Title 54, Chapter 32, which establishes the state’s social-work licensing framework at https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch32/. The statute creates legal distinctions among levels of practice and places licensing authority in the state’s occupational and professional licensing structure. A nonprofit may employ unlicensed outreach workers, navigators, peers, and case aides, but it cannot treat those roles as interchangeable with independently licensed clinical practice. This regulatory fact connects directly to wage and recruitment pressure because organizations delivering Medicaid-funded, mental-health, child-welfare, or clinical services compete for a limited credentialed workforce rather than for the entire pool of mission-oriented applicants.

Professional counseling in Idaho is governed by Title 54, Chapter 34, which establishes licensure requirements and legal authority for counselors and marriage and family therapists https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch34/. Behavioral-health nonprofits that advertise counseling, psychotherapy, marriage and family therapy, diagnosis, or clinical supervision must therefore map each service to an authorized practitioner class. The implication is structural: a charitable corporation’s federal tax status does not exempt it from professional-practice law, and a volunteer-driven organization cannot expand into clinical treatment merely by changing its program description.

Idaho charitable gaming is regulated as gambling activity rather than ordinary fundraising whenever prize, chance, and consideration are present. The Idaho Lottery states that only qualifying charitable organizations may conduct regulated raffles and that charitable-gaming eligibility and operation are controlled by Title 67, Chapter 77, Idaho Code https://www.idaholottery.com/charitable-gaming/faqs. Current administrative rules provide that organizations conducting low-stakes bingo below $10,000 in annual gross sales can be exempt from licensing, and statutory exemptions also apply to certain raffle activity https://www.law.cornell.edu/regulations/idaho/IDAPA-52.01.03.507. Idaho’s tax authority separately warns schools and nonprofit fundraisers that the Lottery Commission regulates raffles and bingo and that organizations may face licensing, background-check, fee, and charitable-proceeds requirements https://tax.idaho.gov/search-category/sales-tax/government-education-nonprofit/. This means a fundraiser marketed as a community event can trigger gaming regulation even when all proceeds support a charity.

Idaho sales-tax treatment does not provide a blanket exemption to nonprofit organizations. The Idaho State Tax Commission maintains a dedicated government, education, and nonprofit guidance category because exemptions depend on the transaction, purchaser, seller, and statutory rule rather than merely on possession of §501(c)(3) status https://tax.idaho.gov/search-category/sales-tax/government-education-nonprofit/. A Treasure Valley nonprofit operating a thrift store, selling event admissions, purchasing construction materials, distributing promotional goods, or conducting an auction must therefore classify each transaction correctly. The graph implication is that retail programs and fundraising events connect nonprofit organizations to the same sales-tax, point-of-sale, inventory, and consumer-protection infrastructure used by commercial firms.

Idaho’s SNAP rules govern household food-assistance eligibility and therefore shape demand for nonprofit food programs. IDAPA 16.03.04 identifies the Idaho Food Stamp Program as the state’s implementation of the Supplemental Nutrition Assistance Program for households whose limited purchasing power contributes to hunger and malnutrition https://adminrules.idaho.gov/rules/current/16/160304.pdf. Food pantries and meal programs operate outside SNAP’s electronic-benefit system, but their clients’ needs are affected by SNAP eligibility, benefit amounts, recertification, household composition, and administrative interruptions. The sourced implication is that nonprofit hunger statistics should not be treated as an independent measure of food need without connecting them to public-benefit enrollment and policy.

Nampa’s Community Development Block Grant program accepts annual applications from community organizations for projects principally benefiting low- and moderate-income residents https://www.cityofnampa.us/159/Community-Development-Block-Grant. Nampa’s 2026 application guidelines impose eligibility, documentation, schedule, and program requirements on applicants rather than operating as unrestricted local philanthropy https://www.cityofnampa.us/DocumentCenter/View/20262/2026-City-of-Nampa---Application-Guidelines---Final. The city’s five-year consolidated-plan process is federally required for jurisdictions receiving CDBG funds and determines local priorities and strategic goals https://www.cityofnampa.us/1131/5-Year-Consolidated-Plan-Process. A nonprofit’s local funding opportunity is therefore controlled by a federal-to-municipal chain: congressional appropriation and HUD rules shape Nampa’s plan, Nampa defines eligible priorities, and community organizations compete to implement projects.

Nampa’s 2024 annual action plan allocated $1,015,934.94 in CDBG resources for the October 1, 2024, through September 30, 2025, program year https://www.cityofnampa.us/DocumentCenter/View/18397/2024-Annual-Action-Plan---06-25-24-Draft. Its 2025 plan documents the city’s continuing administrative responsibility for planning and oversight of CDBG resources https://www.cityofnampa.us/DocumentCenter/View/19579/2025-Annual-Action-Plan---Draft. This produces a municipal market for nonprofit services, facility improvements, neighborhood projects, housing activities, and assistance to low- and moderate-income residents, but organizations entering that market must accept public-record, monitoring, reimbursement, civil-rights, environmental-review, and procurement obligations that do not accompany ordinary private donations.

Nampa’s analysis of impediments to fair housing links nonprofit housing work to discrimination law, zoning, lending, disability access, language access, and public education https://www.cityofnampa.us/DocumentCenter/View/14882/AI-NAMPA-220620. Fair-housing barriers can cause households to seek emergency nonprofit assistance even when the originating problem is discriminatory treatment by a landlord, inaccessible housing, lending disparities, or a shortage of units in appropriate locations. The receiving-side implication is that housing counseling, legal aid, disability advocacy, and municipal code reform must be represented as connected interventions rather than separate service categories.

Boise’s Shelter Better Task Force identified zoning rules as a direct determinant of where present and future shelters could operate and recommended addressing shelters in the city’s zoning code https://www.cityofboise.org/media/13257/shelterbettertaskforce_report.pdf. Boise’s current 2026–2030 consolidated-plan draft records continuing housing instability, shelter use, zoning amendments, and community testimony regarding affordability https://www.cityofboise.org/media/21312/boise-2026-2030-consolidated-plan_final-draft-2nd-pub-comment.pdf. The historical connection is direct: earlier shelter operators faced a zoning framework not designed around modern low-barrier and service-enriched shelter models, while later municipal planning incorporates shelter siting and housing supply into formal land-use policy. Nonprofit homelessness capacity is therefore partly manufactured or constrained by zoning text, hearing procedures, parking requirements, neighborhood opposition, transit access, and conditional-use standards.

Boise’s recent fair-housing analysis identifies regulatory and market barriers affecting access to housing and evaluates the city’s zoning reforms in relation to housing affordability and choice https://www.cityofboise.org/media/20004/city-of-boise-analysis-of-impediments.pdf. Nonprofit housing organizations can provide counseling, subsidy, legal aid, or development capacity, but they cannot independently correct exclusionary land-use patterns, unit shortages, inaccessible design, or landlord discrimination. The originating-side regulatory analysis and the receiving-side Habitat model connect at the point where new or preserved units must be legally buildable and financially attainable: Boise’s policy environment shapes supply https://www.cityofboise.org/media/20004/city-of-boise-analysis-of-impediments.pdf, while Treasure Valley Habitat converts land, labor, financing, and applicants into owner-occupied housing https://tvhabitat.org/.

Idaho Commerce’s Community Development Block Grant program funds eligible Idaho communities for infrastructure, public facilities, disaster recovery, and downtown activities that benefit at least 51 percent low- and moderate-income people or address qualifying slum, blight, or urgent-need conditions https://commerce.idaho.gov/communities/grants/cdbg/. This state-administered program creates an upstream infrastructure edge to nonprofits because water systems, wastewater, streets, community centers, shelters, and public facilities determine whether social programs can physically operate. Rural communities outside direct HUD entitlement jurisdictions may depend on Idaho Commerce’s competitive allocation, while Boise and Nampa administer their own entitlement programs.

The City of Nampa’s development-impact fees fund growth-related police, parks, streets, fire, sewer, water, and pressurized-irrigation capital improvements associated with new development https://www.cityofnampa.us/1261/Development-Impact-Fees. These fees connect nonprofit facility development to the broader cost of urban growth because a nonprofit constructing housing, childcare, healthcare, recreation, or community space may encounter the same development-cost environment as a commercial project unless a specific exemption or credit applies. The resulting market structure favors established organizations with capital reserves, experienced development teams, and access to tax-credit or philanthropic financing over small organizations attempting to establish their first permanent facility.

Nampa Development Corporation uses tax-increment financing and urban-renewal authority to finance infrastructure and catalyze redevelopment in designated areas https://www.cityofnampa.us/100/Nampa-Development-Corporation. Its business-assistance tools can support infrastructure, rehabilitation, and redevelopment activities that alter the location economics of community facilities https://www.cityofnampa.us/903/Business-Assistance. Nonprofit organizations are affected even when they are not direct recipients because urban-renewal investment can increase accessibility, property values, tenant demand, and redevelopment pressure around existing nonprofit sites. The graph edge between urban renewal and nonprofit displacement must therefore be tested property by property rather than assumed to be either uniformly beneficial or harmful.

North Nampa’s opportunity-zone designation was promoted as a mechanism for attracting investment into an older neighborhood facing floodway constraints and aging structures https://www.cityofnampa.us/1248/Opportunity-Zone-North-Nampa. Opportunity-zone capital is private investment seeking tax advantages, not charitable grant funding, but it can intersect with nonprofit affordable housing, community facilities, workforce programs, and neighborhood organizations. The consolidation risk is that well-capitalized investment entities can acquire land more quickly than community organizations, while the opportunity is that nonprofit-controlled projects may partner with qualified funds when project economics and mission controls align.

The consumer-facing discovery layer for nonprofits is fragmented among government directories, referral platforms, tax records, search engines, social networks, review sites, donation portals, and specialized legal directories. Findhelp displays geographically filtered programs for residents seeking housing, legal, food, health, and other assistance, including location-specific search results for Caldwell and Boise https://www.findhelp.org/housing/all?cursor=40&limit=10&postal=83607 and https://www.findhelp.org/legal/advocacy-%26-legal-aid--boise-id. Immigration Advocates Network provides a specialized legal-services directory that identifies Catholic Charities of Idaho’s Treasure Valley Center, its service location, appointment practices, and immigration representation for eligible survivors https://www.immigrationadvocates.org/legaldirectory/organization.392851-Catholic_Charities_of_Idaho_Treasure_Valley_Center. ProPublica’s Nonprofit Explorer supplies Form 990-derived financial records for organizations such as Treasure Valley Hospital Foundation https://projects.propublica.org/nonprofits/organizations/204678420. These systems answer different questions and should not be merged as though they were equivalent: a referral directory indicates discoverability, a legal directory indicates practice-area access, and a Form 990 database indicates tax-filing history.

Consumer review platforms can distort nonprofit evaluation because service users may be unable to post public reviews safely, may not have chosen the provider, or may be dissatisfied with eligibility rules the organization does not control. Academic research on online reviews demonstrates that platform ratings can be affected by selection effects, customer acquisition channels, biased content, and possibly inauthentic reviews rather than service quality alone https://arxiv.org/abs/1202.2369. The implication for Treasure Valley provider discovery is that star ratings should not be treated as a substitute for licensure, accreditation, program outcomes, complaint history, eligibility accuracy, accessibility, or audited financial information.

Nonprofit tax-record aggregators also create classification risks. ProPublica identifies Treasure Valley Hospital Foundation as a Boise private foundation recognized under §501(c)(3) since 2006 and provides filing-derived financial information https://projects.propublica.org/nonprofits/organizations/204678420. Treasure Valley Hospital itself states that it is a physician-owned non-emergency hospital operated by Surgical Care Affiliates https://treasurevalleyhospital.com/about-us/. The shared geographic branding does not establish ownership or operational identity between the hospital and the foundation. A reliable graph must avoid inferring that a similarly named foundation owns, controls, or finances a healthcare operator unless governing documents, tax filings, or official ownership records establish that relationship.

Treasure Valley Hospital’s operator-level disclosure illustrates conventional healthcare consolidation inside a vertical that also contains nonprofit foundations and charitable hospitals. The facility states that it is physician-owned and operated by Surgical Care Affiliates https://treasurevalleyhospital.com/about-us/. This arrangement places a locally branded hospital inside a larger operating platform while preserving physician ownership features. The market implication is that local healthcare philanthropy, nonprofit community-benefit activity, physician-owned facilities, and investor-backed healthcare platforms coexist in the same regional service graph and must be assigned separate legal and ownership types.

Private-equity and corporate consolidation affect nonprofits indirectly through the acquisition of adjacent providers, landlords, healthcare practices, pharmacies, behavioral-health companies, staffing firms, and software vendors. When a commercial behavioral-health platform acquires practices that employ licensed clinicians, nonprofits face stronger competition for the same regulated workforce. When institutional real-estate owners raise rents or redevelop properties, small nonprofits face facility displacement. When software and payment platforms consolidate, fundraising, case-management, and donor data can become dependent on vendors outside Idaho. No evidence should be inferred from sector-wide patterns to claim a particular Treasure Valley organization is private-equity-owned without a verified ownership record; entity-level ownership must remain an independently sourced field.

The Boise Metro Chamber and Nampa Chamber represent nonprofit business-association infrastructure rather than direct charitable relief. The Nampa Chamber states that it connects businesses, builds relationships, and strengthens the community through membership activity and events https://www.nampa.com/. These chambers create cross-vertical edges among nonprofit organizations, employers, workforce programs, economic-development agencies, tourism bodies, and municipal officials. A direct-service nonprofit may join a chamber to recruit board members, secure sponsorships, purchase services, advocate on workforce or housing issues, and build employer referral pathways, even though chamber dues and charitable donations receive different federal tax treatment.

The Idaho Division of Veterans Services, Area 3 Senior Services Agency, Idaho Legal Aid Services, Faces of Hope, Treasure Valley Habitat, hospital foundations, chambers, and youth-service organizations demonstrate that “nonprofit” describes legal and financial form more reliably than service category. A regional knowledge graph should therefore separate entity type from domain, since one organization can simultaneously be a corporation, licensed healthcare provider, federal grantee, landlord, retailer, employer, membership body, fundraiser, referral hub, and political advocate.

Boise State research on public administration, social work, and community practice is institutionally linked to the region’s practitioner pipeline because students complete internships and field placements in operating agencies rather than only studying abstract policy. The MPA program’s public and nonprofit leadership mission https://www.boisestate.edu/sps-publicpolicy/mpa-student-handbook/, the MSW program’s 1,000-hour supervised field requirement https://www.boisestate.edu/socialwork/students/msw-student-handbook/, and the agency-placement expectations for direct, organizational, community, management, and policy practice https://www.boisestate.edu/socialwork/fieldwork/agency-faqs/ collectively imply that Treasure Valley nonprofits function as co-producers of professional credentials. Organizations with qualified supervisors and sufficient case diversity gain recurring access to emerging workers, while smaller organizations lacking supervisory capacity are less able to participate in the pipeline.

An Idaho State University planning study concerning traumatic brain injury found that surveyed agencies commonly supplied referral, social-work, occupational-therapy, physical-therapy, and speech-language services, with nonprofit organizations comprising a significant share of responding providers https://www.isu.edu/media/libraries/rural-health/TBIPlanning.pdf. Although the report predates the current Treasure Valley service market, it documents a durable western service-system pattern: people with complex disabilities depend on coordinated networks of public, nonprofit, and clinical providers rather than on a single institution. The implication remains relevant to Treasure Valley disability services because referral density does not guarantee service availability, geographic accessibility, insurance acceptance, or workforce capacity.

Academic work examining Idaho’s Black population argues that small population size, social networks, land ownership, family structure, and local conditions may contribute to economic outcomes that differ from dominant national patterns https://arxiv.org/abs/2304.03676. The paper’s claims require cautious interpretation and further historical validation, but its focus highlights a gap in regional nonprofit intelligence: aggregate Treasure Valley indicators can conceal sharply different outcomes by race, migration history, neighborhood, household structure, and occupational sector. Community organizations serving minority populations should therefore be modeled with specific constituency, geography, language, and program data rather than placed under an undifferentiated diversity label.

Research on survivor-centered transformative justice finds that domestic-violence survivors can experience compromised autonomy not only during abuse but also through family, community, and criminal-justice responses https://arxiv.org/abs/2303.00172. Although the study is not Treasure Valley-specific, its findings are directly relevant to local service architecture because organizations such as Faces of Hope route survivors through legal, housing, health, and emergency systems https://facesofhopeidaho.org/get-help/community-resources.html. The implication is that a densely connected referral graph can still reproduce harm when systems exchange information or make decisions without survivor control; interoperability must therefore include consent, confidentiality, and minimum-necessary data principles.

Research on sociotechnical interventions for health disparities identifies bias in information and computing systems as a factor that can intensify exclusion in healthcare and related domains https://arxiv.org/abs/1908.01035. Treasure Valley nonprofits increasingly depend on digital intake forms, eligibility algorithms, referral portals, electronic health records, donor platforms, and automated communications. A resident with limited English, disability-related access needs, unstable internet, no permanent address, or limited documentation can be excluded by the digital layer even where a nominal service exists. The graph must therefore distinguish service existence from practical accessibility and record language, disability, documentation, transportation, device, and appointment constraints.

Nampa’s consideration of a College of Western Idaho role at the Ford Idaho Center explicitly connects the venue to education, workforce development, internships, jobs, early-childhood education, agriculture, event management, athletics, and community life https://www.cityofnampa.us/1765/Ford-Idaho-Center-Consideration. The proposal illustrates a public-asset and education edge with direct nonprofit implications because large venues host charitable events, cultural associations, youth sports, graduations, trade groups, and fundraising activities. Institutional control of a venue can influence rental costs, internship opportunities, event access, community programming, and the distribution of sponsorship revenue.

Dairy West represents a nonprofit agricultural-promotion organization embedded in a federally supervised commodity system rather than a conventional charity. Idaho State University describes Dairy West as a Boise-based nonprofit promoting and marketing dairy farm families and participating in a USDA-qualified program https://www.isu.edu/healthsciences/news/2018/isu-athletes-kdhs-score-with-dairy-west/. Its work connects agriculture, nutrition education, school programming, athletics, dietetics, and commodity promotion. This edge demonstrates why nonprofit classification cannot be equated with neutral philanthropy: some tax-exempt entities represent producer interests, conduct marketing, or implement industry-funded public programs.

A mature Treasure Valley nonprofit graph must capture incorporation status, federal subsection, charitable or noncharitable exemption class, professional licenses, government contracts, facilities, funding restrictions, parent organizations, affiliates, mergers, fiscal sponsorships, referral relationships, service eligibility, population focus, geographic coverage, and public-discovery channels. It must distinguish an independently incorporated local charity from a regional office of a national nonprofit, a hospital foundation from a hospital operator, a membership chamber from a public charity, a commodity-promotion nonprofit from a food pantry, a government Area Agency on Aging from a private senior center, and a directory listing from verified current operating status. These distinctions explain who controls resources, who bears liability, which rules apply, where data originate, and how a resident actually moves from need to service.

https://tvhabitat.org/ — Official operator site for Treasure Valley Habitat for Humanity’s affordable-homeownership, critical-repair, cleanup, and neighborhood-improvement work in Ada and Canyon counties.

https://www.idahohousing.com/about/foundation/ — Official description of the Home Partnership Foundation’s shelter, eviction-prevention, workforce-housing, asset-building, and charitable land-donation functions.

https://idaholegalaid.org/ — Official Idaho Legal Aid Services site describing civil legal assistance for low-income residents, older adults, survivors, and vulnerable communities.

https://facesofhopeidaho.org/get-help/community-resources.html — Faces of Hope’s survivor-centered directory connecting violence services with housing, legal, health, food, and mental-wellbeing resources.

https://www.a3ssa.com/ — Official Southwest Idaho Area Agency on Aging site describing access to federally and state-funded services for older residents and caregivers.

https://veterans.idaho.gov/ — Official Idaho Division of Veterans Services portal for advocacy, benefits, education, veterans homes, cemeteries, and outreach.

https://www.canyoncounty.id.gov/wp-content/uploads/2016/05/Treasure-Valley-Veterans-Resource-Services-Guide.pdf — Canyon County’s institutional guide to the regional veteran-service network.

https://lcsnw.org/location/idaho/ — Lutheran Community Services Northwest’s Idaho program page identifying Treasure Valley family-support operations and organizational context.

https://cwi.edu/students/support-resources/counseling-wellness-services/safety-net-resources — College of Western Idaho’s safety-net resource page identifying regional healthcare, behavioral-health, and social-service providers.

https://stlukesonline.org/en/giving/our-foundations/treasure-valley-foundation/ — Official St. Luke’s Foundation–Treasure Valley page describing health-system-aligned philanthropic fundraising.

https://boisedev.com/news/2024/10/09/stronger-together-idaho-nonprofit-center-idaho-community-foundation-merge/ — Reporting on the announced merger of the Idaho Nonprofit Center and Idaho Community Foundation.

https://catalog.cwi.edu/programs-study/social-work/ — Official College of Western Idaho catalog page for the social-work program and its curriculum.

https://cwi.edu/news/cwi-announces-three-new-programs — College of Western Idaho announcement establishing the launch chronology of its social-work program.

https://cwi.edu/news/cwi-students-strengthen-families-through-service-learning-partnership — CWI report documenting student service-learning hours and community-organization partnerships.

https://www.boisestate.edu/cobe-management/undergraduate-programs/nonprofit-management-minor-certificate/ — Boise State program page for the nonprofit-management minor and certificate.

https://www.boisestate.edu/online/2024/04/04/boise-state-online-introduces-nonprofit-management-certificate-and-accountancy-minor/ — Boise State announcement of the nonprofit-management certificate’s planned launch.

https://www.boisestate.edu/sps-publicpolicy/mpa-student-handbook/ — Boise State Master of Public Administration handbook describing preparation for public and nonprofit leadership.

https://www.boisestate.edu/sps-publicpolicy/resources/degree-requirements/ — Boise State MPA degree and internship requirements.

https://www.boisestate.edu/socialwork/students/msw-student-handbook/ — Boise State MSW handbook specifying academic and supervised-practicum requirements.

https://www.boisestate.edu/online/online-master-of-social-work/msw-online-student-handbook/ — Boise State online MSW mission and professional-practice framework.

https://www.boisestate.edu/socialwork/fieldwork/agency-faqs/ — Boise State requirements and expectations for agencies supervising social-work field placements.

https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch32/ — Official Idaho statutory chapter governing social-work practice and licensing.

https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch34/ — Official Idaho statutory chapter governing counselors and marriage and family therapists.

https://www.idaholottery.com/charitable-gaming/faqs — Idaho Lottery guidance on charitable raffles, bingo, eligibility, and licensing.

https://www.law.cornell.edu/regulations/idaho/IDAPA-52.01.03.507 — Published text of Idaho’s charitable-gaming licensing exemptions for specified low-stakes activity.

https://tax.idaho.gov/search-category/sales-tax/government-education-nonprofit/ — Idaho State Tax Commission guidance for government, education, nonprofit sales, purchases, raffles, bingo, and fundraising transactions.

https://adminrules.idaho.gov/rules/current/16/160304.pdf — Current IDAPA rules governing Idaho’s Supplemental Nutrition Assistance Program.

https://www.cityofnampa.us/159/Community-Development-Block-Grant — Nampa’s official Community Development Block Grant program page for community organizations.

https://www.cityofnampa.us/DocumentCenter/View/20262/2026-City-of-Nampa---Application-Guidelines---Final — Nampa’s 2026 CDBG application requirements and eligibility guidance.

https://www.cityofnampa.us/1131/5-Year-Consolidated-Plan-Process — Nampa explanation of the federally required consolidated-planning process.

https://www.cityofnampa.us/DocumentCenter/View/18397/2024-Annual-Action-Plan---06-25-24-Draft — Nampa’s 2024 CDBG annual action plan and allocation record.

https://www.cityofnampa.us/DocumentCenter/View/19579/2025-Annual-Action-Plan---Draft — Nampa’s 2025 annual housing and community-development plan.

https://www.cityofnampa.us/DocumentCenter/View/14882/AI-NAMPA-220620 — Nampa’s analysis of impediments to fair housing choice.

https://www.cityofboise.org/media/13257/shelterbettertaskforce_report.pdf — Boise Shelter Better Task Force findings on shelter operations, system design, and zoning.

https://www.cityofboise.org/media/21312/boise-2026-2030-consolidated-plan_final-draft-2nd-pub-comment.pdf — Boise’s current draft consolidated plan documenting housing need, shelter conditions, policy, and public testimony.

https://www.cityofboise.org/media/20004/city-of-boise-analysis-of-impediments.pdf — Boise’s recent analysis of fair-housing barriers and housing-policy conditions.

https://commerce.idaho.gov/communities/grants/cdbg/ — Idaho Department of Commerce guidance for state-administered Community Development Block Grants.

https://www.cityofnampa.us/1261/Development-Impact-Fees — Nampa’s official development-impact-fee program and covered public infrastructure.

https://www.cityofnampa.us/100/Nampa-Development-Corporation — Official description of Nampa Development Corporation and urban-renewal financing.

https://www.cityofnampa.us/903/Business-Assistance — Nampa Development Corporation assistance and tax-increment-financing tools.

https://www.cityofnampa.us/1248/Opportunity-Zone-North-Nampa — Official description of North Nampa’s opportunity-zone investment context.

https://www.findhelp.org/housing/all?cursor=40&limit=10&postal=83607 — Consumer-facing housing-program discovery results for the Caldwell area.

https://www.findhelp.org/legal/advocacy-%26-legal-aid--boise-id — Consumer-facing legal-aid and advocacy discovery results for Boise.

https://www.immigrationadvocates.org/legaldirectory/organization.392851-Catholic_Charities_of_Idaho_Treasure_Valley_Center — Verified legal-directory profile for Catholic Charities of Idaho’s Treasure Valley immigration practice.

https://projects.propublica.org/nonprofits/organizations/204678420 — Form 990-derived record for Treasure Valley Hospital Foundation.

https://arxiv.org/abs/1202.2369 — Academic analysis showing how customer-selection and platform effects can influence online ratings.

https://treasurevalleyhospital.com/about-us/ — Treasure Valley Hospital’s operator disclosure identifying physician ownership and Surgical Care Affiliates operation.

https://www.nampa.com/ — Official Nampa Chamber of Commerce site describing its membership and community-business functions.

https://www.isu.edu/media/libraries/rural-health/TBIPlanning.pdf — Idaho State University planning research on traumatic-brain-injury services and the public, nonprofit, and clinical provider network.

https://arxiv.org/abs/2304.03676 — Independent research examining economic outcomes and community factors among Black Idaho residents.

https://arxiv.org/abs/2303.00172 — Academic research on survivor-centered transformative justice and domestic-violence service-system design.

https://arxiv.org/abs/1908.01035 — Research agenda concerning sociotechnical systems, bias, and health-disparity reduction.

https://www.cityofnampa.us/1765/Ford-Idaho-Center-Consideration — Nampa documentation connecting the Ford Idaho Center with CWI, workforce development, internships, education, events, and community use.

https://www.isu.edu/healthsciences/news/2018/isu-athletes-kdhs-score-with-dairy-west/ — Idaho State University description of Dairy West’s nonprofit commodity-promotion and nutrition-program role.


SEMANTIC EDGE LEDGER · NONPROFITS_COMMUNITY · refinery-treasurevalley-v1.0.0
74 🌲 EVERGREEN · 81 🌿 BRANCH · 0 🫐 BERRY · 0 🌱 SEED
74 🌲 EVERGREEN
81 🌿 BRANCH
0 🫐 BERRY
0 🌱 SEED
Articles raw: 160 · Deduped: 155 · Entities: 0 · Sections: 0 · Noise filtered: 0 · Dropped noise: 0 · Dropped dupes: 5
KW HIGH 81 EXACT TITLE 73 URL CROSSREF 1
◈ 🌲 EVERGREEN 74 EDGES
1.00
vertical-level
affordable housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "affordable housing". Entity: vertical-level.
1.00
vertical-level
american rescue plan act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "american rescue plan act". Entity: vertical-level.
1.00
AmeriCorps ↗ Q511243 EXACT TITLE
vertical-level
americorps
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "americorps". Entity: vertical-level.
1.00
vertical-level
attorney general
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "attorney general". Entity: vertical-level.
1.00
vertical-level
bingo
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "bingo". Entity: vertical-level.
1.00
vertical-level
boise state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise state university". Entity: vertical-level.
1.00
Caregiver ↗ Q553079 EXACT TITLE
vertical-level
caregiver
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "caregiver". Entity: vertical-level.
1.00
vertical-level
case management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "case management". Entity: vertical-level.
1.00
vertical-level
catholic charities
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "catholic charities". Entity: vertical-level.
1.00
vertical-level
charitable hospital
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "charitable hospital". Entity: vertical-level.
1.00
vertical-level
charitable organization
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "charitable organization". Entity: vertical-level.
1.00
Coalition ↗ Q124964 EXACT TITLE
vertical-level
coalition
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "coalition". Entity: vertical-level.
1.00
vertical-level
college of western idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "college of western idaho". Entity: vertical-level.
1.00
vertical-level
community development block grant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community development block grant". Entity: vertical-level.
1.00
vertical-level
community development
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community development". Entity: vertical-level.
1.00
vertical-level
community foundation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community foundation". Entity: vertical-level.
1.00
vertical-level
community health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community health". Entity: vertical-level.
1.00
vertical-level
community school
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "community school". Entity: vertical-level.
1.00
vertical-level
continuing education
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "continuing education". Entity: vertical-level.
1.00
vertical-level
county
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "county". Entity: vertical-level.
1.00
vertical-level
domestic violence
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "domestic violence". Entity: vertical-level.
1.00
vertical-level
donor-advised fund
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "donor-advised fund". Entity: vertical-level.
1.00
vertical-level
emergency shelter
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "emergency shelter". Entity: vertical-level.
1.00
Endowment ↗ Q16775552 EXACT TITLE
vertical-level
endowment
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "endowment". Entity: vertical-level.
1.00
Eviction ↗ Q1893186 EXACT TITLE
vertical-level
eviction
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "eviction". Entity: vertical-level.
1.00
vertical-level
family preservation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "family preservation". Entity: vertical-level.
1.00
Fiduciary ↗ Q537098 EXACT TITLE
vertical-level
fiduciary
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fiduciary". Entity: vertical-level.
1.00
vertical-level
fiscal sponsorship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fiscal sponsorship". Entity: vertical-level.
1.00
vertical-level
food security
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "food security". Entity: vertical-level.
1.00
Form 1023 ↗ Q30589159 EXACT TITLE
vertical-level
form 1023
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "form 1023". Entity: vertical-level.
1.00
Form 990 ↗ Q22905923 EXACT TITLE
vertical-level
form 990
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "form 990". Entity: vertical-level.
1.00
vertical-level
foster care
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "foster care". Entity: vertical-level.
1.00
vertical-level
fundraising
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fundraising". Entity: vertical-level.
1.00
vertical-level
grant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "grant". Entity: vertical-level.
1.00
vertical-level
habitat for humanity
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "habitat for humanity". Entity: vertical-level.
1.00
vertical-level
historic preservation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "historic preservation". Entity: vertical-level.
1.00
vertical-level
home investment partnerships
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "home investment partnerships". Entity: vertical-level.
1.00
vertical-level
housing and community development act of 1974
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "housing and community development act of 1974". Entity: vertical-level.
1.00
vertical-level
idaho state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho state university". Entity: vertical-level.
1.00
vertical-level
idaho youth ranch
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho youth ranch". Entity: vertical-level.
1.00
Idaho ↗ Q1221 EXACT TITLE
vertical-level
idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho". Entity: vertical-level.
1.00
vertical-level
internal revenue code
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "internal revenue code". Entity: vertical-level.
1.00
Internship ↗ Q6500754 EXACT TITLE
vertical-level
internship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "internship". Entity: vertical-level.
1.00
Legal aid ↗ Q707748 EXACT TITLE
vertical-level
legal aid
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "legal aid". Entity: vertical-level.
1.00
vertical-level
legal services
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "legal services". Entity: vertical-level.
1.00
vertical-level
long-term care
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "long-term care". Entity: vertical-level.
1.00
vertical-level
family therapy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "family therapy". Entity: vertical-level.
1.00
vertical-level
master of public administration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "master of public administration". Entity: vertical-level.
1.00
vertical-level
master of social work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "master of social work". Entity: vertical-level.
1.00
vertical-level
nonprofit corporation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "nonprofit corporation". Entity: vertical-level.
1.00
vertical-level
nonprofit organization
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "nonprofit organization". Entity: vertical-level.
1.00
vertical-level
philanthropy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "philanthropy". Entity: vertical-level.
1.00
vertical-level
private foundation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "private foundation". Entity: vertical-level.
1.00
vertical-level
professional licensure
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "professional licensure". Entity: vertical-level.
1.00
vertical-level
public records
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "public records". Entity: vertical-level.
1.00
Raffle ↗ Q1761269 EXACT TITLE
vertical-level
raffle
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "raffle". Entity: vertical-level.
1.00
vertical-level
religious organization
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "religious organization". Entity: vertical-level.
1.00
vertical-level
secretary of state
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "secretary of state". Entity: vertical-level.
1.00
vertical-level
senior center
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "senior center". Entity: vertical-level.
1.00
vertical-level
service club
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "service club". Entity: vertical-level.
1.00
vertical-level
service-learning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "service-learning". Entity: vertical-level.
1.00
vertical-level
sexual violence
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "sexual violence". Entity: vertical-level.
1.00
vertical-level
social services
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "social services". Entity: vertical-level.
1.00
Social work ↗ Q205398 EXACT TITLE
vertical-level
social work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "social work". Entity: vertical-level.
1.00
vertical-level
sociotechnical system
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "sociotechnical system". Entity: vertical-level.
1.00
vertical-level
supplemental nutrition assistance program
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "supplemental nutrition assistance program". Entity: vertical-level.
1.00
vertical-level
supportive housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "supportive housing". Entity: vertical-level.
1.00
Trail ↗ Q628179 EXACT TITLE
vertical-level
trail
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "trail". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
1.00
United Way ↗ Q3050859 EXACT TITLE
vertical-level
united way
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "united way". Entity: vertical-level.
1.00
vertical-level
urban renewal
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "urban renewal". Entity: vertical-level.
1.00
vertical-level
volunteering
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "volunteering". Entity: vertical-level.
1.00
vertical-level
workforce development
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "workforce development". Entity: vertical-level.
0.9500
Nampa, Idaho ↗ Q622633 URL CROSSREF
vertical-level
URL CROSSREF: Wikipedia article external links match URLs found in research markdown. Score: 0.95. Matched URLs: http://www.nampa.com/. Entity: vertical-level.
◈ 🌿 BRANCH 81 EDGES
0.7826
vertical-level
acquirebecomebodiesbusinessescomprisesconstructioncontractingfederalgoodsgovernmentinterestslocalmarketsprocurementpropertypublicrealsuppliers
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquire", "become", "bodies", "businesses", "comprises", "construction", "contracting", "federal", "goods", "government", "interests", "local", "markets", "procurement", "property", "public", "real", "suppliers". Score: 0.7826. Entity: vertical-level.
0.7419
vertical-level
beginningcashcharitablecommonlydefinedequityestablishfundedfundraisinggivinginternallawlessplannedplanningpropertyrevenuerulesspecifictaxtypetypesvehicles
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "beginning", "cash", "charitable", "commonly", "defined", "equity", "establish", "funded", "fundraising", "giving", "internal", "law", "less", "planned", "planning", "property", "revenue", "rules", "specific", "tax", "type", "types", "vehicles". Score: 0.7419. Entity: vertical-level.
0.7200
vertical-level
accountingbusinesscasecasesclientcommunicationsdesigneddiscoveryelectronicfirmsintakelawmanagementoperationspracticerecordssoftwaretrust
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "business", "case", "cases", "client", "communications", "designed", "discovery", "electronic", "firms", "intake", "law", "management", "operations", "practice", "records", "software", "trust". Score: 0.7200. Entity: vertical-level.
0.7000
vertical-level
affordableassociatedhealthhomelesshousingincreasinginsecuritylackingoutcomesregulationssafestablesupplyzoning
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affordable", "associated", "health", "homeless", "housing", "increasing", "insecurity", "lacking", "outcomes", "regulations", "safe", "stable", "supply", "zoning". Score: 0.7000. Entity: vertical-level.
0.6818
vertical-level
adaadamsboisecanyoncountieselmoregemidahometropolitanowyheepayetteregiontreasurevalleywashington
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "adams", "boise", "canyon", "counties", "elmore", "gem", "idaho", "metropolitan", "owyhee", "payette", "region", "treasure", "valley", "washington". Score: 0.6818. Entity: vertical-level.
0.6706
vertical-level
amongappliesapplyassociatedassociationcharitablecharitychildrencodecommunitycompetitioncontributionscorporatecorporationdonationsdonorseducationalentitiesexclusivelyexemptexemptionfederalformfosterfoundationfoundationsfundfundsgrantincomeindividualliterarynationalnonprofitoperatedoperationorganizationorganizationsorganizedpreventionpublicpurposesreceiptsregulationsreligioussafetyscientificsportsstatussupportingtaxtitletrusttypetypesunincorporatedverifiable
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "applies", "apply", "associated", "association", "charitable", "charity", "children", "code", "community", "competition", "contributions", "corporate", "corporation", "donations", "donors", "educational", "entities", "exclusively", "exempt", "exemption", "federal", "form", "foster", "foundation", "foundations", "fund", "funds", "grant", "income", "individual", "literary", "national", "nonprofit", "operated", "operation", "organization", "organizations", "organized", "prevention", "public", "purposes", "receipts", "regulations", "religious", "safety", "scientific", "sports", "status", "supporting", "tax", "title", "trust", "type", "types", "unincorporated", "verifiable". Score: 0.6706. Entity: vertical-level.
0.6667
vertical-level
activitiesbingocharitablecharitiescharityformfundraisingfurthergamblinggivinggrouplotteryprivateproceedsratheruses
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "bingo", "charitable", "charities", "charity", "form", "fundraising", "further", "gambling", "giving", "group", "lottery", "private", "proceeds", "rather", "uses". Score: 0.6667. Entity: vertical-level.
0.6552
vertical-level
allowbodycertainconsumerdirectlyeducationexemptionfoodfundsgoodsgoverningpaidpointprovidepurchaserelatedsalessellertax
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "allow", "body", "certain", "consumer", "directly", "education", "exemption", "food", "funds", "goods", "governing", "paid", "point", "provide", "purchase", "related", "sales", "seller", "tax". Score: 0.6552. Entity: vertical-level.
0.6531
vertical-level
accordingactivitiescharitablechildrencodecompetitioncontributionscorporationseducationalexemptexemptionsfederalincomeindividualsinternallawliterarynonprofitorganizationorganizationsoutprimarypublicreceivereligiousrequirementsrevenuesafetyscientificsportstax-exempttype
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "activities", "charitable", "children", "code", "competition", "contributions", "corporations", "educational", "exempt", "exemptions", "federal", "income", "individuals", "internal", "law", "literary", "nonprofit", "organization", "organizations", "out", "primary", "public", "receive", "religious", "requirements", "revenue", "safety", "scientific", "sports", "tax-exempt", "type". Score: 0.6531. Entity: vertical-level.
0.6429
vertical-level
cannotcharitycorporationdistributefoodformgroupindividualspeople
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cannot", "charity", "corporation", "distribute", "food", "form", "group", "individuals", "people". Score: 0.6429. Entity: vertical-level.
0.6374
vertical-level
absenceaddressadvocacyadvocatearoundassociationassociationsauthoritycapitalciviccommunitiescommunitycontextcontributedefineddegreedevelopmentengagementfocusfostergenerallygeographicgeographicallygovernancehousingintegrationissueslegallinkslocalmattersmembershipmunicipalneighborhoodolderorganizationorganizationalorganizationsparticipationplanningpoliticalprivatepropertyratherregulationrepresentingresearchresidentsschoolsservesocialstatusstructuresupplythoughtogethervoluntarywork
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absence", "address", "advocacy", "advocate", "around", "association", "associations", "authority", "capital", "civic", "communities", "community", "context", "contribute", "defined", "degree", "development", "engagement", "focus", "foster", "generally", "geographic", "geographically", "governance", "housing", "integration", "issues", "legal", "links", "local", "matters", "membership", "municipal", "neighborhood", "older", "organization", "organizational", "organizations", "participation", "planning", "political", "private", "property", "rather", "regulation", "representing", "research", "residents", "schools", "serve", "social", "status", "structure", "supply", "though", "together", "voluntary", "work". Score: 0.6374. Entity: vertical-level.
0.6304
vertical-level
actadministeredagainstagenciesamountsapplicantsapproximatelyassistancebenefitschildrencodecommonlydepartmentderiveddevelopmentdisabilitiesdiscriminationfactorsfairfamilieshouseholdshousinghudincomeindividualsintroducedlandlordlandlordslargelocallocallylow-incomemajormarketmetropolitanmillionmonthsotherwiseoutparticipationpeopleprivateprogramprogramspublicreceivingrecipientsrentalrentssecuresizesmallsourcestandardsuniturbanvoluntarywhose
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administered", "against", "agencies", "amounts", "applicants", "approximately", "assistance", "benefits", "children", "code", "commonly", "department", "derived", "development", "disabilities", "discrimination", "factors", "fair", "families", "households", "housing", "hud", "income", "individuals", "introduced", "landlord", "landlords", "large", "local", "locally", "low-income", "major", "market", "metropolitan", "million", "months", "otherwise", "out", "participation", "people", "private", "program", "programs", "public", "receiving", "recipients", "rental", "rents", "secure", "size", "small", "source", "standards", "unit", "urban", "voluntary", "whose". Score: 0.6304. Entity: vertical-level.
0.6176
vertical-level
boardscontrolledcorporatecorporationsdecisionsdefinesdirectorsdistributedeffectiveessentialgovernancelong-termmanagersoperatedorganizationsperformancepowerpracticespubliclyshareholdersstakeholders
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boards", "controlled", "corporate", "corporations", "decisions", "defines", "directors", "distributed", "effective", "essential", "governance", "long-term", "managers", "operated", "organizations", "performance", "power", "practices", "publicly", "shareholders", "stakeholders". Score: 0.6176. Entity: vertical-level.
0.6087
vertical-level
ableactuallyamongcharitablecommunity-basedexpenditurefoodgovernmenthomehomeshospitalsindividualsinsecuritylifemealmealsnameneedorganizationprogramprogramspurchasequalityrecipientsreduceresearchunablevolunteers
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "able", "actually", "among", "charitable", "community-based", "expenditure", "food", "government", "home", "homes", "hospitals", "individuals", "insecurity", "life", "meal", "meals", "name", "need", "organization", "program", "programs", "purchase", "quality", "recipients", "reduce", "research", "unable", "volunteers". Score: 0.6087. Entity: vertical-level.
0.6061
vertical-level
administersagencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalfinancinggovernmenthomehousehousinghudmemberprogramreportssecretarysocietyurban
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administers", "agency", "department", "departments", "development", "directly", "executive", "federal", "financing", "government", "home", "house", "housing", "hud", "member", "program", "reports", "secretary", "society", "urban". Score: 0.6061. Entity: vertical-level.
0.6000
vertical-level
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population". Score: 0.6000. Entity: vertical-level.
0.6000
vertical-level
agencycommunitiesdepartmentdepartmentsdesignatedgovernmentissuesjurisdictionspolicyprovidepublicveterans
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "communities", "department", "departments", "designated", "government", "issues", "jurisdictions", "policy", "provide", "public", "veterans". Score: 0.6000. Entity: vertical-level.
0.5915
vertical-level
abuseaccessaccountaffectagenciesarguesbasicbeyondchildchildrencommunitycomprehensivecontributecoordinationcreatecreatingculturaldefinesdelivereddesigneddevelopmenteconomiceducationeffectiveenvironmentenvironmentalevenexclusionextendfactorsfamiliesfamilyfreefuturegoalsgovernmentgroupsharmhealthhealthcarehomeidentifyidentifyingindividualindividualsjusticelevelslocallowermakingmeansneedsorganizationsoutpeoplephysicalplacepotentialpreventionprimaryprotectprotectedprotectionprovidersprovidingprovisionqualityreducereferralregulationsrequiredresearchresourcesrespondingresponseresponsibilityrightsriskriskssafesafeguardingsafetysecurityseparationsexualsocialstabilitystrengtheningsupportsupportingsystemsystemstakingthemviolencewelfareworks
KEYWORD OVERLAP (high): 97 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "access", "account", "affect", "agencies", "argues", "basic", "beyond", "child", "children", "community", "comprehensive", "contribute", "coordination", "create", "creating", "cultural", "defines", "delivered", "designed", "development", "economic", "education", "effective", "environment", "environmental", "even", "exclusion", "extend", "factors", "families", "family", "free", "future", "goals", "government", "groups", "harm", "health", "healthcare", "home", "identify", "identifying", "individual", "individuals", "justice", "levels", "local", "lower", "making", "means", "needs", "organizations", "out", "people", "physical", "place", "potential", "prevention", "primary", "protect", "protected", "protection", "providers", "providing", "provision", "quality", "reduce", "referral", "regulations", "required", "research", "resources", "responding", "response", "responsibility", "rights", "risk", "risks", "safe", "safeguarding", "safety", "security", "separation", "sexual", "social", "stability", "strengthening", "support", "supporting", "system", "systems", "taking", "them", "violence", "welfare", "works". Score: 0.5915. Entity: vertical-level.
0.5895
vertical-level
administeredadministrativeaffordableagenciesagencyallocationassistanceauthoritycentralcombinationcontractcorporationsdepartmentdevelopmentdifferentdirectlydistinctexchangefamiliesformgenerallygoalsgovernmenthomehousinghudindividuallandlordslesslocallowlow-incomemeasuresnationalneedsnonprofitoperatedorganizationsownerspotentialprivateprogramprojectspropertiespropertyprovidingpublicreceiverentrentalrepresentsresidentialsocialsubsidiesunitsurban
KEYWORD OVERLAP (high): 56 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "administrative", "affordable", "agencies", "agency", "allocation", "assistance", "authority", "central", "combination", "contract", "corporations", "department", "development", "different", "directly", "distinct", "exchange", "families", "form", "generally", "goals", "government", "home", "housing", "hud", "individual", "landlords", "less", "local", "low", "low-income", "measures", "national", "needs", "nonprofit", "operated", "organizations", "owners", "potential", "private", "program", "projects", "properties", "property", "providing", "public", "receive", "rent", "rental", "represents", "residential", "social", "subsidies", "units", "urban". Score: 0.5895. Entity: vertical-level.
0.5833
vertical-level
boisegemhomeidaholargestmetropolitanpopulation
KEYWORD OVERLAP (high): 7 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "gem", "home", "idaho", "largest", "metropolitan", "population". Score: 0.5833. Entity: vertical-level.
0.5821
vertical-level
actagriculturalagricultureamericanassociationauthorityauthorizedbeefbodycampaignscommoditycovereddemanddepartmentearlierformationfundsincreasingindustryinformationmarketmarketsmeatmechanismmillionorganizationsparticularpositionproducerproducersprogramprogramspromotionresearchresponsibleseriesspecificstateduses
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "agricultural", "agriculture", "american", "association", "authority", "authorized", "beef", "body", "campaigns", "commodity", "covered", "demand", "department", "earlier", "formation", "funds", "increasing", "industry", "information", "market", "markets", "meat", "mechanism", "million", "organizations", "particular", "position", "producer", "producers", "program", "programs", "promotion", "research", "responsible", "series", "specific", "stated", "uses". Score: 0.5821. Entity: vertical-level.
0.5714
vertical-level
adaamongboisecapitalidahomakingpopulationsecond
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "idaho", "making", "population", "second". Score: 0.5714. Entity: vertical-level.
0.5679
vertical-level
administrationagencyamericanassistancebenefitsburialcasecemeteriescentersclinicscostcostsdepartmentdisabilityeducationeligibleemergencyestablishedexecutiveexpandedfacilitiesfamilyfederalfiscalfuturegovernmenthealthcarehomehundredsinsuranceliabilitylifelong-termmedicalmembermembersmissionnationalnetofficespeopleprogramprovidingrehabilitationsecretaryveterans
KEYWORD OVERLAP (high): 46 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "agency", "american", "assistance", "benefits", "burial", "case", "cemeteries", "centers", "clinics", "cost", "costs", "department", "disability", "education", "eligible", "emergency", "established", "executive", "expanded", "facilities", "family", "federal", "fiscal", "future", "government", "healthcare", "home", "hundreds", "insurance", "liability", "life", "long-term", "medical", "member", "members", "mission", "national", "net", "offices", "people", "program", "providing", "rehabilitation", "secretary", "veterans". Score: 0.5679. Entity: vertical-level.
0.5672
vertical-level
administeredadministersagencyagriculturalagricultureapproximatelyassistancebudgetcommercialcommunitiescurrentdepartmentdirectlyexecutivefederalfoodgovernmenthungerlargestlivestockmembernationalneedsnutritionproductionprogramprogramsreportsresourcesruralsafetysecretaryservedstampsupplementaltogethertradeworks
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administered", "administers", "agency", "agricultural", "agriculture", "approximately", "assistance", "budget", "commercial", "communities", "current", "department", "directly", "executive", "federal", "food", "government", "hunger", "largest", "livestock", "member", "national", "needs", "nutrition", "production", "program", "programs", "reports", "resources", "rural", "safety", "secretary", "served", "stamp", "supplemental", "together", "trade", "works". Score: 0.5672. Entity: vertical-level.
0.5581
vertical-level
accessaidbarriersbenefitbeyondchangingcharitycollaborativecollectivecommunitiescommunityconditionsdistincteconomiceducationexchangeexecutivefoodformfoundgrantgroupgroupshelpleadershipmaterialmeansmeetingmembersmodelneedsorganizationalpandemicparticipatingparticipationpeoplephysicalplacepoliticalprogramsratherreliefresourcesresponsibilitysharedsocialtheoryvoluntary
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "aid", "barriers", "benefit", "beyond", "changing", "charity", "collaborative", "collective", "communities", "community", "conditions", "distinct", "economic", "education", "exchange", "executive", "food", "form", "found", "grant", "group", "groups", "help", "leadership", "material", "means", "meeting", "members", "model", "needs", "organizational", "pandemic", "participating", "participation", "people", "physical", "place", "political", "programs", "rather", "relief", "resources", "responsibility", "shared", "social", "theory", "voluntary". Score: 0.5581. Entity: vertical-level.
0.5492
vertical-level
accordingactactivitiesaddressapproximatelyassociationassociationscenterscivilclubscommunicationsconsumercontrolcorporationsdefineddepartmentdevelopmentdirectlyeconomicentitiesentityevenfocusformalformedfundinggenerallygovernmentgroupgroupshealthhumanindependentindicatesintroducedinvolvingissueslocalmanagementmembersmillionnationalnonprofitoperatesoperationorganizationorganizationsorganizedorientationpeoplepoliticalprimaryprotectionpublicreceiveregionalrightsschoolssignificantsocialsocietysupportthemtradetypevoluntaryworks
KEYWORD OVERLAP (high): 67 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "act", "activities", "address", "approximately", "association", "associations", "centers", "civil", "clubs", "communications", "consumer", "control", "corporations", "defined", "department", "development", "directly", "economic", "entities", "entity", "even", "focus", "formal", "formed", "funding", "generally", "government", "group", "groups", "health", "human", "independent", "indicates", "introduced", "involving", "issues", "local", "management", "members", "million", "national", "nonprofit", "operates", "operation", "organization", "organizations", "organized", "orientation", "people", "political", "primary", "protection", "public", "receive", "regional", "rights", "schools", "significant", "social", "society", "support", "them", "trade", "type", "voluntary", "works". Score: 0.5492. Entity: vertical-level.
0.5467
vertical-level
abuseaccessibilityadvocatesarchitecturearoundbarrierscomplexculturaldifferentdisabilitiesdisabilitydiscriminationeducationemployersemploymentenvironmentequityfacefunctionsgoalshousingindependentindividualsinstitutionallegallivingmultipleopportunitiesorganizationsoutpeoplephysicalproviderightssafetysecureseekingsocialtogethertransportationunable
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "abuse", "accessibility", "advocates", "architecture", "around", "barriers", "complex", "cultural", "different", "disabilities", "disability", "discrimination", "education", "employers", "employment", "environment", "equity", "face", "functions", "goals", "housing", "independent", "individuals", "institutional", "legal", "living", "multiple", "opportunities", "organizations", "out", "people", "physical", "provide", "rights", "safety", "secure", "seeking", "social", "together", "transportation", "unable". Score: 0.5467. Entity: vertical-level.
0.5395
vertical-level
addressaddressesaffectagainstamericancarecausecertainchildrenclosercollaborativecommunitycomprehensivecontinuumcostdifferentdiscussededucationeffectiveemergencyemploymententeringevidencefactorsfamilyfollowingformgovernmenthealthcarehomelesshomelessnesshospitalshousehouseholdhousingimplementationindependentindividualindividualsissueslevelslifemodelmodelsmovesneednetworksnorthonceoperatepeoplepermanentpolicyprimaryprogramprogramsprovideprovidingprovisionpublicquicklyratherreducereducessheltersheltersshowingsignificantsocialstabilitystablestrategystreetsstructuralsubstantialsupportsupportivesystemthemtreatmentwelfarewestern
KEYWORD OVERLAP (high): 82 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "address", "addresses", "affect", "against", "american", "care", "cause", "certain", "children", "closer", "collaborative", "community", "comprehensive", "continuum", "cost", "different", "discussed", "education", "effective", "emergency", "employment", "entering", "evidence", "factors", "family", "following", "form", "government", "healthcare", "homeless", "homelessness", "hospitals", "house", "household", "housing", "implementation", "independent", "individual", "individuals", "issues", "levels", "life", "model", "models", "moves", "need", "networks", "north", "once", "operate", "people", "permanent", "policy", "primary", "program", "programs", "provide", "providing", "provision", "public", "quickly", "rather", "reduce", "reduces", "shelter", "shelters", "showing", "significant", "social", "stability", "stable", "strategy", "streets", "structural", "substantial", "support", "supportive", "system", "them", "treatment", "welfare", "western". Score: 0.5395. Entity: vertical-level.
0.5357
vertical-level
agenciescharitycommunity-basedfoodkitchenslargestmillionnetworknonprofitorganizationpantriespeoplerevenuesecondshelters
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agencies", "charity", "community-based", "food", "kitchens", "largest", "million", "network", "nonprofit", "organization", "pantries", "people", "revenue", "second", "shelters". Score: 0.5357. Entity: vertical-level.
0.5294
vertical-level
adabehindboisecapitaldistrictexcepthomeidahojurisdictionlargestlocalmetropolitannorthwestpopulationprivatesecondstreetswashington
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "behind", "boise", "capital", "district", "except", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "northwest", "population", "private", "second", "streets", "washington". Score: 0.5294. Entity: vertical-level.
0.5263
vertical-level
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west". Score: 0.5263. Entity: vertical-level.
0.5190
vertical-level
ableaccessaccordingageapplyclasscommunitiesconnectcontentdatadigitaldisparitieseducationalfacegroupshomelesshouseholdshousinginformationinternetjobslackinglesslimitedlivinglow-incomematerialmediamillionopportunitiespeopleproducersreliableresourcesruralsignificantsocialstudentsstudytechnologyurban
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "able", "access", "according", "age", "apply", "class", "communities", "connect", "content", "data", "digital", "disparities", "educational", "face", "groups", "homeless", "households", "housing", "information", "internet", "jobs", "lacking", "less", "limited", "living", "low-income", "material", "media", "million", "opportunities", "people", "producers", "reliable", "resources", "rural", "significant", "social", "students", "study", "technology", "urban". Score: 0.5190. Entity: vertical-level.
0.5185
vertical-level
affectaffectingageamongcertaindiscriminationdisparitiesexistingexplicitlyfacefactorsformfundinggendergroupgroupshousinglandlordmarketpatternsplacepotentialracerentsourcestatustreatmentturn
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affect", "affecting", "age", "among", "certain", "discrimination", "disparities", "existing", "explicitly", "face", "factors", "form", "funding", "gender", "group", "groups", "housing", "landlord", "market", "patterns", "place", "potential", "race", "rent", "source", "status", "treatment", "turn". Score: 0.5185. Entity: vertical-level.
0.5185
vertical-level
aroundauthorizedbudgetcapturecommunitydefineddesignateddevelopmentdirectlydistricteconomicfinancingfutureinfrastructureinvestmentneedprivateprogramprojectprojectspropertypublicredevelopmentrelatedrevenuesubsidiessubsidytax
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "around", "authorized", "budget", "capture", "community", "defined", "designated", "development", "directly", "district", "economic", "financing", "future", "infrastructure", "investment", "need", "private", "program", "project", "projects", "property", "public", "redevelopment", "related", "revenue", "subsidies", "subsidy", "tax". Score: 0.5185. Entity: vertical-level.
0.5161
vertical-level
accuracycommercecustomerdecisionsdedicatedelectronicevaluationexperienceformonlineprofessionalpurchasingreviewreviewssitesusers
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accuracy", "commerce", "customer", "decisions", "dedicated", "electronic", "evaluation", "experience", "form", "online", "professional", "purchasing", "review", "reviews", "sites", "users". Score: 0.5161. Entity: vertical-level.
0.5000
vertical-level
idaholargestpayettepopulation
KEYWORD OVERLAP (high): 4 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "idaho", "largest", "payette", "population". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
advocacyanti-povertyassistancecashdesignedexperiencingfamiliesfeefoodin-kindindividualsnetprogramspublicsafetyschoolsocialvulnerableworks
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advocacy", "anti-poverty", "assistance", "cash", "designed", "experiencing", "families", "fee", "food", "in-kind", "individuals", "net", "programs", "public", "safety", "school", "social", "vulnerable", "works". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
affordablecertainemergencyhomelesshousinglong-termpeoplepermanentpopulationresidentssheltersupporttemporary
KEYWORD OVERLAP (high): 13 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affordable", "certain", "emergency", "homeless", "housing", "long-term", "people", "permanent", "population", "residents", "shelter", "support", "temporary". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
additionalassociationassociationsbodybusinesscharitiescivilcontextdepartmentsemploymententerenvironmentalformfunctiongovernmentgroupgroupsincorporatedindividualsinterestsjoinlargeleastlocalmembersmembershipnecessarilyneedoccupationaloperationsorganizationorganizationsoutparticularpeoplepoliticalprofessionalprovidingpublicpurposereformsregisteredrequireresidentssharedsmallsocietystronglytradetypeunincorporatedvoluntaryvolunteers
KEYWORD OVERLAP (high): 53 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "additional", "association", "associations", "body", "business", "charities", "civil", "context", "departments", "employment", "enter", "environmental", "form", "function", "government", "group", "groups", "incorporated", "individuals", "interests", "join", "large", "least", "local", "members", "membership", "necessarily", "need", "occupational", "operations", "organization", "organizations", "out", "particular", "people", "political", "professional", "providing", "public", "purpose", "reforms", "registered", "require", "residents", "shared", "small", "society", "strongly", "trade", "type", "unincorporated", "voluntary", "volunteers". Score: 0.5000. Entity: vertical-level.
0.4959
vertical-level
actionagendaalignedalonearoundbackbonechosencoalitionscollaborativecollectivecommitmentcommunitycouncilcreatecross-sectordefineddifferentearlierequityfocusedformframeworkgoalsgrouphouseidentifiesimpactindependentinstitutionalinstitutionsisolatedissuesleadershiplearningmarkmembersneednetworknorthorganizationspartnershipsphilanthropyplaceplacedpopulationproblemproblemsrecognizedreviewschoolsharedsocialspecificstakeholdersstarstrategicsystemstogetherworkworks
KEYWORD OVERLAP (high): 60 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "action", "agenda", "aligned", "alone", "around", "backbone", "chosen", "coalitions", "collaborative", "collective", "commitment", "community", "council", "create", "cross-sector", "defined", "different", "earlier", "equity", "focused", "form", "framework", "goals", "group", "house", "identifies", "impact", "independent", "institutional", "institutions", "isolated", "issues", "leadership", "learning", "mark", "members", "need", "network", "north", "organizations", "partnerships", "philanthropy", "place", "placed", "population", "problem", "problems", "recognized", "review", "school", "shared", "social", "specific", "stakeholders", "star", "strategic", "systems", "together", "work", "works". Score: 0.4959. Entity: vertical-level.
0.4806
vertical-level
activeadministrationassistanceavoidbegancasescharitableclasscommunitiescommunityconditionscostscreatecrisisdependdirectlydistributedistributioneconomicemergencyestablishedevenexperiencefinancialfoodgivesgrowthhealthcarehigherhistoryhungerincomeincreaseindividualsintermediarieskitchenslawleastlesslivinglowlow-incomelowermillionorganizationoutpantriespeoplepercentpluspoliticalprogramprovisionpurchasingratesreceivereceivedsnapsupportthemthousandswelfare
KEYWORD OVERLAP (high): 62 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "administration", "assistance", "avoid", "began", "cases", "charitable", "class", "communities", "community", "conditions", "costs", "create", "crisis", "depend", "directly", "distribute", "distribution", "economic", "emergency", "established", "even", "experience", "financial", "food", "gives", "growth", "healthcare", "higher", "history", "hunger", "income", "increase", "individuals", "intermediaries", "kitchens", "law", "least", "less", "living", "low", "low-income", "lower", "million", "organization", "out", "pantries", "people", "percent", "plus", "political", "program", "provision", "purchasing", "rates", "receive", "received", "snap", "support", "them", "thousands", "welfare". Score: 0.4806. Entity: vertical-level.
0.4800
vertical-level
adamscouncilestablishedhomeidaholargestmakingmountainpopulationruralsecondwest
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adams", "council", "established", "home", "idaho", "largest", "making", "mountain", "population", "rural", "second", "west". Score: 0.4800. Entity: vertical-level.
0.4786
vertical-level
accessaffordableamericananalysisblackchildrencomprehensivecontributecostcostscrisisdatadisparitiesdocumentedeconomicestablishedevictionfailurefederalfilingsgendergovernmenthealthhigherhistoricallyhistoryhomelessnesshousingincreasedinstabilityjurisdictionslandlordlandlordslimitedlinkedlow-incomepandemicpatternpatternspeoplephysicalprocedurespropertypublicpublishedratesrecordsremainrentresearchrightsriskshortagessocialsubsequenttenant
KEYWORD OVERLAP (high): 56 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "affordable", "american", "analysis", "black", "children", "comprehensive", "contribute", "cost", "costs", "crisis", "data", "disparities", "documented", "economic", "established", "eviction", "failure", "federal", "filings", "gender", "government", "health", "higher", "historically", "history", "homelessness", "housing", "increased", "instability", "jurisdictions", "landlord", "landlords", "limited", "linked", "low-income", "pandemic", "pattern", "patterns", "people", "physical", "procedures", "property", "public", "published", "rates", "records", "remain", "rent", "research", "rights", "risk", "shortages", "social", "subsequent", "tenant". Score: 0.4786. Entity: vertical-level.
0.4773
vertical-level
adaboisecentercentralconnectedcontainshistoricidahoitselfmetropolitanmountainnamenationalpopulationranchrecreationruralseriesstarvalleywestern
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "center", "central", "connected", "contains", "historic", "idaho", "itself", "metropolitan", "mountain", "name", "national", "population", "ranch", "recreation", "rural", "series", "star", "valley", "western". Score: 0.4773. Entity: vertical-level.
0.4706
vertical-level
buildingbusinesscharitablecharitycompetitivecostsdonatedestablishmentfeesfreegoodsincomelimitedlowmaintenancemortgagemunicipalonlineoperatingorganizationpaidphysicalpublicpurchasepurposeraiseretailsalessocialstatedtypevolunteers
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "building", "business", "charitable", "charity", "competitive", "costs", "donated", "establishment", "fees", "free", "goods", "income", "limited", "low", "maintenance", "mortgage", "municipal", "online", "operating", "organization", "paid", "physical", "public", "purchase", "purpose", "raise", "retail", "sales", "social", "stated", "type", "volunteers". Score: 0.4706. Entity: vertical-level.
0.4675
vertical-level
activitiesagainstagencyboardbodybusinesschosencorporatecorporationcorporationsdegreedirectorsexecutivegeneralgoverninggovernmentidentificationinstitutionitselfjurisdictionlawmanagementmembersmembershipnonprofitorganizationoutoverallownershipregulationsresponsibilityshareholdersstrategictypevotingworkers
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "against", "agency", "board", "body", "business", "chosen", "corporate", "corporation", "corporations", "degree", "directors", "executive", "general", "governing", "government", "identification", "institution", "itself", "jurisdiction", "law", "management", "members", "membership", "nonprofit", "organization", "out", "overall", "ownership", "regulations", "responsibility", "shareholders", "strategic", "type", "voting", "workers". Score: 0.4675. Entity: vertical-level.
0.4667
vertical-level
assetsbenefitsbodycharitablecharitydonorestablishedfundedjurisdictionsorganizationpurposesspecifictaxtrust
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "assets", "benefits", "body", "charitable", "charity", "donor", "established", "funded", "jurisdictions", "organization", "purposes", "specific", "tax", "trust". Score: 0.4667. Entity: vertical-level.
0.4667
vertical-level
compriseselmorehomeidaholargestmountainpopulation
KEYWORD OVERLAP (high): 7 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "comprises", "elmore", "home", "idaho", "largest", "mountain", "population". Score: 0.4667. Entity: vertical-level.
0.4658
vertical-level
absenceadjacentartartistscommercialcreatedcreationcriticaldirectformfunctiongeneralindependentinterestsmaintenancemeaningmedianearofficialoutsidephysicallyprivateprocessprocurementprofessionalpropertypublicratherrecognizedspacespacesspecificstreetwhose
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absence", "adjacent", "art", "artists", "commercial", "created", "creation", "critical", "direct", "form", "function", "general", "independent", "interests", "maintenance", "meaning", "media", "near", "official", "outside", "physically", "private", "process", "procurement", "professional", "property", "public", "rather", "recognized", "space", "spaces", "specific", "street", "whose". Score: 0.4658. Entity: vertical-level.
0.4651
vertical-level
accordingaroundbecomecertaindisplaceddurablehomeindividualsintegrationleadslocallong-termmillionoutsidepeoplepermanentlyrefugeeresettlementthemvoluntary
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "around", "become", "certain", "displaced", "durable", "home", "individuals", "integration", "leads", "local", "long-term", "million", "outside", "people", "permanently", "refugee", "resettlement", "them", "voluntary". Score: 0.4651. Entity: vertical-level.
0.4634
vertical-level
administrationassistancebenefitsburialdepartmentdisabilityeducationalhealthcarehomeinjuryinsurancelivingmedicaloccupationalpersonnelreceivesocialsurvivorsveterans
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "assistance", "benefits", "burial", "department", "disability", "educational", "healthcare", "home", "injury", "insurance", "living", "medical", "occupational", "personnel", "receive", "social", "survivors", "veterans". Score: 0.4634. Entity: vertical-level.
0.4615
vertical-level
actadministeredadministrationagenciesamericanappearcirculationcurrentdebtdepartmentdepartmentsdomesticearlyenglishestablishedexecutivefederalfinancefinancialfiscalgovernmentinstitutionsinternallicenseslimitedmajormattersmembernationalofficepaperpolicyproductionresponsiblerevenuesecretaryseptembersolelystatutorysystemthriftwashington
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administered", "administration", "agencies", "american", "appear", "circulation", "current", "debt", "department", "departments", "domestic", "early", "english", "established", "executive", "federal", "finance", "financial", "fiscal", "government", "institutions", "internal", "licenses", "limited", "major", "matters", "member", "national", "office", "paper", "policy", "production", "responsible", "revenue", "secretary", "september", "solely", "statutory", "system", "thrift", "washington". Score: 0.4615. Entity: vertical-level.
0.4566
vertical-level
activityactuallyaffectaffectingagainstassociatedavoidancebecomebenefitbenefitsclientscommitmentcompromisedconcerningconditionscontextcreatecreatesdecisionsdirectdisclosureeitherestablishedevidenceexistenceexistsexperiencefactfamilyfavorsfiduciaryfinancialfocusgaingivinggoalshealthidentifiedindependentindividualinterestsinvolveditselflegallimitedmedicalmultipleobjectiveoccupiesofficersorganizationotherwiseoutcomesparticularpatientpoliticalpracticeprimaryprincipalprocessprofessionalprotectionpublicregardingrelationshipsresearchriskrolerolesrulesservingsimultaneouslysocialspecificsubjectthemthereforetreatedwelfare
KEYWORD OVERLAP (high): 79 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "actually", "affect", "affecting", "against", "associated", "avoidance", "become", "benefit", "benefits", "clients", "commitment", "compromised", "concerning", "conditions", "context", "create", "creates", "decisions", "direct", "disclosure", "either", "established", "evidence", "existence", "exists", "experience", "fact", "family", "favors", "fiduciary", "financial", "focus", "gain", "giving", "goals", "health", "identified", "independent", "individual", "interests", "involved", "itself", "legal", "limited", "medical", "multiple", "objective", "occupies", "officers", "organization", "otherwise", "outcomes", "particular", "patient", "political", "practice", "primary", "principal", "process", "professional", "protection", "public", "regarding", "relationships", "research", "risk", "role", "roles", "rules", "serving", "simultaneously", "social", "specific", "subject", "them", "therefore", "treated", "welfare". Score: 0.4566. Entity: vertical-level.
0.4545
vertical-level
boisecompletioncoveredestablishedextendshomeidaholargestlivestocknorthpayettepopulationriverruralvalley
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "completion", "covered", "established", "extends", "home", "idaho", "largest", "livestock", "north", "payette", "population", "river", "rural", "valley". Score: 0.4545. Entity: vertical-level.
0.4474
vertical-level
activitiescasescenterchurchesclubscommunitygroupinformationlocalmemberspublicpurposesreligioussocialsupportthoughyouth
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "cases", "center", "churches", "clubs", "community", "group", "information", "local", "members", "public", "purposes", "religious", "social", "support", "though", "youth". Score: 0.4474. Entity: vertical-level.
0.4444
vertical-level
adaannualartblockboisecapitalcountiesdowntownemployershomeidaholocallymajormetropolitannorthpopulationrivertechnologytreasurevalley
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "annual", "art", "block", "boise", "capital", "counties", "downtown", "employers", "home", "idaho", "locally", "major", "metropolitan", "north", "population", "river", "technology", "treasure", "valley". Score: 0.4444. Entity: vertical-level.
0.4416
vertical-level
adviceallowbuildcollaborativecollectivecomcommonlycommunitiescommunityconsumerevenexchangeexperiencefoundinformationinternetmembersonlinephysicallyprogramprovidingprovisionsratingsrelatedrepresentrolesignificantsupportsystemsystemstrustusersuseswebsites
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advice", "allow", "build", "collaborative", "collective", "com", "commonly", "communities", "community", "consumer", "even", "exchange", "experience", "found", "information", "internet", "members", "online", "physically", "program", "providing", "provisions", "ratings", "related", "represent", "role", "significant", "support", "system", "systems", "trust", "users", "uses", "websites". Score: 0.4416. Entity: vertical-level.
0.4403
vertical-level
administrationadvocatesaroundarrangementassetsbuildingcapitalcontractcontractingcorporationscostcostsdevelopmenteitherevidencefinancialfinancingfunderfundinggovernmenthigherhospitalsincreasinginfrastructureinstitutionsinvestmentinvolvementissueslong-termlowermaintainingmultipleoperatingoutoutsidepaidpartnershippartnershipsperformanceprivateprocessprojectspublicpubliclypurposerelatedresultingreturnsriskschoolssectorsharingstructurallysystemstaxtoolstransactionuserswater
KEYWORD OVERLAP (high): 59 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "advocates", "around", "arrangement", "assets", "building", "capital", "contract", "contracting", "corporations", "cost", "costs", "development", "either", "evidence", "financial", "financing", "funder", "funding", "government", "higher", "hospitals", "increasing", "infrastructure", "institutions", "investment", "involvement", "issues", "long-term", "lower", "maintaining", "multiple", "operating", "out", "outside", "paid", "partnership", "partnerships", "performance", "private", "process", "projects", "public", "publicly", "purpose", "related", "resulting", "returns", "risk", "schools", "sector", "sharing", "structurally", "systems", "tax", "tools", "transaction", "users", "water". Score: 0.4403. Entity: vertical-level.
0.4348
vertical-level
aggregateamongbusinesscentralciviccivildistinctenglishfamilygeneralgovernmentindependentindividualsinstitutionsinterestsorganizationsprivatesectorsocietyvalues
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "aggregate", "among", "business", "central", "civic", "civil", "distinct", "english", "family", "general", "government", "independent", "individuals", "institutions", "interests", "organizations", "private", "sector", "society", "values". Score: 0.4348. Entity: vertical-level.
0.4314
vertical-level
causeconsentcontroldatadifferentdigitaldisclosuredynamicforminformationissueslegalotherwisepoliticalprotectionpublicregardingrelationshiptechnologythemtypesuses
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cause", "consent", "control", "data", "different", "digital", "disclosure", "dynamic", "form", "information", "issues", "legal", "otherwise", "political", "protection", "public", "regarding", "relationship", "technology", "them", "types", "uses". Score: 0.4314. Entity: vertical-level.
0.4298
vertical-level
actamericanapplicableapplieschildchildrencivilcodecommercecommonlyconcerningdevelopmentdifferentdisabilitiesdiscriminationenforcementexpandedfairfamiliesfamilyfederalfinancingforcefundinghousinglawmakesmembernationalorganizedparticipatepeoplepoliticalprivateprogramsprotectedprovisionprovisionsracereligionrentalrightsseekstatustitletitlestribesurbanviolence
KEYWORD OVERLAP (high): 49 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "american", "applicable", "applies", "child", "children", "civil", "code", "commerce", "commonly", "concerning", "development", "different", "disabilities", "discrimination", "enforcement", "expanded", "fair", "families", "family", "federal", "financing", "force", "funding", "housing", "law", "makes", "member", "national", "organized", "participate", "people", "political", "private", "programs", "protected", "provision", "provisions", "race", "religion", "rental", "rights", "seek", "status", "title", "titles", "tribes", "urban", "violence". Score: 0.4298. Entity: vertical-level.
0.4250
vertical-level
acceptaccordingactionagainstagencyallowamericanamountscampaignscasecausecentercommissioncommitteesconsumercontributionscorporatecorporationsdatadatabasedecisionsdegreedonateddonationsdonordonorseffectiveeligibilityfederalfinancefinancingfollowingfoundfundedfundingfundsgeneralgivegovernedgovernmenthistoryhouseidentityindependentindividualindividualsinfluenceinformationjusticelargelargestlawleastlevelslocalmakingmillionnearlynonprofitofficesofficialsordinaryorganizationsoutparticularpeoplepoliticalpostprimaryprivatelypublicqualifyqualifyingreflectedrequirementsresponsiverolesinglespendingsubjectsubsidysurveyedthemwashingtonwork
KEYWORD OVERLAP (high): 85 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accept", "according", "action", "against", "agency", "allow", "american", "amounts", "campaigns", "case", "cause", "center", "commission", "committees", "consumer", "contributions", "corporate", "corporations", "data", "database", "decisions", "degree", "donated", "donations", "donor", "donors", "effective", "eligibility", "federal", "finance", "financing", "following", "found", "funded", "funding", "funds", "general", "give", "governed", "government", "history", "house", "identity", "independent", "individual", "individuals", "influence", "information", "justice", "large", "largest", "law", "least", "levels", "local", "making", "million", "nearly", "nonprofit", "offices", "officials", "ordinary", "organizations", "out", "particular", "people", "political", "post", "primary", "privately", "public", "qualify", "qualifying", "reflected", "requirements", "responsive", "role", "single", "spending", "subject", "subsidy", "surveyed", "them", "washington", "work". Score: 0.4250. Entity: vertical-level.
0.4236
vertical-level
actalgorithmsanalysisapplicationauthoritybecomebiasbiasedblackcannotcasescategorycertainchosencomplexitycontributecreateculturaldatadecisionsdescribesdesigndifferentdiscriminationenterevenexistingexpandexpectationsfacesfactorsfeaturesformsfunctionfunctioninggendergeneralharmfulhealthcarehistoricalhumanidentifiedidentifyimpactimplicationsinitialinstitutionalinstitutionsintelligenceissuejusticelegallimitationslinkedmediamultiplenetworkneutralonlineoutcomesphysicalplatformsproblemsprogramsprojectproposedprotectionracerecognitionregulationrepresentationresponsibilityresultssearchsinglesocialsocietysociotechnicalsoftwarestudysystemsystemstechnologytradetreatedusers
KEYWORD OVERLAP (high): 86 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "algorithms", "analysis", "application", "authority", "become", "bias", "biased", "black", "cannot", "cases", "category", "certain", "chosen", "complexity", "contribute", "create", "cultural", "data", "decisions", "describes", "design", "different", "discrimination", "enter", "even", "existing", "expand", "expectations", "faces", "factors", "features", "forms", "function", "functioning", "gender", "general", "harmful", "healthcare", "historical", "human", "identified", "identify", "impact", "implications", "initial", "institutional", "institutions", "intelligence", "issue", "justice", "legal", "limitations", "linked", "media", "multiple", "network", "neutral", "online", "outcomes", "physical", "platforms", "problems", "programs", "project", "proposed", "protection", "race", "recognition", "regulation", "representation", "responsibility", "results", "search", "single", "social", "society", "sociotechnical", "software", "study", "system", "systems", "technology", "trade", "treated", "users". Score: 0.4236. Entity: vertical-level.
0.4167
vertical-level
commercedistinctentryfrequentlygoverninggovernmentimmigrationinternallawlegalmattersnationalparticipateregulationsrights
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "commerce", "distinct", "entry", "frequently", "governing", "government", "immigration", "internal", "law", "legal", "matters", "national", "participate", "regulations", "rights". Score: 0.4167. Entity: vertical-level.
0.4167
vertical-level
associatedbehindboisecentercontainsextendsfederallyidaholargestmetropolitanowyheepopulationrecognizedtribalvalley
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "associated", "behind", "boise", "center", "contains", "extends", "federally", "idaho", "largest", "metropolitan", "owyhee", "population", "recognized", "tribal", "valley". Score: 0.4167. Entity: vertical-level.
0.4167
vertical-level
establishedidaholargestpopulationwashington
KEYWORD OVERLAP (high): 5 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "established", "idaho", "largest", "population", "washington". Score: 0.4167. Entity: vertical-level.
0.4159
vertical-level
architecturebasicbodybrainbroadcapacity-buildingcarechoicecommunicationscreatingcultureeducationeffectsexperiencedexposureframeworkgenderhealthhumanimpactindividualsinformationintegratedlawmodelneedorganizationspatternspeoplepotentialpracticepresentprinciplesprocessingpsychologyratherrelationshiprelationshipsresponsesresultingsafetysinglestatedsupporttherapeutictrauma-informedview
KEYWORD OVERLAP (high): 47 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "architecture", "basic", "body", "brain", "broad", "capacity-building", "care", "choice", "communications", "creating", "culture", "education", "effects", "experienced", "exposure", "framework", "gender", "health", "human", "impact", "individuals", "information", "integrated", "law", "model", "need", "organizations", "patterns", "people", "potential", "practice", "present", "principles", "processing", "psychology", "rather", "relationship", "relationships", "responses", "resulting", "safety", "single", "stated", "support", "therapeutic", "trauma-informed", "view". Score: 0.4159. Entity: vertical-level.
0.4141
vertical-level
addressadultsaggregateagriculturalamongaroundbarriersbecomebeginningbenefitschildrencoveragecrisisdomesticeducationfoodhelphungerlargestlocallow-incomemealmealsmillionnetprimaryprogramsprovidereceivereducesafetyschoolschoolssectorsecurityserveservingsocialstudentssupportingvulnerable
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "address", "adults", "aggregate", "agricultural", "among", "around", "barriers", "become", "beginning", "benefits", "children", "coverage", "crisis", "domestic", "education", "food", "help", "hunger", "largest", "local", "low-income", "meal", "meals", "million", "net", "primary", "programs", "provide", "receive", "reduce", "safety", "school", "schools", "sector", "security", "serve", "serving", "social", "students", "supporting", "vulnerable". Score: 0.4141. Entity: vertical-level.
0.4107
vertical-level
actadvantagesamericancapitalcertaincreateddesignateddesignationdesignedeconomicfundsimpactincomeinvestmentjobsleastloweroperateopportunityoutcomesprogramqualifiedtax
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "advantages", "american", "capital", "certain", "created", "designated", "designation", "designed", "economic", "funds", "impact", "income", "investment", "jobs", "least", "lower", "operate", "opportunity", "outcomes", "program", "qualified", "tax". Score: 0.4107. Entity: vertical-level.
0.4057
vertical-level
accessaccordingadvocatesaffordableannualaroundassessmentassociationcannotchoicecoldcomplicationscontributescostcostsdepartmentdevelopmentdriversearlyeconomicemergingevenfactorsfoodfoundgrantshealthhistoricallyhomehomelesshomelessnesshousingincreasedincreasinglyindividualindividualsindustryissuelargelesslevelslivinglowermajormillionnationaloutsidepeoplepercentpopulationratesrecentrecordrecordsreportresultingrolesheltershortagesignificantstructuralsubstantialsupplythemthoughurbanvaluesvehiclesviolencewashingtonwest
KEYWORD OVERLAP (high): 71 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "according", "advocates", "affordable", "annual", "around", "assessment", "association", "cannot", "choice", "cold", "complications", "contributes", "cost", "costs", "department", "development", "drivers", "early", "economic", "emerging", "even", "factors", "food", "found", "grants", "health", "historically", "home", "homeless", "homelessness", "housing", "increased", "increasingly", "individual", "individuals", "industry", "issue", "large", "less", "levels", "living", "lower", "major", "million", "national", "outside", "people", "percent", "population", "rates", "recent", "record", "records", "report", "resulting", "role", "shelter", "shortage", "significant", "structural", "substantial", "supply", "them", "though", "urban", "values", "vehicles", "violence", "washington", "west". Score: 0.4057. Entity: vertical-level.
0.3893
vertical-level
activityactualadvocacyadvocatesagencyamericanbecomebodiescomplexcorporationsexecutivefactorfederalfirmsfocusfollowedformfreegovernancegovernmentgroupsincreasingincreasinglyindependentindustryinfluencelobbyinglocalmembersmunicipalofficialspaidplacepoliticalpowerprofessionalprotectedpublicrecordregisteredreportrulessizespecificstreetstrongstructurestudysubjectsystemwashington
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "actual", "advocacy", "advocates", "agency", "american", "become", "bodies", "complex", "corporations", "executive", "factor", "federal", "firms", "focus", "followed", "form", "free", "governance", "government", "groups", "increasing", "increasingly", "independent", "industry", "influence", "lobbying", "local", "members", "municipal", "officials", "paid", "place", "political", "power", "professional", "protected", "public", "record", "registered", "report", "rules", "size", "specific", "street", "strong", "structure", "study", "subject", "system", "washington". Score: 0.3893. Entity: vertical-level.
0.3846
vertical-level
applicabledistrictlanduseszoning
KEYWORD OVERLAP (high): 5 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "applicable", "district", "land", "uses", "zoning". Score: 0.3846. Entity: vertical-level.
0.3839
vertical-level
actartartistsartsbusinessescenterscommunitiescommunitycommunity-basedcorporatecreatedcreativedefineddevelopersdistrictdynamiceventsformhelpedinvolvedissueslocalmediamembersnationalnetworksnormallyorganizationsparticipationpracticeprofessionalprojectsratesrecentrelatedsocialstreetstogethertriggerturnwarehousesworkworks
KEYWORD OVERLAP (high): 43 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "art", "artists", "arts", "businesses", "centers", "communities", "community", "community-based", "corporate", "created", "creative", "defined", "developers", "district", "dynamic", "events", "form", "helped", "involved", "issues", "local", "media", "members", "national", "networks", "normally", "organizations", "participation", "practice", "professional", "projects", "rates", "recent", "related", "social", "streets", "together", "trigger", "turn", "warehouses", "work", "works". Score: 0.3839. Entity: vertical-level.
0.3721
vertical-level
administrativeautonomybodycommunitiescontractcorporatederiveddistrictdivisionearlyenglishexchangegoverninggovernmentincorporationjurisdictionjurisdictionslimitedlocalnationalpermittingplaceplacespoliticalregionalsinglesmallsocialstatussuppliedturnwest
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administrative", "autonomy", "body", "communities", "contract", "corporate", "derived", "district", "division", "early", "english", "exchange", "governing", "government", "incorporation", "jurisdiction", "jurisdictions", "limited", "local", "national", "permitting", "place", "places", "political", "regional", "single", "small", "social", "status", "supplied", "turn", "west". Score: 0.3721. Entity: vertical-level.
0.3563
vertical-level
absenceaccordingactivitiesaffectamongautonomybroadercommunitycontributecreateculturaldecisionsdefinesdeterminesencompasseshealthindividuallifemerelyorganizationoverallpeoplepotentialprofessionalpsychologyratherrelationshipsresiliencerolesocialwork
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absence", "according", "activities", "affect", "among", "autonomy", "broader", "community", "contribute", "create", "cultural", "decisions", "defines", "determines", "encompasses", "health", "individual", "life", "merely", "organization", "overall", "people", "potential", "professional", "psychology", "rather", "relationships", "resilience", "role", "social", "work". Score: 0.3563. Entity: vertical-level.
0.3472
vertical-level
actualallowapproximatelyartartsassessmentcasesclientclientsclinicalcontrolcouncilcreationcreativedifferentdistinctessentialevidenceexistingfortyfoundfunctiongrowthhealthhelpincorporateslifemeaningmediamotornationalpaperpathwayspatternspeopleprocessprovidingpsychologypsychotherapyreduceregardingresiliencesafeseriesspacethemtherapiststherapythereforework
KEYWORD OVERLAP (high): 50 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actual", "allow", "approximately", "art", "arts", "assessment", "cases", "client", "clients", "clinical", "control", "council", "creation", "creative", "different", "distinct", "essential", "evidence", "existing", "forty", "found", "function", "growth", "health", "help", "incorporates", "life", "meaning", "media", "motor", "national", "paper", "pathways", "patterns", "people", "process", "providing", "psychology", "psychotherapy", "reduce", "regarding", "resilience", "safe", "series", "space", "them", "therapists", "therapy", "therefore", "work". Score: 0.3472. Entity: vertical-level.
0.3467
vertical-level
ableactiveactivityaroundbicycleeffectiveformsgoodshealthhumanincreaseincreasingindicatorsindividuallargelevelsmeanspeoplephysicalprogramspromotingpublicratesseparatelythoughtransportation
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "able", "active", "activity", "around", "bicycle", "effective", "forms", "goods", "health", "human", "increase", "increasing", "indicators", "individual", "large", "levels", "means", "people", "physical", "programs", "promoting", "public", "rates", "separately", "though", "transportation". Score: 0.3467. Entity: vertical-level.
0.3455
vertical-level
accordingaffordabilityagainstamongauthorityavailabilitybegancasescommonlyconstructioncontributediscriminatorydistrictdistrictsearlyeconomicenvironmentalexplicitlyhomelessnesshomeshouseshousinghundredsincreasejurisdictionlandlocallostlowermajormetropolitanofficialsoperatingoppositionplanningpolicepoliticalpowerprivatelypropertyprovisionpublicrealregardingregulationsresidentialrestrictionsrightsshortagesubstantialsupplysupportsystemthoughurbanvalueszoning
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "affordability", "against", "among", "authority", "availability", "began", "cases", "commonly", "construction", "contribute", "discriminatory", "district", "districts", "early", "economic", "environmental", "explicitly", "homelessness", "homes", "houses", "housing", "hundreds", "increase", "jurisdiction", "land", "local", "lost", "lower", "major", "metropolitan", "officials", "operating", "opposition", "planning", "police", "political", "power", "privately", "property", "provision", "public", "real", "regarding", "regulations", "residential", "restrictions", "rights", "shortage", "substantial", "supply", "support", "system", "though", "urban", "values", "zoning". Score: 0.3455. Entity: vertical-level.
0.3182
vertical-level
ableaccessaccessibilityaccordingaddressaffectingalonebarriersbenefitsbetterboundarycannotconditionscontentcontrolcorrectlycreatecurrentdesigneddevelopmentaldevicedisabilitiesdisabilityeffectsevenexperienceexperiencingextendsformalhandshearinghelphtmlincorporatedincreasinglyindividualsinformationlanguagelargelearninglinkslistlowmaintainedmeansmotornavigationneedsnoticeotherwisepeoplepermanentphysicalpracticepractitionersratherreceivedrestrictionsrisksinglesitesitessoftwaretemporarytextthemtoolstypesuserswebsites
KEYWORD OVERLAP (high): 70 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "able", "access", "accessibility", "according", "address", "affecting", "alone", "barriers", "benefits", "better", "boundary", "cannot", "conditions", "content", "control", "correctly", "create", "current", "designed", "developmental", "device", "disabilities", "disability", "effects", "even", "experience", "experiencing", "extends", "formal", "hands", "hearing", "help", "html", "incorporated", "increasingly", "individuals", "information", "language", "large", "learning", "links", "list", "low", "maintained", "means", "motor", "navigation", "needs", "notice", "otherwise", "people", "permanent", "physical", "practice", "practitioners", "rather", "received", "restrictions", "risk", "single", "site", "sites", "software", "temporary", "text", "them", "tools", "types", "users", "websites". Score: 0.3182. Entity: vertical-level.
0.2727
vertical-level
accessactivitiesactivitybroadcollectivelycommonlycompetitioncompletedcreateddegreedemandencompassesengagedenvironmentfacilitiesfreegaingeneralgenerallyindividuallessnecessarilyorganizedoutoutsideparksphysicalpopulationpurposesratherrecreationrenewalriskriversportstraining
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "activities", "activity", "broad", "collectively", "commonly", "competition", "completed", "created", "degree", "demand", "encompasses", "engaged", "environment", "facilities", "free", "gain", "general", "generally", "individual", "less", "necessarily", "organized", "out", "outside", "parks", "physical", "population", "purposes", "rather", "recreation", "renewal", "risk", "river", "sports", "training". Score: 0.2727. Entity: vertical-level.
0.2105
vertical-level
americanassociationblockcategorycreatedcrisiscurrentdepartmenteventsfeaturesfinancialgovernmentincorporatedissuelaterlocalmajormarkofficeofficialsparksperformancepoliticalprogrammingreceivedreceivingrecreationresponsereviewssecondseriesstaffsubsequentsupportingurbanwriters
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "american", "association", "block", "category", "created", "crisis", "current", "department", "events", "features", "financial", "government", "incorporated", "issue", "later", "local", "major", "mark", "office", "officials", "parks", "performance", "political", "programming", "received", "receiving", "recreation", "response", "reviews", "second", "series", "staff", "subsequent", "supporting", "urban", "writers". Score: 0.2105. Entity: vertical-level.
Provenance
Nonprofits Community refinery-treasurevalley-v1.0.0 94,257 chars · 0 entities · 0 sections 155 articles · 155 edges 8975a89d01569db0