—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Procurement Public Spending page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 135 edges
Information Vertical · Treasure Valley

Procurement Public Spending

0 Research Entities
135 Wikipedia Articles
135 Semantic Edges
0 Sections

Procurement and public spending in the Treasure Valley operate through a distributed network rather than a single regional purchasing authority. The principal buyers are Idaho executive agencies headquartered in Boise, Ada and Canyon counties, the cities of Boise, Meridian, Nampa, Caldwell, Eagle, Kuna and Garden City, the Ada County Highway District, Idaho Transportation Department District 3, Valley Regional Transit, Boise Airport, public school districts, charter schools, Boise State University, the College of Western Idaho, public health districts, urban-renewal agencies and special-purpose districts. Idaho’s Division of Purchasing, housed within the Department of Administration, manages purchasing policy and implementation for property acquisitions by state executive agencies, conducts and administers solicitations and contracts, trains purchasing personnel and serves as Idaho’s clearinghouse for federal surplus property at https://purchasing.idaho.gov/division-of-purchasing/. Its statewide entry point exposes bid opportunities, statewide contracts and open or anticipated solicitations at https://purchasing.idaho.gov/, while its legal framework page links the State Procurement Act, implementing administrative rules, exemptions and policy material at https://purchasing.idaho.gov/laws-and-policies/.

The statewide system distinguishes procurement of goods and services from public-works construction, local-government purchasing, professional services, information technology, federally funded acquisitions and transactions made by statutorily exempt entities. Idaho Code Title 67, Chapter 92 establishes the State Procurement Act, while the Division of Purchasing’s official legal index connects agencies and vendors to the operative statutes and administrative rules at https://purchasing.idaho.gov/laws-and-policies/. Local political subdivisions are principally governed by Idaho Code Title 67, Chapter 28, whose stated purpose is efficient and cost-effective procurement through a publicly accountable process balancing economy and quality; the Idaho Association of Counties’ official county contracting guide consolidates those requirements at https://idcounties.org/wp-content/uploads/2024/09/County-Contracting-and-Procurement-2024.pdf, and the Idaho State Bar’s Local Procurement Laws Manual supplies a detailed legal treatment of public works, personal property, services, exceptions, emergencies and judicial remedies at https://isb.idaho.gov/wp-content/uploads/11-2023-GOV-Local-Procurement-Laws-Manual.pdf.

Idaho Code §67-2805 governs procurement of public-works construction by political subdivisions and separates projects into Category A and Category B procedures. Category A generally turns on price, administrative responsiveness and possession of the required public-works license, while Category B permits qualification criteria before price competition; the operative statutory text is available at https://law.justia.com/codes/idaho/title-67/chapter-28/section-67-2805/. Idaho Code §67-5711C separately requires state public-works construction contracts to be awarded through competitive sealed bidding to the lowest responsible and responsive bidder unless another statutory delivery method applies, with the text reproduced at https://law.justia.com/codes/idaho/title-67/chapter-57/section-67-5711c/. The College of Western Idaho’s public-works procurement policy demonstrates how a Treasure Valley public institution operationalizes these statutes by requiring competitive sealed bidding, qualified contractors, responsiveness and either Category A or Category B procedures at https://cwi.edu/policies-procedures-manual/finance-administration-policies/admin-190-procurement-public-works.

Public-works procurement is inseparable from occupational licensing. Idaho’s Public Works Contractors License Board, administered by the Division of Occupational and Professional Licenses in Boise, regulates firms bidding on publicly funded construction and provides licensing, complaint, statute, rule and guidance access at https://dopl.idaho.gov/pwc/. A construction manager must hold the appropriate license when offering construction-management services on a publicly funded project with an estimated total cost of at least $10,000, as stated at https://dopl.idaho.gov/pwc/pwc-licensing/. Idaho maintains eight public-works license classes—Unlimited, AAA, AA, A, B, CC, C and D—and the license class determines the maximum project amount on which a contractor may bid based partly on net worth, working capital and completed-project history, as explained at https://dopl.idaho.gov/search-cateogry/pwc/. Applicants must pass the applicable examination before applying for licensure under the current process described at https://dopl.idaho.gov/pwc/pwc-exams/, and the official licensing fact sheet states that the examination tests Idaho public-works statutes, rules and contractor business-law material at https://dopl.idaho.gov/wp-content/uploads/2025/09/Public-Works-Program-Fact-Sheet.pdf.

The State Controller forms the fiscal-control and payment side of the procurement graph. The Controller establishes statewide internal pre-audit accounting controls intended to ensure that state funds are spent properly, as described at https://www.sco.idaho.gov/LivePages/duties-of-the-state-controller.aspx. Idaho’s purchasing-card program was created to simplify requisitioning, payment and reimbursement processes and reduce the paperwork and routing associated with smaller acquisitions at https://www.sco.idaho.gov/LivePages/fiscal-policies-p-card-policy.aspx. State invoice processing records vendor identity, invoice number, amount, accounting distribution and authorization data, and the payment workflow warns users about possible duplicate invoice numbers, as documented at https://www.sco.idaho.gov/LivePages/payment-services-enter-an-invoice.aspx. Legacy STARS expenditure and disbursement functions feed vendor-payment records and fiscal reporting at https://www.sco.idaho.gov/LivePages/stars-expenditures-and-disbursements.aspx, creating the accounting trail through which solicitations become purchase orders, invoices, warrants, disbursements and auditable vendor histories.

The modernization of Idaho’s financial infrastructure is itself a major procurement event. The State Controller described a split procurement strategy for the Luma enterprise-resource-planning program, with one request for proposals covering software and another covering systems integration, at https://www.sco.idaho.gov/LivePages/luma-the%20procurement%20process.aspx. Luma replaced or reorganized functions historically distributed across mainframe accounting, purchasing, vendor, human-resources and payment systems, and the Controller characterized the transition as a move from a mainframe environment to a cloud-based system at https://www.sco.idaho.gov/LivePages/luma-engage-here.aspx. This makes Boise not merely a location where state contracts are administered but the operational center of Idaho’s statewide procurement, accounting, vendor-master and payment-data architecture.

Boise’s municipal purchasing office operates within the Department of Finance and publishes information on electronic bidding and third-party solicitation services at https://www.cityofboise.org/departments/finance/purchasing/. Vendors can register to receive automatic notices, download solicitation packages and access award information through https://www.cityofboise.org/departments/finance/purchasing/vendor-information-and-registration/. The city maintains bid information and instructions at https://www.cityofboise.org/departments/finance/purchasing/bid-information/ and an archive of closed and awarded solicitations at https://www.cityofboise.org/departments/finance/purchasing/bids/. Boise’s procurement controls extend beyond posting opportunities: its internal auditors examined bid requests, specifications, contracts and supporting records in the 2023 purchasing-compliance audit at https://www.cityofboise.org/media/17209/2305purchasingcomplianceaudit.pdf and in the earlier purchasing audit at https://www.cityofboise.org/media/12448/2109purchasingaudit.pdf.

Boise’s procurement system is also a conduit for federal labor, housing and grant requirements. The city’s procurement and labor-standards procedures require formal bidding opportunities to be supported by specifications or a statement of work and advertised through the applicable process at https://www.cityofboise.org/media/20309/procurement-and-labor-standards-policies-and-procedures.pdf. Housing and community-development projects financed with federal funds can carry Section 3 contractor and worker requirements, illustrated by Boise’s developer-plan documentation at https://www.cityofboise.org/media/18138/developer-plan-template-ihfa.pdf. The resulting procurement graph joins the city’s Finance Department to HUD funding, affordable housing, labor compliance, developers, general contractors, subcontractors and income-qualified workers rather than ending at the municipal purchase order.

Ada County runs its own solicitation and contract process, with individual bid, RFP, RFI and auction records published through its procurement application. The county’s records show acquisitions ranging from emergency-generator maintenance at https://apps.adacounty.id.gov/admin/bids/bid.aspx?key=48 to mobile data terminals for the Sheriff’s patrol fleet at https://apps.adacounty.id.gov/Admin/bids/bid.aspx?key=88, custodial services at https://apps.adacounty.id.gov/Admin/bids/bid.aspx?key=556 and construction work at Expo Idaho documented at https://apps.adacounty.id.gov/admin/documents/bids/BID18083/Bid18083_AddendumNo2.pdf. These records reveal procurement as the connective mechanism between county government and public safety, facilities, information technology, fleet operations, sanitation, courts, elections, solid waste, parks and event infrastructure.

Ada County’s public-spending landscape expanded substantially through federal pandemic-recovery funding. Its American Rescue Plan Act recovery report states that the county received $93,542,629 in State and Local Fiscal Recovery Funds and documents the allocation and performance structure at https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2023/08/ARPA-Ada-County-Recovery-Plan-Performance-2023.pdf. ARPA transformed procurement demand by funding or supplementing public-health response, governmental operations, infrastructure and recovery-related initiatives, linking federal Treasury rules to county budgeting, subrecipient monitoring, contract administration and performance reporting.

The Ada County Highway District is a distinctive Treasure Valley institution because it is a countywide highway district rather than a conventional municipal public-works department. ACHD uses OpenGov as its electronic bidding and vendor-management system and states that the platform is free to applicants and bidders at https://www.achdidaho.org/projects/bids-procurement. Its procurements connect road design, pavement, bridges, traffic signals, drainage, rights of way, construction engineering, materials testing, professional consulting and land development across Boise, Meridian, Eagle, Garden City, Kuna and unincorporated Ada County. This institutional separation means a road project can involve a city’s land-use approvals and utilities, ACHD’s roadway procurement, COMPASS regional planning, ITD state or federal funding and private development contributions in the same project graph.

Idaho Transportation Department District 3 is one of the largest public buyers shaping the Treasure Valley’s construction and professional-services market. District 3 covers southwest Idaho, maintains more than 2,600 lane miles and nearly 400 bridges across approximately 22,000 square miles, and is headquartered on West Chinden Boulevard in Boise at https://itd.idaho.gov/district-3-southwest-idaho/. Highway construction and maintenance advertisements and bid results are published at https://itd.idaho.gov/contractor-bidding/, while engineering, inspection, planning, design and other professional-service opportunities are administered through the Consultant Services Section at https://itd.idaho.gov/consultant-services/. ITD’s 2026 consultant listing included an Ada County construction-engineering-and-inspection opportunity for Star Road to State Highway 16, demonstrating that regional transportation procurement continues to generate work for engineering, inspection, surveying, testing and project-management firms through https://itd.idaho.gov/consultant-services/.

Transportation procurement in the Treasure Valley is strongly conditioned by federal funding. ITD’s consultant solicitations carry contract-administration, civil-rights, environmental, inspection and federal-aid requirements, as illustrated by the Ada County Columbia Road-to-Victory Road construction-engineering procurement at https://apps.itd.idaho.gov/Apps/cau/solicitations/24818_RFP.pdf. The department’s directory identifies separate functions for contractor bidding, construction materials, consultant services, civil rights, environmental services, bridge design, planning and District 3 administration at https://itd.idaho.gov/department-directory/. A single federally assisted highway contract can therefore connect the Federal Highway Administration, ITD headquarters, District 3, local governments, licensed prime contractors, disadvantaged business enterprises, engineering consultants, testing laboratories, material suppliers, utilities and property owners.

Valley Regional Transit is the principal transit-procurement authority serving Ada and Canyon counties. Its procurement page separately publishes requests for proposals, bids, quotes and information, notices of intent to award, sole-source procurements and disadvantaged-business-enterprise materials at https://www.valleyregionaltransit.org/about-us/procurement/. A 2025 solicitation sought a management contractor for fixed-route, ADA complementary paratransit and microtransit operations across both counties and identified VRT facilities in Ada and Canyon counties at https://www.valleyregionaltransit.org/wp-content/uploads/2025/03/RFP-REG-BASE-25-2-Transit-Management-Services-for-Ada-and-Canyon-Counties-.pdf. Other procurements have covered fare-payment technology at https://www.valleyregionaltransit.org/wp-content/uploads/2025/04/RFP-IT-25-2-Electronic-Farebox-Mobile-Ticketing-System.pdf, renewable-natural-gas credits at https://www.valleyregionaltransit.org/wp-content/uploads/2025/04/Request-for-Proposal-DEV-BASE-001-25-3-Renewable-Natural-Gas-Credits.pdf and on-call construction at https://www.valleyregionaltransit.org/wp-content/uploads/2025/05/SOLICITATION-RFP-DEV-BASE-001-25-4-On-Call-General-Construction-2025-2029-.pdf.

VRT demonstrates the direct connection between public procurement and healthcare. Its active procurement page included a solicitation for a non-emergency medical transportation provider for Rides2Wellness at https://www.valleyregionaltransit.org/about-us/procurement/. That service converts healthcare access into a transportation contract involving scheduling systems, qualified operators, medical destinations, accessibility requirements, patient eligibility, federal transit rules and local health-service networks. Procurement therefore becomes the enforceable edge connecting mobility, disability accommodation, Medicaid-adjacent services, hospitals, clinics and regional public transportation.

Boise Airport procurement joins municipal ownership with Federal Aviation Administration requirements, airline infrastructure, concessions, rental-car operations, security, construction and disadvantaged-business-enterprise obligations. The airport’s DBE program describes technical assistance concerning bid specifications, procurement policies, contracting procedures and specific opportunities at https://iflyboise.com/media/1431/2018dbe-program.pdf. Airport spending consequently links the City of Boise to FAA grants, federally required DBE participation, architects, engineers, runway and terminal contractors, concessionaires, security vendors, airlines and ground-transportation operators.

Meridian’s annual budget is the city’s principal authorization document for operating purchases, personnel, grants, debt and capital projects. The FY2027 proposed budget ties spending choices to the city’s mission, strategic plan and annual objectives at https://meridiancity.org/media/onznuesh/fy2027-proposed-budget-book.pdf, while the FY2025 adopted budget records the legally adopted financial plan at https://meridiancity.org/media/mh4dnrgc/fy2025-adopted-budget-8-27-24.pdf. Meridian’s comprehensive plan directs departments to use the plan when setting work programs, budgets, capital improvements and code amendments at https://meridiancity.org/media/ymqjvmsj/adopted-meridian-comprehensive-plan.pdf. Procurement demand is therefore downstream from population growth, comprehensive planning, impact fees, utility master plans, public-safety service levels and the capital-improvement program rather than an isolated administrative activity.

Nampa divides opportunities among general city bids, legal work, public works, finance, community-development consulting, the Ford Idaho Center and the Nampa Development Corporation, with those channels indexed at https://www.cityofnampa.us/405/Bids-and-Proposals. Public-works bid and RFP documents are distributed through QuestCDN according to https://www.cityofnampa.us/443/Bid-Postings-RFP, while individual notices appear at https://www.cityofnampa.us/bids.aspx. Nampa’s procurement portfolio includes water and sewer infrastructure, airport planning, traffic technology, telecommunications, cultural and convention facilities, audit services and federally funded community-development planning. A 2026 procurement for vulnerable-road-user detection explicitly identified COMPASS, ACHD and ITD as regional partners, showing the interagency technology edge at https://www.cityofnampa.us/bids.aspx?bidid=66.

Nampa’s infrastructure acquisitions illustrate the connection between procurement, growth and utility finance. The city issued a request for proposals for the Purdam Trunk Sewer Extension at https://www.cityofnampa.us/bids.aspx?bidID=40 and used contractor prequalification for an annual waterline-replacement project at https://www.cityofnampa.us/DocumentCenter/View/13172/Request-for-General-Contractor-Qualifications_FY21WaterlineReplacement_5421. These projects turn development forecasts, water rights, treatment capacity, rate revenue, engineering design, excavation, pipe and fitting supply, traffic control and environmental compliance into contracted public works. Nampa’s use of progressive design-build was discussed as a two-step qualifications-and-proposal process in council records at https://www.cityofnampa.us/AgendaCenter/ViewFile/Minutes/_05062019-1891, documenting the region’s movement beyond traditional design-bid-build for complex infrastructure.

Caldwell’s Finance Department administers banking, accounts payable, payroll, grants, fixed assets, budgeting, auditing, investments, debt payments and capital-construction financial reporting for both the city and Caldwell Urban Renewal Agency at https://www.cityofcaldwell.org/Departments/Finance. Caldwell’s transparency portal provides access to contracts, awarded bids, payment records and project documents at https://www.cityofcaldwell.org/Government/Mayor/Transparency. Its records policy classifies airport construction files—including plans, bids, specifications, project diaries, correspondence and agreements—as permanent records at https://www.cityofcaldwell.org/files/assets/city/v/1/city-clerk/documents/city-of-caldwell-records-policy.pdf, illustrating how procurement documentation also functions as the institutional memory of public infrastructure.

Canyon County’s procurements cover courts, detention, the sheriff, elections, parks, solid waste, the fairgrounds, information technology, fleet and facilities. Its 2025 construction-manager/general-contractor solicitation for the Pond Lane Detention Facility identified an initial project estimate of $10 million and contemplated procurement and installation of security technology, generators, controls, prefabricated detention units and pre-engineered structures at https://www.canyoncounty.id.gov/wp-content/uploads/2025/06/CMGC-Pond-Lane-Detention-Facility-Project-06-25-2025-D3-zjw.pdf. The county has also published formal sole-source notices, such as the grader procurement notice at https://www.canyoncounty.id.gov/wp-content/uploads/2025/06/Grader-notice.pdf, showing how noncompetitive acquisitions are documented and exposed to public comment.

The Canyon County Fair Expo Building procurement demonstrates the overlap among county capital planning, public works, event infrastructure and regional agriculture. The county used a qualifications stage to identify contractors eligible to bid, emphasized quality, schedule, cost and minimal disruption, and sought completion before the 2021 Canyon County Fair at https://www.canyoncounty.id.gov/wp-content/uploads/2020/07/7.7.2020-Canyon-County-Fair-Expo-RFQ.pdf. The project connected county facilities staff, licensed contractors, livestock and agricultural exhibitors, fair operations, structural design, materials suppliers and public-event scheduling.

Boise State University is a major institutional buyer whose procurements span construction, research equipment, software, professional services, laboratory supplies, athletics, housing, food service, facilities and academic operations. Its vendor and supplier page publishes current solicitations and buyer contacts at https://www.boisestate.edu/vpfa-p2p/vendor-supplier-information-for-businesses/. The College of Western Idaho similarly purchases construction, technology, instructional equipment, facilities services and professional support across its Ada and Canyon County campuses, and its public-works policy at https://cwi.edu/policies-procedures-manual/finance-administration-policies/admin-190-procurement-public-works shows direct incorporation of Idaho competitive-bidding law. A CWI utility and infrastructure solicitation imposed public-works, labor-preference and drug-free-workplace requirements at https://cwi.edu/sites/default/files/1/itb_01-2019_utility_and_infrastructure_project_-_final_4-10-19.pdf.

The workforce pipeline is broader than employees holding “buyer” titles. Public procurement depends on purchasing agents, contract specialists, accountants, budget analysts, auditors, estimators, project managers, engineers, attorneys, construction managers, inspectors, grant administrators, information-technology specialists and accounts-payable personnel. The College of Western Idaho’s regional business-career data identifies procurement and budgeting as core duties of project-management specialists and reports 434 annual openings, a median wage of $39.58 per hour and 17.55 percent projected growth for 2025–2035 at https://cwi.edu/academics/academic-transfer/business. The same page identifies regional demand for accountants and auditors, management analysts, construction managers, cost estimators, logistics managers and budget analysts, all of whom occupy functional nodes in the public-spending system at https://cwi.edu/academics/academic-transfer/business.

Professional development and interagency standardization are supported by the Idaho Public Purchasing Association, the state chapter associated with public-procurement practitioners. Its resource page distributes tools such as Boise’s procurement-process matrix for adaptation by other agencies at https://nigp-idaho.org/Resources. The association’s role links state and local buyers, contract administrators, legal counsel, vendors and national procurement standards, improving the portability of solicitation templates, evaluation methods, ethics controls and contract-management practices across Treasure Valley institutions.

Public records law supplies the transparency layer around the procurement lifecycle. Idaho agencies must preserve and disclose responsive procurement records subject to statutory exemptions, and the Department of Administration explains that Idaho Code §74-103 allows up to ten working days to respond to requests from Idaho residents and up to thirty-five calendar days for nonresidents under the post-July 1, 2024 framework at https://adm.idaho.gov/public-record-request/. Bid tabulations, evaluation records after award, executed contracts, invoices, change orders, payment records, audits and governing-board minutes consequently form a recoverable evidence chain connecting appropriations to vendors and delivered assets.

Risk allocation continues after award. Idaho’s Risk Management Program protects state assets and employees and administers coverage and loss-control functions at https://adm.idaho.gov/risk-management-program/. The Idaho Tort Claims Act, Idaho Code Title 6, Chapter 9, governs state and local governmental liability, employee defense, claims procedures, exceptions and liability limits, as summarized at https://adm.idaho.gov/risk-management-program/tort-claims/. Construction contracts, professional-service agreements and operating procurements therefore connect purchasing decisions to insurance, indemnification, bonding, workers’ compensation, safety, claims and litigation exposure.

The Treasure Valley procurement market is shaped by rapid population growth and the resulting need for roads, utilities, schools, public safety, transit, parks, airports, health services and administrative technology. Meridian’s comprehensive-plan-to-budget linkage at https://meridiancity.org/media/ymqjvmsj/adopted-meridian-comprehensive-plan.pdf, ITD District 3’s regional infrastructure responsibility at https://itd.idaho.gov/district-3-southwest-idaho/, Nampa’s water and sewer procurements at https://www.cityofnampa.us/bids.aspx?bidID=40, ACHD’s electronic public-works marketplace at https://www.achdidaho.org/projects/bids-procurement and VRT’s two-county operating contracts at https://www.valleyregionaltransit.org/wp-content/uploads/2025/03/RFP-REG-BASE-25-2-Transit-Management-Services-for-Ada-and-Canyon-Counties-.pdf collectively show that public spending is the contractual operating system through which regional growth becomes physical and institutional capacity.

The strongest knowledge-graph representation of this vertical treats an appropriation, grant or enterprise-fund revenue source as the upstream node; the buyer, legal authority, procurement method, solicitation, addendum, bidder, evaluation, award, contract, purchase order, invoice, payment, change order, asset, operating department and audit finding as separately typed entities; and geographic service area, federal funding source, professional license, disadvantaged-business status, bonding, insurance, prevailing contract conditions and public-record location as traversable attributes. Boise’s archived awards at https://www.cityofboise.org/departments/finance/purchasing/bids/, ACHD’s OpenGov system at https://www.achdidaho.org/projects/bids-procurement, ITD’s bid-results portal at https://itd.idaho.gov/contractor-bidding/, VRT’s procurement page at https://www.valleyregionaltransit.org/about-us/procurement/, Caldwell’s transparency portal at https://www.cityofcaldwell.org/Government/Mayor/Transparency and State Controller payment controls at https://www.sco.idaho.gov/LivePages/payment-services-enter-an-invoice.aspx provide the principal evidence surfaces for constructing that graph.

https://purchasing.idaho.gov/ — Idaho Division of Purchasing entry point for state bid opportunities, statewide contracts and solicitations.

https://purchasing.idaho.gov/division-of-purchasing/ — Official description of the Division of Purchasing’s authority, functions and organizational role.

https://purchasing.idaho.gov/laws-and-policies/ — Official index of Idaho procurement statutes, administrative rules, policies and exemptions.

https://idcounties.org/wp-content/uploads/2024/09/County-Contracting-and-Procurement-2024.pdf — Idaho Association of Counties guide to county contracting and procurement requirements.

https://isb.idaho.gov/wp-content/uploads/11-2023-GOV-Local-Procurement-Laws-Manual.pdf — Idaho State Bar manual covering local procurement, public works, exceptions and legal remedies.

https://law.justia.com/codes/idaho/title-67/chapter-28/section-67-2805/ — Text of Idaho Code §67-2805 governing political-subdivision public-works bidding.

https://law.justia.com/codes/idaho/title-67/chapter-57/section-67-5711c/ — Text of Idaho Code §67-5711C governing state public-project competitive sealed bidding.

https://dopl.idaho.gov/pwc/ — Idaho Public Works Contractors License Board portal.

https://dopl.idaho.gov/pwc/pwc-licensing/ — Public-works contractor and construction-manager licensing requirements.

https://dopl.idaho.gov/search-cateogry/pwc/ — Public-works license classes and bid-limit information.

https://dopl.idaho.gov/pwc/pwc-exams/ — Current public-works examination process.

https://dopl.idaho.gov/wp-content/uploads/2025/09/Public-Works-Program-Fact-Sheet.pdf — Official licensing and examination fact sheet.

https://www.sco.idaho.gov/LivePages/duties-of-the-state-controller.aspx — State Controller’s constitutional fiscal-control duties.

https://www.sco.idaho.gov/LivePages/fiscal-policies-p-card-policy.aspx — Idaho purchasing-card policy and control framework.

https://www.sco.idaho.gov/LivePages/payment-services-enter-an-invoice.aspx — State invoice-entry, vendor and payment-control procedures.

https://www.sco.idaho.gov/LivePages/stars-expenditures-and-disbursements.aspx — STARS expenditure, disbursement and vendor-payment documentation.

https://www.sco.idaho.gov/LivePages/luma-the%20procurement%20process.aspx — Procurement strategy used for Idaho’s Luma ERP modernization.

https://www.sco.idaho.gov/LivePages/luma-engage-here.aspx — State Controller material describing the Luma modernization transition.

https://www.cityofboise.org/departments/finance/purchasing/ — City of Boise Purchasing office and electronic-solicitation information.

https://www.cityofboise.org/departments/finance/purchasing/vendor-information-and-registration/ — Boise vendor registration, notifications and award-access information.

https://www.cityofboise.org/departments/finance/purchasing/bid-information/ — Boise bid-process instructions.

https://www.cityofboise.org/departments/finance/purchasing/bids/ — Boise closed and awarded bid archive.

https://www.cityofboise.org/media/17209/2305purchasingcomplianceaudit.pdf — Boise’s 2023 purchasing-compliance audit.

https://www.cityofboise.org/media/12448/2109purchasingaudit.pdf — Boise’s earlier internal purchasing audit.

https://www.cityofboise.org/media/20309/procurement-and-labor-standards-policies-and-procedures.pdf — Boise procurement and federally connected labor-standards procedures.

https://adacounty.id.gov/clerk/wp-content/uploads/sites/9/2023/08/ARPA-Ada-County-Recovery-Plan-Performance-2023.pdf — Ada County ARPA award, allocation and performance report.

https://www.achdidaho.org/projects/bids-procurement — ACHD electronic bidding and vendor-management portal.

https://itd.idaho.gov/district-3-southwest-idaho/ — ITD District 3 jurisdiction, infrastructure and regional-office information.

https://itd.idaho.gov/contractor-bidding/ — ITD highway construction advertisements and bid results.

https://itd.idaho.gov/consultant-services/ — ITD engineering and professional-services solicitations.

https://itd.idaho.gov/department-directory/ — ITD contracting, construction, civil-rights, environmental and District 3 contacts.

https://apps.itd.idaho.gov/Apps/cau/solicitations/24818_RFP.pdf — Ada County construction-engineering and inspection solicitation illustrating ITD consultant procurement.

https://www.valleyregionaltransit.org/about-us/procurement/ — VRT solicitations, awards, sole-source notices and DBE information.

https://www.valleyregionaltransit.org/wp-content/uploads/2025/03/RFP-REG-BASE-25-2-Transit-Management-Services-for-Ada-and-Canyon-Counties-.pdf — Two-county transit-management procurement.

https://www.valleyregionaltransit.org/wp-content/uploads/2025/04/RFP-IT-25-2-Electronic-Farebox-Mobile-Ticketing-System.pdf — VRT farebox and mobile-ticketing technology procurement.

https://www.valleyregionaltransit.org/wp-content/uploads/2025/04/Request-for-Proposal-DEV-BASE-001-25-3-Renewable-Natural-Gas-Credits.pdf — VRT renewable-natural-gas-credit procurement.

https://www.valleyregionaltransit.org/wp-content/uploads/2025/05/SOLICITATION-RFP-DEV-BASE-001-25-4-On-Call-General-Construction-2025-2029-.pdf — VRT on-call construction solicitation.

https://iflyboise.com/media/1431/2018dbe-program.pdf — Boise Airport disadvantaged-business-enterprise and contracting-assistance program.

https://meridiancity.org/media/onznuesh/fy2027-proposed-budget-book.pdf — Meridian FY2027 proposed operating and capital budget.

https://meridiancity.org/media/mh4dnrgc/fy2025-adopted-budget-8-27-24.pdf — Meridian FY2025 adopted budget.

https://meridiancity.org/media/ymqjvmsj/adopted-meridian-comprehensive-plan.pdf — Meridian comprehensive plan linking growth policy to budgets and capital improvements.

https://www.cityofnampa.us/405/Bids-and-Proposals — Nampa index of general, legal, public-works and development-related solicitations.

https://www.cityofnampa.us/443/Bid-Postings-RFP — Nampa public-works bid and RFP distribution information.

https://www.cityofnampa.us/bids.aspx — Nampa’s current and historical bid-posting system.

https://www.cityofnampa.us/bids.aspx?bidid=66 — Nampa vulnerable-road-user technology solicitation involving regional partner agencies.

https://www.cityofnampa.us/bids.aspx?bidID=40 — Purdam Trunk Sewer Extension professional-services procurement.

https://www.cityofnampa.us/DocumentCenter/View/13172/Request-for-General-Contractor-Qualifications_FY21WaterlineReplacement_5421 — Nampa waterline-project contractor-prequalification document.

https://www.cityofnampa.us/AgendaCenter/ViewFile/Minutes/_05062019-1891 — Nampa council record discussing progressive design-build procurement.

https://www.cityofcaldwell.org/Departments/Finance — Caldwell Finance Department’s budgeting, payment, audit and capital-project responsibilities.

https://www.cityofcaldwell.org/Government/Mayor/Transparency — Caldwell contracts, awards, payment records and public-project transparency portal.

https://www.cityofcaldwell.org/files/assets/city/v/1/city-clerk/documents/city-of-caldwell-records-policy.pdf — Caldwell records-retention rules for bids, contracts and airport construction files.

https://www.canyoncounty.id.gov/wp-content/uploads/2025/06/CMGC-Pond-Lane-Detention-Facility-Project-06-25-2025-D3-zjw.pdf — Canyon County detention-facility CM/GC solicitation and project requirements.

https://www.canyoncounty.id.gov/wp-content/uploads/2025/06/Grader-notice.pdf — Canyon County sole-source procurement notice.

https://www.canyoncounty.id.gov/wp-content/uploads/2020/07/7.7.2020-Canyon-County-Fair-Expo-RFQ.pdf — Canyon County Fair Expo Building contractor-qualification procurement.

https://www.boisestate.edu/vpfa-p2p/vendor-supplier-information-for-businesses/ — Boise State University vendor and solicitation information.

https://cwi.edu/policies-procedures-manual/finance-administration-policies/admin-190-procurement-public-works — College of Western Idaho public-works procurement policy.

https://cwi.edu/sites/default/files/1/itb_01-2019_utility_and_infrastructure_project_-_final_4-10-19.pdf — CWI utility and infrastructure invitation to bid.

https://cwi.edu/academics/academic-transfer/business — Treasure Valley occupational data for project management, accounting, estimating, logistics and budget work.

https://nigp-idaho.org/Resources — Idaho Public Purchasing Association tools and procurement resources.

https://adm.idaho.gov/public-record-request/ — Idaho Department of Administration public-record request rules and response periods.

https://adm.idaho.gov/risk-management-program/ — Idaho Risk Management Program responsibilities.

https://adm.idaho.gov/risk-management-program/tort-claims/ — Idaho Tort Claims Act summary and governmental claims procedures.

Idaho’s procurement regime contains a separate qualifications-based market for architects, engineers, landscape architects, construction managers and professional land surveyors. Idaho Code §67-2320 requires public agencies to select these professionals through demonstrated competence and qualifications rather than initial price competition when the anticipated professional fee exceeds the statutory threshold, while permitting negotiation of fair and reasonable compensation after ranking; the governing text appears at https://law.justia.com/codes/idaho/title-67/chapter-23/section-67-2320/. This rule changes the competitive structure of Treasure Valley capital projects because engineering and design firms do not win covered assignments merely by submitting the lowest fee: they must accumulate relevant project history, licensed personnel, municipal familiarity, references and documented technical capacity before fee negotiations begin. The result is a repeat-player market in which experience obtained on Boise, Meridian, Nampa, Caldwell, Ada County, Canyon County, highway, airport, utility and educational projects becomes a reusable qualification asset.

The current IDAPA 38.05.01 rules apply to state agencies conducting procurements and vendors participating in those procurements, establish enforceable procedures for delegated purchasing authority and contested cases, and define the operational rules beneath the State Procurement Act at https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/current/38/380501.pdf. The rule addresses record preservation, communication methods, authority delegation, cooperative purchasing, specifications, solicitation procedures, evaluation, contract award, protests and administrative review. Procurement compliance in Boise-centered state government is therefore not exhausted by reading Idaho Code: vendors must also understand agency delegation limits, mandatory solicitation language, response formalities, evaluation procedures and protest deadlines embedded in administrative rule.

Idaho’s official procurement desk manual translates statutes and administrative rules into daily operating procedures for state purchasing employees at https://purchasing.idaho.gov/wp-content/uploads/2018/12/Desk_manual-correct-links-dec-18.pdf. The manual explains acquisition planning, competition, solicitation preparation, evaluation, award, contract administration, emergency purchasing, sole-source treatment and records management, while expressly subordinating its guidance to Idaho Code, IDAPA, purchasing policy and attorney-general authority. This creates a three-layer compliance graph for Treasure Valley vendors seeking state work: statutory authorization defines what government may do, IDAPA defines enforceable procedure, and the desk manual reveals how procurement personnel are trained to execute those requirements.

Idaho’s state procurement system permits cooperative purchasing, allowing public buyers to use contracts competitively established by other governmental entities or purchasing organizations rather than independently repeating every solicitation. The Division of Purchasing identifies NASPO ValuePoint, OMNIA Partners, RFxPremier, Sourcewell and the Texas Department of Information Resources as available cooperative channels at https://purchasing.idaho.gov/purchasing-cooperatives/. Cooperative acquisition compresses the local vendor market because a Boise-area agency can procure technology, vehicles, equipment, software or services through a national master contract whose principal competition occurred outside Idaho. Local firms that wait only for a Boise-area solicitation may therefore never see an opportunity that has effectively been awarded through an upstream cooperative vehicle.

NASPO ValuePoint describes its model as cooperative procurement conducted through a lead-state structure at https://naspovaluepoint.org/cooperative-contracts/. Demand aggregation can give smaller Treasure Valley governments pricing and contractual protections that resemble those available to much larger jurisdictions, but it can also concentrate spending among vendors capable of winning and servicing multistate agreements. The same mechanism that reduces duplicate administrative work can narrow entry points for smaller Idaho suppliers unless they become authorized resellers, subcontractors or local implementation partners to the national contract holders.

The Idaho Public Purchasing Association’s cooperative-purchasing guidance explains that political subdivisions can obtain economic advantages by directly purchasing from existing competitively established contracts at https://nigpidaho.starchapter.com/downloads/ippa_cooperative_purchasing_programs_for_political_subdivisions.pdf. This links rural and small-city purchasing capacity to Treasure Valley procurement because regional suppliers serving Boise or Meridian may also reach smaller Idaho jurisdictions through the same cooperative contract, while national vendors can enter southwest Idaho without establishing a locally originated contract. Cooperative eligibility is therefore a market-distribution mechanism, not merely an administrative convenience.

Meridian maintains a dedicated Procurement Division that administers contracts and competitively acquires municipal goods and services at https://meridiancity.org/finance/procurement/. The city’s procurement interface includes vendor registration, active opportunities, purchasing terms and procurement policy, making Meridian an independent buyer rather than an appendage of Ada County or Boise. Its sustained population and infrastructure growth creates recurring demand in wastewater treatment, drinking water, parks, public safety, information technology, fleet, facilities, professional engineering and construction services.

Meridian states that it uses the Bonfire electronic procurement platform for vendor registration and solicitation distribution, advertises bids in the Meridian Press, and directs vendors offering lower-value goods and services to contact procurement personnel regarding acquisitions below $10,000 at https://meridiancity.org/finance/procurement/faq/. This creates two distinct access paths: publicly advertised competition for formal purchases and relationship-dependent vendor awareness for small acquisitions. Firms that monitor only formal bid portals leave lower-dollar recurring work to competitors that maintain commodity registration, local contacts and current capability descriptions.

Ada County separately identifies Bonfire as the platform through which it posts bids, requests for proposals and other solicitations at https://adacounty.id.gov/procurement/suppliers/. The county’s adoption of the same platform used by Meridian lowers the technical cost of monitoring both governments, but commodity codes, vendor profiles and notification settings determine whether a supplier actually sees relevant work. Digital availability does not eliminate information asymmetry when vendor classification is incomplete, notifications are misconfigured or solicitation terminology differs from the language used by local businesses.

Bonfire, IonWave, EqualLevel and DemandStar have been consolidated into Euna Procurement, which markets a full-cycle public-sector procurement platform at https://eunasolutions.com/solutions/procurement/. The integration of historically separate sourcing and vendor-network products means local solicitations are increasingly mediated through a consolidated commercial software layer that can control registration, document distribution, questions, addenda, evaluation workflows and supplier discovery. Treasure Valley procurement data may be publicly generated, but practical participation increasingly depends on privately operated platforms whose interface design and notification systems influence which suppliers discover and respond to opportunities.

The broader Euna consolidation combined acquired procurement products including Bonfire, DemandStar, EqualLevel and IonWave, as documented at https://www.businesswire.com/news/home/20240820626790/en/Euna-Solutions-Launches-Industry-First-Full-Cycle-Procurement-Offering-Purpose-Built-for-the-Public-Sector. This acquisition strategy concentrates public-sector sourcing infrastructure among fewer software operators. The market implication for Treasure Valley governments is vendor dependence beyond license pricing: changing platforms can require migration of supplier records, templates, historical evaluations, contract files and user workflows, while suppliers must repeatedly adapt to interfaces controlled by distant software owners.

OpenGov represents a parallel consolidation channel in local-government technology. Cox Enterprises acquired majority ownership of OpenGov in February 2024 at https://www.coxenterprises.com/press-releases/cox-enterprises-acquires-majority-ownership-of-opengov/. The transaction placed a government budgeting, finance, asset-management and procurement platform under a large family-owned enterprise, demonstrating that public procurement infrastructure has become a high-value acquisition category rather than a minor administrative software niche. Where a local government adopts multiple modules from one provider, budgeting, solicitation, contract administration and asset data can become vertically integrated within a single commercial ecosystem.

The OpenGov transaction valued the company at approximately $1.8 billion and left management and employees holding continuing equity under the Cox umbrella, according to transaction counsel at https://www.kslaw.com/news-and-insights/king-spalding-advises-cox-enterprises-in-acquisition-of-majority-interest-of-opengov-at-18-billion-valuation. This valuation signals investor expectations that government software revenues are durable because agencies face high switching costs, long implementation cycles and continuing compliance needs. The ownership structure matters locally because public entities may retain formal control over procurement decisions while the technical architecture governing those decisions becomes concentrated in nationally scaled private platforms.

QuestCDN constitutes another specialized intermediary in the public-works market. It distributes plans and specifications, maintains plan-holder information, issues addenda and supports electronic bidding at https://www.questcdn.com/solicitors/. This functionality is especially consequential for Treasure Valley utility, road and civil-construction projects because a contractor’s failure to obtain an addendum through the recognized distribution channel can render a bid nonresponsive. The platform is not simply a directory; it becomes part of the legally significant communication chain between owner, engineer, general contractor, subcontractors and material suppliers.

QuestCDN was acquired by BCI Central, an operating subsidiary of Sweden-based Byggfakta Group, according to the transaction adviser at https://quazarinc.com/questcdn. The acquisition connected a public bidding-document platform to a larger construction-data and market-intelligence business. This ownership relationship creates a potential data edge between publicly advertised projects and commercial construction-lead intelligence because plan distribution reveals project type, location, estimated timing, plan-holder activity and bidder interest before final award.

Idaho Public Notices aggregates notices published by newspapers throughout Idaho, including advertisements for bids, financial reports, hearings and ordinances, at https://www.idahopublicnotices.com/. This service remains important where statutes or local procedures require newspaper publication even when an electronic procurement portal is also used. A complete Treasure Valley opportunity-monitoring system must therefore join procurement-platform records to legally published notices because either source alone can be incomplete, delayed or indexed under different agency and project names.

Public Purchase maintains a State of Idaho agency portal for bid notifications, reverse auctions and government procurement tools at https://www.publicpurchase.com/gems/state%2Cid/buyer/public/home. The coexistence of Public Purchase, Bonfire, OpenGov, QuestCDN, cooperative-contract repositories, newspaper notices and agency-hosted document pages fragments supplier discovery. Commercial bid aggregators gain value from normalizing those disconnected sources, but their summaries can omit amendments, legal conditions or authoritative attachments; vendors must treat aggregators as discovery layers and retrieve controlling documents from the issuing agency or designated bidding platform.

Idaho Bid Network indexes municipal solicitations and illustrates the commercial directory layer surrounding official procurement at https://www.idahobids.com/government-agencies/ada/meridian-city-of-4176/. Such aggregators can expose opportunities across agencies without separate portal searches, but they also create a paid-information market around records ultimately originating from public bodies. The supplier with the best monitoring stack can gain a timing advantage over equally qualified competitors, meaning procurement openness does not automatically produce equal discovery capability.

HigherGov similarly profiles city contracting opportunities and spending forecasts at https://www.highergov.com/sl/agency/city-of-meridian-22980/. Commercial normalization can help businesses compare agencies, deadlines and historical activity, yet no aggregator substitutes for the official solicitation because addenda, mandatory conferences, bonding requirements and submission instructions can change after initial indexing. The knowledge-graph model should preserve both the aggregator-discovery edge and the official-source authority edge rather than merging them into one undifferentiated record.

Public-works procurement is constrained by contractor preference and labor rules in addition to bid procedure. The College of Western Idaho’s policy cross-reference identifies Idaho Code §67-2348 governing preference for Idaho-domiciled public-works contractors and Idaho Code Title 44, Chapter 10 governing employment of Idaho residents on public works at https://cwi.edu/policies-procedures-manual/finance-administration-policies/admin-190-procurement-public-works. These requirements connect procurement to business domicile, labor sourcing and workforce availability. A nominally low bid may carry additional legal consequences when contractor residence, reciprocal preference rules or workforce obligations apply.

Idaho’s municipal procurement manual explains that cities face different procedures for public works, ordinary materials and supplies, and architectural or engineering services, and that dollar thresholds determine when formal competition is required at https://cdn.ymaws.com/idahocities.org/resource/dynamic/blogs/20200630_134635_31088.pdf. The distinction prevents a single generic “government bid” classification from representing the market accurately. Each opportunity must be typed by buyer, funding source, acquisition category, estimated value, procurement method, professional-license requirement and statutory exception.

Idaho Code §67-2320 creates an especially strong cross-domain edge between procurement and professional licensing because the covered services are performed by regulated design and construction professionals at https://law.justia.com/codes/idaho/title-67/chapter-23/section-67-2320/. A public agency’s qualifications evaluation is therefore partly an assessment of licensed human capital: firms need registered professionals, relevant project experience and adequate capacity, while the procurement record identifies which specialized expertise government demand is purchasing. This makes requests for qualifications a valuable labor-market dataset as well as a contracting record.

Boise State University’s supply-chain-management program explicitly prepares graduates for procurement, project management, logistics, inventory planning and process improvement at https://www.boisestate.edu/cobe-itscm/supply-chain-management/. The program feeds both sides of the regional market: graduates can enter public purchasing offices or join contractors, distributors, utilities and technology vendors that sell to government. Procurement capability is therefore formed through general supply-chain education as well as government-specific certification.

Boise State’s construction-management program has trained construction managers for more than forty years at https://www.boisestate.edu/coen-cm/. Its longevity matters because the Treasure Valley’s public-works market depends on a locally embedded managerial workforce familiar with estimating, scheduling, safety, contracts, subcontractor coordination and project controls. Alumni employed by owners, engineering firms, general contractors and specialty contractors form a relationship network that can accelerate project delivery while also reinforcing the advantage of established regional firms.

The Boise State–College of Western Idaho construction-management transfer pathway teaches contract development, estimating, budgeting, safety, leadership, planning and scheduling for commercial, heavy-civil, industrial and infrastructure work at https://www.boisestate.edu/coen-students/students/transfer-students/construction-management-cwi-transfer-pathway/. This pathway lowers the transition barrier from community-college education into four-year construction management and directly supports the labor pool required by publicly funded roads, utilities, schools and government buildings. The educational edge is measurable through later contractor qualifications because resumes and project histories submitted in public procurements are downstream products of this training system.

The Idaho Public Purchasing Association promotes Certified Professional Public Buyer credentials for nonmanagerial and supervisory procurement practitioners at https://www.nigp-idaho.org/Certification. Certification converts procurement experience into a portable signal of competency and can shape public hiring because agencies need personnel capable of writing specifications, protecting competition, evaluating responses, administering contracts and defending decisions during protests or audits. The presence of certified procurement staff reduces institutional dependence on individual memory and creates a more standardized professional field across Treasure Valley agencies.

The Universal Public Procurement Certification Council describes the CPPO and CPPB credentials as recognized standards applicable across federal, state and local government organizations at https://uppcc.org/certification/. These credentials distinguish executive procurement leadership from buyer-level professional competence and create a workforce ladder from purchasing technician or buyer to contract manager, procurement officer and chief procurement official. Public bodies that employ certified staff also communicate procedural maturity to auditors and vendors because certification requires demonstrated knowledge beyond clerical purchasing.

The NIGP Certified Procurement Professional examination assesses the competency of mid- and senior-level procurement leaders at https://www.pearsonvue.com/us/en/nigp.html. The coexistence of NIGP-CPP, CPPO and CPPB credentials means public procurement in the Treasure Valley is developing as a profession with independent competency standards rather than remaining an incidental duty assigned to finance personnel. This professionalization matters as agencies purchase cloud systems, cybersecurity, artificial intelligence, alternative construction delivery and performance-based services that cannot be evaluated solely by comparing unit prices.

Ada County’s procurement office publicly identifies personnel holding CPPO, CPPB and NIGP-CPP credentials at https://adacounty.id.gov/procurement/. The county therefore provides direct local evidence that national certification pathways are embedded in Treasure Valley government operations. Certified leadership can influence solicitation structure, negotiation strategy, cooperative use, supplier engagement and protest defensibility across county departments.

Idaho Power’s supplier-diversity program provides a private-utility comparison to government procurement at https://www.idahopower.com/about-us/doing-business-with-us/supplier-information/supplier-diversity-program/. The utility reported that 59 percent of more than $197.7 million purchased from Idaho and Oregon businesses in 2022 went to small businesses and states that its program assists veteran-owned, women-owned and disadvantaged firms in competing within its supply chain. Idaho Power is not governed identically to municipal procurement, but many of the same Treasure Valley contractors, engineers, technology vendors and material suppliers compete for both utility and governmental work; supplier-development capability in one market can therefore increase capacity in the other.

Carahsoft’s Idaho contract page identifies a state cloud-solutions agreement derived from a NASPO ValuePoint participating addendum and states that Idaho public agencies may use the vehicle to procure cloud services at https://www.carahsoft.com/buy/slg-contracts/idaho-state-contracts. This creates an intermediary structure in which government may acquire products from major technology manufacturers through a contract-holding reseller rather than contracting directly with each software producer. The reseller’s portfolio, authorized partners and contract catalog become practical gatekeepers to public cloud spending.

CAI operates the State of Idaho managed-service-provider structure for contingent information-technology labor at https://www.cai.io/services/contingent-workforce-solutions/idaho. The model centralizes temporary technology staffing through an intermediary that manages supplier participation and hiring workflows. This changes local market structure because small Boise technology consultancies may sell labor through the managed-service system rather than contract directly with each state agency, inserting a private coordination layer between public demand, staffing suppliers and individual consultants.

The state’s ability to use reverse auctions is recognized in NASPO’s Idaho repository, which cites Idaho Code §67-9221 and provides state procurement-practice resources at https://www.naspo.org/states/idaho/rosp/. Reverse auctions move selected acquisitions from sealed static pricing toward iterative online price competition. They can produce lower prices for standardized goods but favor suppliers with sufficient margin, inventory visibility and digital bidding capacity, making them less suitable for ambiguous professional services or complex projects where quality differences dominate.

The Association of Government Accountants’ Idaho procurement presentation maps the division between state-agency procurement and purchasing by political subdivisions and summarizes applicable statutes, administrative rules and thresholds at https://www.agacgfm.org/Images/ChapterWebsites/Idaho-Centennial-Chapter/libraries/files/State%20Procurement%20in%20Idaho_AGA_April%202024.pdf. The division explains why vendors cannot treat Idaho government as one customer: state agencies, cities, counties, school districts and special districts may apply different authority, thresholds, portals and approval structures even when purchasing similar products.

Public procurement increasingly determines how artificial intelligence enters local government. Research on city AI acquisition found that legacy procurement laws, institutional routines and decision authority shape which systems governments purchase and how algorithmic risk is addressed at https://arxiv.org/abs/2411.04994. The implication for the Treasure Valley is direct: agencies adopting automated screening, policing analytics, transportation systems, permitting tools, chatbots or decision-support software will govern those systems partly through specifications, evaluation criteria, data-rights clauses, audit provisions and contract remedies rather than technology policy alone.

Research examining public-sector AI fact sheets found that vendor self-disclosures can support dialogue and shared understanding but are limited as standalone risk-assessment instruments because they must simultaneously market products and disclose risk at https://arxiv.org/abs/2604.01332. Treasure Valley agencies procuring AI should therefore connect vendor disclosures to independent testing, data-governance requirements, performance metrics, incident reporting and contractual audit rights. A voluntary questionnaire without enforceable contract language cannot reliably allocate liability or guarantee continuing transparency after award.

Research on indefinite-delivery, indefinite-quantity contracting identifies a structural tension between administrative efficiency and transparency at https://arxiv.org/abs/2104.08276. This applies to regional on-call engineering, construction and professional-services contracts because the competitively awarded master agreement may be public while individual task-order scope, pricing and distribution among selected firms receive less attention. A procurement knowledge graph must therefore represent master contract, vendor pool, task order, project location, amount and completion separately; treating the master award as the entire transaction conceals actual spending allocation.

Open-procurement-data research demonstrates that award notices can be modeled as relationships among contracting authorities, suppliers, categories, locations and amounts, allowing analysts to identify dominant vendors and spending patterns at https://arxiv.org/abs/1611.02118. The same analytical structure is applicable to Treasure Valley records, but local implementation requires entity resolution across inconsistent legal names, subsidiaries, assumed business names, joint ventures and acquisition histories. A contractor appearing under several names can otherwise look like several competitors rather than one economic group.

Procurement-data research also documents substantial quality defects in large award datasets and uses automated and human-assisted methods to produce analytically usable records at https://arxiv.org/abs/2305.18317. Treasure Valley spending intelligence requires the same discipline because solicitation titles, award notices, council agendas, payment ledgers and vendor files may use different identifiers and descriptions. Reliable graph construction must preserve source provenance, distinguish inferred links from explicit ones and retain the original record alongside every normalized entity.

The combined structure explains why procurement intelligence is central to a Treasure Valley regional knowledge graph. Public spending reveals planned infrastructure before completion, identifies firms with verified government experience, exposes relationships between grants and projects, maps labor and material demand, and records which private platforms mediate access to public markets. The disciplined objective is not merely to collect bid notices; it is to connect appropriation, authority, solicitation, vendor, beneficial owner, professional license, cooperative vehicle, subcontractor, task order, invoice, asset, geography and service outcome. That structure fits the goal of producing an AI-ready regional directory because it distinguishes a company that merely advertises a capability from one whose capability has been tested through a documented public contract, while forcing every inferred commercial relationship back to verifiable evidence.

https://law.justia.com/codes/idaho/title-67/chapter-23/section-67-2320/ — Idaho Code governing qualifications-based selection of design professionals, construction managers and land surveyors.

https://proddfmmainsa.blob.core.windows.net/dfm-admin-website/rules/current/38/380501.pdf — Current IDAPA rules governing state procurement procedures, delegated authority and contested cases.

https://purchasing.idaho.gov/wp-content/uploads/2018/12/Desk_manual-correct-links-dec-18.pdf — Idaho’s practical state procurement desk manual.

https://purchasing.idaho.gov/purchasing-cooperatives/ — Idaho Division of Purchasing page identifying authorized cooperative-purchasing channels.

https://naspovaluepoint.org/cooperative-contracts/ — NASPO ValuePoint’s explanation of its lead-state cooperative-contract model.

https://nigpidaho.starchapter.com/downloads/ippa_cooperative_purchasing_programs_for_political_subdivisions.pdf — Idaho guidance on cooperative purchasing by political subdivisions.

https://meridiancity.org/finance/procurement/ — City of Meridian Procurement Division, vendor and solicitation entry point.

https://meridiancity.org/finance/procurement/faq/ — Meridian vendor-registration, advertising and small-purchase information.

https://adacounty.id.gov/procurement/suppliers/ — Ada County supplier instructions and Bonfire platform notice.

https://eunasolutions.com/solutions/procurement/ — Euna Procurement’s integrated Bonfire, IonWave, EqualLevel and DemandStar platform description.

https://www.businesswire.com/news/home/20240820626790/en/Euna-Solutions-Launches-Industry-First-Full-Cycle-Procurement-Offering-Purpose-Built-for-the-Public-Sector — Documentation of Euna’s procurement-software consolidation strategy.

https://www.coxenterprises.com/press-releases/cox-enterprises-acquires-majority-ownership-of-opengov/ — Cox Enterprises’ announcement of majority ownership of OpenGov.

https://www.kslaw.com/news-and-insights/king-spalding-advises-cox-enterprises-in-acquisition-of-majority-interest-of-opengov-at-18-billion-valuation — Transaction details for the OpenGov acquisition and valuation.

https://www.questcdn.com/solicitors/ — QuestCDN services for electronic plan distribution, addenda and bidding.

https://quazarinc.com/questcdn — Transaction adviser’s account of BCI Central’s acquisition of QuestCDN.

https://www.idahopublicnotices.com/ — Statewide aggregation of legally published bid advertisements, financial reports and government notices.

https://www.publicpurchase.com/gems/state%2Cid/buyer/public/home — Public Purchase’s State of Idaho procurement and reverse-auction portal.

https://www.idahobids.com/government-agencies/ada/meridian-city-of-4176/ — Commercial aggregation of Meridian-area government solicitations.

https://www.highergov.com/sl/agency/city-of-meridian-22980/ — Commercial profile of Meridian procurement opportunities and forecasts.

https://cdn.ymaws.com/idahocities.org/resource/dynamic/blogs/20200630_134635_31088.pdf — Idaho municipal procurement manual covering goods, public works, professional services and thresholds.

https://www.boisestate.edu/cobe-itscm/supply-chain-management/ — Boise State supply-chain education covering procurement, logistics and project management.

https://www.boisestate.edu/coen-cm/ — Boise State construction-management program and its regional workforce role.

https://www.boisestate.edu/coen-students/students/transfer-students/construction-management-cwi-transfer-pathway/ — Construction-management transfer pathway linking CWI and Boise State.

https://www.nigp-idaho.org/Certification — Idaho Public Purchasing Association information on professional buyer certification.

https://uppcc.org/certification/ — CPPO and CPPB public-procurement certification standards.

https://www.pearsonvue.com/us/en/nigp.html — NIGP-CPP examination and competency description.

https://adacounty.id.gov/procurement/ — Ada County procurement office and certified procurement personnel.

https://www.idahopower.com/about-us/doing-business-with-us/supplier-information/supplier-diversity-program/ — Idaho Power supplier-diversity program and small-business purchasing data.

https://www.carahsoft.com/buy/slg-contracts/idaho-state-contracts — Carahsoft’s Idaho cloud and cooperative-contract vehicles.

https://www.cai.io/services/contingent-workforce-solutions/idaho — State of Idaho contingent information-technology workforce managed-service structure.

https://www.naspo.org/states/idaho/rosp/ — NASPO repository describing Idaho procurement practices and reverse-auction authority.

https://www.agacgfm.org/Images/ChapterWebsites/Idaho-Centennial-Chapter/libraries/files/State%20Procurement%20in%20Idaho_AGA_April%202024.pdf — Government-accounting presentation mapping Idaho procurement statutes, rules and buyer types.

https://arxiv.org/abs/2411.04994 — Research on how municipal procurement practices shape public-sector artificial-intelligence governance.

https://arxiv.org/abs/2604.01332 — Research evaluating vendor self-disclosure documents used in government AI procurement.

https://arxiv.org/abs/2104.08276 — Research on transparency and efficiency problems in indefinite-delivery contracting.

https://arxiv.org/abs/1611.02118 — Research demonstrating relational analysis of open public-spending data.

https://arxiv.org/abs/2305.18317 — Research on cleaning, normalizing and analyzing large public-procurement award datasets.


SEMANTIC EDGE LEDGER · PROCUREMENT_PUBLIC_SPENDING · refinery-treasurevalley-v1.0.0
59 🌲 EVERGREEN · 76 🌿 BRANCH · 0 🫐 BERRY · 0 🌱 SEED
59 🌲 EVERGREEN
76 🌿 BRANCH
0 🫐 BERRY
0 🌱 SEED
Articles raw: 140 · Deduped: 135 · Entities: 0 · Sections: 0 · Noise filtered: 0 · Dropped noise: 0 · Dropped dupes: 5
KW HIGH 76 EXACT TITLE 59
◈ 🌲 EVERGREEN 59 EDGES
1.00
Accounting ↗ Q4116214 EXACT TITLE
vertical-level
accounting
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "accounting". Entity: vertical-level.
1.00
vertical-level
accounts payable
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "accounts payable". Entity: vertical-level.
1.00
vertical-level
ada county highway district
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ada county highway district". Entity: vertical-level.
1.00
vertical-level
ada county,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ada county,". Entity: vertical-level.
1.00
vertical-level
affordable housing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "affordable housing". Entity: vertical-level.
1.00
Airport ↗ Q1248784 EXACT TITLE
vertical-level
airport
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "airport". Entity: vertical-level.
1.00
vertical-level
american rescue plan act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "american rescue plan act". Entity: vertical-level.
1.00
Architect ↗ Q42973 EXACT TITLE
vertical-level
architect
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "architect". Entity: vertical-level.
1.00
vertical-level
artificial intelligence
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "artificial intelligence". Entity: vertical-level.
1.00
vertical-level
boise airport
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise airport". Entity: vertical-level.
1.00
vertical-level
boise state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise state university". Entity: vertical-level.
1.00
Bridge ↗ Q12280 EXACT TITLE
vertical-level
bridge
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "bridge". Entity: vertical-level.
1.00
vertical-level
canyon county,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "canyon county,". Entity: vertical-level.
1.00
Carahsoft ↗ Q5037630 EXACT TITLE
vertical-level
carahsoft
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "carahsoft". Entity: vertical-level.
1.00
vertical-level
college of western idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "college of western idaho". Entity: vertical-level.
1.00
Procurement ↗ Q829492 EXACT TITLE
vertical-level
procurement
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "procurement". Entity: vertical-level.
1.00
vertical-level
construction engineering
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "construction engineering". Entity: vertical-level.
1.00
vertical-level
construction management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "construction management". Entity: vertical-level.
1.00
Contract ↗ Q93288 EXACT TITLE
vertical-level
contract
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "contract". Entity: vertical-level.
1.00
vertical-level
cox enterprises
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "cox enterprises". Entity: vertical-level.
1.00
vertical-level
disadvantaged business enterprise
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "disadvantaged business enterprise". Entity: vertical-level.
1.00
vertical-level
e-procurement
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "e-procurement". Entity: vertical-level.
1.00
vertical-level
federal aviation administration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "federal aviation administration". Entity: vertical-level.
1.00
vertical-level
federal highway administration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "federal highway administration". Entity: vertical-level.
1.00
vertical-level
garden city,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "garden city,". Entity: vertical-level.
1.00
vertical-level
general contractor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "general contractor". Entity: vertical-level.
1.00
vertical-level
government budget
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "government budget". Entity: vertical-level.
1.00
vertical-level
government procurement
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "government procurement". Entity: vertical-level.
1.00
Idaho ↗ Q1221 EXACT TITLE
vertical-level
idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho". Entity: vertical-level.
1.00
Grant ↗ Q219140 EXACT TITLE
vertical-level
grant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "grant". Entity: vertical-level.
1.00
Highway ↗ Q269949 EXACT TITLE
vertical-level
highway
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "highway". Entity: vertical-level.
1.00
vertical-level
idaho power
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho power". Entity: vertical-level.
1.00
vertical-level
infrastructure
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "infrastructure". Entity: vertical-level.
1.00
vertical-level
internal audit
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "internal audit". Entity: vertical-level.
1.00
Inventory ↗ Q815410 EXACT TITLE
vertical-level
inventory
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "inventory". Entity: vertical-level.
1.00
vertical-level
invitation to
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "invitation to". Entity: vertical-level.
1.00
Invoice ↗ Q190581 EXACT TITLE
vertical-level
invoice
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "invoice". Entity: vertical-level.
1.00
vertical-level
knowledge graph
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "knowledge graph". Entity: vertical-level.
1.00
vertical-level
landscape architect
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "landscape architect". Entity: vertical-level.
1.00
Logistics ↗ Q177777 EXACT TITLE
vertical-level
logistics
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "logistics". Entity: vertical-level.
1.00
OpenGov ↗ Q17084399 EXACT TITLE
vertical-level
opengov
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "opengov". Entity: vertical-level.
1.00
vertical-level
paratransit
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "paratransit". Entity: vertical-level.
1.00
vertical-level
public records
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "public records". Entity: vertical-level.
1.00
vertical-level
public transport
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "public transport". Entity: vertical-level.
1.00
vertical-level
public works
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "public works". Entity: vertical-level.
1.00
vertical-level
purchase order
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "purchase order". Entity: vertical-level.
1.00
vertical-level
request for
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "request for". Entity: vertical-level.
1.00
vertical-level
request for proposal
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "request for proposal". Entity: vertical-level.
1.00
vertical-level
request for
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "request for". Entity: vertical-level.
1.00
vertical-level
reverse auction
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "reverse auction". Entity: vertical-level.
1.00
vertical-level
risk management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "risk management". Entity: vertical-level.
1.00
vertical-level
small business
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "small business". Entity: vertical-level.
1.00
vertical-level
subcontractor
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "subcontractor". Entity: vertical-level.
1.00
vertical-level
supply chain
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "supply chain". Entity: vertical-level.
1.00
Surveying ↗ Q816425 EXACT TITLE
vertical-level
surveying
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "surveying". Entity: vertical-level.
1.00
Tort ↗ Q158970 EXACT TITLE
vertical-level
tort
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "tort". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
1.00
vertical-level
valley regional transit
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "valley regional transit". Entity: vertical-level.
1.00
vertical-level
wastewater treatment
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "wastewater treatment". Entity: vertical-level.
◈ 🌿 BRANCH 76 EDGES
0.7742
vertical-level
analysisanalyticsanalyzingbudgetingbusinesscomplexcompliancecontractcontrolscostsdatadevelopmentefficiencyexpenditureimprovinginventorymanagementmonitoringplanningprocessprocurementpurposesourcingsupplier
KEYWORD OVERLAP (high): 24 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "analysis", "analytics", "analyzing", "budgeting", "business", "complex", "compliance", "contract", "controls", "costs", "data", "development", "efficiency", "expenditure", "improving", "inventory", "management", "monitoring", "planning", "process", "procurement", "purpose", "sourcing", "supplier". Score: 0.7742. Entity: vertical-level.
0.6905
vertical-level
compliancecontractcontractscontractualcostefficiencyensurefinancialhelpimplementingimprovementslawlegalliabilitylifecyclemanagementnegotiationobligationsoperationalorganizationalprocessesreducerenewalrequirementsrisksignificantsoftwarethroughoutunderstanding
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "compliance", "contract", "contracts", "contractual", "cost", "efficiency", "ensure", "financial", "help", "implementing", "improvements", "law", "legal", "liability", "lifecycle", "management", "negotiation", "obligations", "operational", "organizational", "processes", "reduce", "renewal", "requirements", "risk", "significant", "software", "throughout", "understanding". Score: 0.6905. Entity: vertical-level.
0.6667
vertical-level
adaboiseeagleidahomilespopulation
KEYWORD OVERLAP (high): 6 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "eagle", "idaho", "miles", "population". Score: 0.6667. Entity: vertical-level.
0.6429
vertical-level
adaamongboisecapitalcitiesidahomakingmeridianpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population". Score: 0.6429. Entity: vertical-level.
0.6000
vertical-level
agencybidbiddingconstructioncontractsdeliverydesigndiffersentitiesmethodownerprojectseparatesubstantialtraditional
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "bid", "bidding", "construction", "contracts", "delivery", "design", "differs", "entities", "method", "owner", "project", "separate", "substantial", "traditional". Score: 0.6000. Entity: vertical-level.
0.6000
vertical-level
abilityaccessfederalgovernmentinformationlevelslocalpublicrecords
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "access", "federal", "government", "information", "levels", "local", "public", "records". Score: 0.6000. Entity: vertical-level.
0.6000
vertical-level
adaadditionalboisegainidahokunanearlypercentpopulation
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "additional", "boise", "gain", "idaho", "kuna", "nearly", "percent", "population". Score: 0.6000. Entity: vertical-level.
0.5882
vertical-level
affordabledepartmentdevelopmentdiffersfederalfundsgoalgovernmentsgrantgrantshousinginfrastructurelesslocalprogramprogramsspecificstatedsubjecturban
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "affordable", "department", "development", "differs", "federal", "funds", "goal", "governments", "grant", "grants", "housing", "infrastructure", "less", "local", "program", "programs", "specific", "stated", "subject", "urban". Score: 0.5882. Entity: vertical-level.
0.5789
vertical-level
approximatelyboisecaldwellcanyoncollegeidaholocallymilesoregonpopulationwest
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "miles", "oregon", "population", "west". Score: 0.5789. Entity: vertical-level.
0.5701
vertical-level
administrationagreementsamendmentsamonganalysisbusinesschangescommercialcomplexcomplianceconditionsconstructionconsultantscontractcontractsdetaileddocumentingemployeesengagemententerprisesexposurefinancialfoundgoodsimplementationimprovementsinvoiceslargerlegallifecyclemanagementmultiplenearlyoperationalorderspartnersperformanceprivateprocessprocessesprofessionalsprojectspropertyprovidepublicpublishedpurchasepurposeregulatedreportrequireriskrolesoftwarespecificationssummarizedsystemstechnicaltermsutilityvendors
KEYWORD OVERLAP (high): 61 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "agreements", "amendments", "among", "analysis", "business", "changes", "commercial", "complex", "compliance", "conditions", "construction", "consultants", "contract", "contracts", "detailed", "documenting", "employees", "engagement", "enterprises", "exposure", "financial", "found", "goods", "implementation", "improvements", "invoices", "larger", "legal", "lifecycle", "management", "multiple", "nearly", "operational", "orders", "partners", "performance", "private", "process", "processes", "professionals", "projects", "property", "provide", "public", "published", "purchase", "purpose", "regulated", "report", "require", "risk", "role", "software", "specifications", "summarized", "systems", "technical", "terms", "utility", "vendors". Score: 0.5701. Entity: vertical-level.
0.5641
vertical-level
chainchannelscontractcostdevelopingdevelopmentdifferencesdistinctenvironmentfirmsgoodsimprovementincreaseindividualinfrastructureissuinglaborlowestmanagementmarketneedsnegotiationoperationsorderspaymentplacedplanningpriceprocessprocessesprocurementprofessionalspurchasepurchasingrepresentssourcingstrategicsuppliersupplierssupplysupporttotaltraditionaltransactions
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "chain", "channels", "contract", "cost", "developing", "development", "differences", "distinct", "environment", "firms", "goods", "improvement", "increase", "individual", "infrastructure", "issuing", "labor", "lowest", "management", "market", "needs", "negotiation", "operations", "orders", "payment", "placed", "planning", "price", "process", "processes", "procurement", "professionals", "purchase", "purchasing", "represents", "sourcing", "strategic", "supplier", "suppliers", "supply", "support", "total", "traditional", "transactions". Score: 0.5641. Entity: vertical-level.
0.5510
vertical-level
agenciesairportsbridgesbuildingscivilconstructiondepartmentsdesigndisciplinedistinguishengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicroadsstructuralsystemsworks
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agencies", "airports", "bridges", "buildings", "civil", "construction", "departments", "design", "discipline", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public", "roads", "structural", "systems", "works". Score: 0.5510. Entity: vertical-level.
0.5455
vertical-level
accordingactivityanalysisbecomescarrycasesdefinedesigndisciplinedocumentationengineerengineeringengineersenvironmentestablishedestimategeneralgovernmentjurisdictionslegallicenselicensedlicensurelocalmaintenanceplanspractitionersprocessproductsprofessionalprojectprojectspropertyprovidepublicrelevantreportsrequireresponsibilitysafetyservicingsimplytasktechnicaltitleunderstandvaluationwork
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "activity", "analysis", "becomes", "carry", "cases", "define", "design", "discipline", "documentation", "engineer", "engineering", "engineers", "environment", "established", "estimate", "general", "government", "jurisdictions", "legal", "license", "licensed", "licensure", "local", "maintenance", "plans", "practitioners", "process", "products", "professional", "project", "projects", "property", "provide", "public", "relevant", "reports", "require", "responsibility", "safety", "servicing", "simply", "task", "technical", "title", "understand", "valuation", "work". Score: 0.5455. Entity: vertical-level.
0.5455
vertical-level
administersagencydepartmentdepartmentsdevelopmentdirectlyexecuteexecutivefederalgovernmenthomehousinghudlawspoliciesprogramreportsurban
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administers", "agency", "department", "departments", "development", "directly", "execute", "executive", "federal", "government", "home", "housing", "hud", "laws", "policies", "program", "reports", "urban". Score: 0.5455. Entity: vertical-level.
0.5397
vertical-level
acquireagencyassistanceauthorizedawardcarrycollectivelycriteriadirecteconomicentityfederalfinancialformfundinggeneralgovernmentgrantgrantsissuedlawlocalorganizationsoutsideprivateprogramsprojectspropertypublicpurposerevenuesimilarspecificsupport
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquire", "agency", "assistance", "authorized", "award", "carry", "collectively", "criteria", "direct", "economic", "entity", "federal", "financial", "form", "funding", "general", "government", "grant", "grants", "issued", "law", "local", "organizations", "outside", "private", "programs", "projects", "property", "public", "purpose", "revenue", "similar", "specific", "support". Score: 0.5397. Entity: vertical-level.
0.5273
vertical-level
biddingbudgetbudgetingbuildingcertifiedconstructioncontractingcontractorcontractorscontractualcostsensurefinancialhelpknowledgelawprofessionprofessionalprojectprojectedprojectsqualifiedresponsiblesidesubmissionsurveyorstitlevaluationwork
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "bidding", "budget", "budgeting", "building", "certified", "construction", "contracting", "contractor", "contractors", "contractual", "costs", "ensure", "financial", "help", "knowledge", "law", "profession", "professional", "project", "projected", "projects", "qualified", "responsible", "side", "submission", "surveyors", "title", "valuation", "work". Score: 0.5273. Entity: vertical-level.
0.5200
vertical-level
americanassociationcostcostsdatadefinesdocumentedengineeringestablishedestimateestimatingfebruarygovernmentindividualmethodsofficepointpotentialprocessprogramprojectreliablescopesingletotalvalue
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "american", "association", "cost", "costs", "data", "defines", "documented", "engineering", "established", "estimate", "estimating", "february", "government", "individual", "methods", "office", "point", "potential", "process", "program", "project", "reliable", "scope", "single", "total", "value". Score: 0.5200. Entity: vertical-level.
0.5161
vertical-level
agenciesapplicationbusinesscapabilitycasesclassificationconsolidatedcontingentcontractdistributionfinancialinstitutionslabormanagementmanualmechanismorderoutsidepermanentprocessesprocureprogramsreportingrisksignificantsoftwarestaffingsystemsystemstemporarythird-partyvendor
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agencies", "application", "business", "capability", "cases", "classification", "consolidated", "contingent", "contract", "distribution", "financial", "institutions", "labor", "management", "manual", "mechanism", "order", "outside", "permanent", "processes", "procure", "programs", "reporting", "risk", "significant", "software", "staffing", "system", "systems", "temporary", "third-party", "vendor". Score: 0.5161. Entity: vertical-level.
0.5046
vertical-level
abilityadditionalanalysisanotherassistancebecomebestchangeconsultanciesconsultantsconsultingcontingentdescriptiondevelopmenteconomicefficientexpertiseexposurefirmsfunctionsgeneralgeographicguidehelpimplementationimprovementinternaljurisdictionslegalmanagementmarketsmodelobjectiveobjectivesoperateoperationalorganizationalorganizationsperformancepracticalpracticesproblemsprocessprovideregardingrelationshipsresultspecializedspecificstrategytechnologythereforevalueviewwork
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "additional", "analysis", "another", "assistance", "become", "best", "change", "consultancies", "consultants", "consulting", "contingent", "description", "development", "economic", "efficient", "expertise", "exposure", "firms", "functions", "general", "geographic", "guide", "help", "implementation", "improvement", "internal", "jurisdictions", "legal", "management", "markets", "model", "objective", "objectives", "operate", "operational", "organizational", "organizations", "performance", "practical", "practices", "problems", "process", "provide", "regarding", "relationships", "result", "specialized", "specific", "strategy", "technology", "therefore", "value", "view", "work". Score: 0.5046. Entity: vertical-level.
0.5000
vertical-level
activityadministrationadministrativeagenciesanotherbodieschangescivilcontrolcourtscreateddecisionsdivisioneconomiceducationenvironmentenvironmentalexecutiveexpandedgenerallygoverninggovernmenthumanincreaseinfluenceitselfjudiciallawlawslegalmodelorderspoliticalpossibleprocurementspublicreviewrulesspecializedstrongstructuresystemtraditionalunits
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "administration", "administrative", "agencies", "another", "bodies", "changes", "civil", "control", "courts", "created", "decisions", "division", "economic", "education", "environment", "environmental", "executive", "expanded", "generally", "governing", "government", "human", "increase", "influence", "itself", "judicial", "law", "laws", "legal", "model", "orders", "political", "possible", "procurements", "public", "review", "rules", "specialized", "strong", "structure", "system", "traditional", "units". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
accordingalternativecontingentcontractcontractorsemployeesemploymentformholdersindependentlaborlimitedmultiplenearlypaymentrelationshiprepresentsecuritystaffingsubstantialtemporarytypeworkworkersworkforce
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "alternative", "contingent", "contract", "contractors", "employees", "employment", "form", "holders", "independent", "labor", "limited", "multiple", "nearly", "payment", "relationship", "represent", "security", "staffing", "substantial", "temporary", "type", "work", "workers", "workforce". Score: 0.5000. Entity: vertical-level.
0.5000
vertical-level
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcombinedcompetitioncompetitiveconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentitiesentityequityfederalgovernedgovernmentlawlegalmanagementmarketnoticenotificationoperatingoperationsownershippotentialprocessesproposedrequirerequiresresembleresultreviewsinglestrategicstrategysubjectsubstantiallytermstransactiontransactionstransferunits
KEYWORD OVERLAP (high): 52 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "combined", "competition", "competitive", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entities", "entity", "equity", "federal", "governed", "government", "law", "legal", "management", "market", "notice", "notification", "operating", "operations", "ownership", "potential", "processes", "proposed", "require", "requires", "resemble", "result", "review", "single", "strategic", "strategy", "subject", "substantially", "terms", "transaction", "transactions", "transfer", "units". Score: 0.5000. Entity: vertical-level.
0.4828
vertical-level
communicationconsultantsdeliveryembeddedgovernmentinformationpoliticalprivateprocessesrelationshipsoftwaresupportingtechnologyworking
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "communication", "consultants", "delivery", "embedded", "government", "information", "political", "private", "processes", "relationship", "software", "supporting", "technology", "working". Score: 0.4828. Entity: vertical-level.
0.4828
vertical-level
becomesbusinessescasesdatadecisiondiscussingensureevenformgenerallygovernancehighinformationintendedinternalmakingoperationsorderplanningpurposequalityrepresentsrequiredsignificantsourcesstandardizationstandardsuses
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "becomes", "businesses", "cases", "data", "decision", "discussing", "ensure", "even", "form", "generally", "governance", "high", "information", "intended", "internal", "making", "operations", "order", "planning", "purpose", "quality", "represents", "required", "significant", "sources", "standardization", "standards", "uses". Score: 0.4828. Entity: vertical-level.
0.4821
vertical-level
accountingboardbusinesscentraldedicatedeffectivelyentitiesfinancialfiscalframeworkfundedgovernmentgovernmentallegalmanagementmandatoryorganizationsprocesspromotespublicpubliclyreportingresourcesspecializedstandardstransactionstransparency
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "board", "business", "central", "dedicated", "effectively", "entities", "financial", "fiscal", "framework", "funded", "government", "governmental", "legal", "management", "mandatory", "organizations", "process", "promotes", "public", "publicly", "reporting", "resources", "specialized", "standards", "transactions", "transparency". Score: 0.4821. Entity: vertical-level.
0.4815
vertical-level
accessaccountingbillionbusinesscapacitycategorycloud-basedcollectcommercialcoredatadepartmentsdevelopingdevelopmentdiffersefficiencyenterpriseenterpriseserpexistingfinancefunctionsgeneralimpactincreasinglyinformationintegratedlargemanagementmanagesmarketmaterialsmediatedneedsnetworkobjectivesoperationsordersorganizationaloutsidepayrollplanningplansprocessesprovidepurchasepurchasingrecordrepositoryrequiredresourceresourcessharedsmallersoftwarestaffstatussuitablesystemsystemstasktechnologytraditionaltransactionsview
KEYWORD OVERLAP (high): 65 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "accounting", "billion", "business", "capacity", "category", "cloud-based", "collect", "commercial", "core", "data", "departments", "developing", "development", "differs", "efficiency", "enterprise", "enterprises", "erp", "existing", "finance", "functions", "general", "impact", "increasingly", "information", "integrated", "large", "management", "manages", "market", "materials", "mediated", "needs", "network", "objectives", "operations", "orders", "organizational", "outside", "payroll", "planning", "plans", "processes", "provide", "purchase", "purchasing", "record", "repository", "required", "resource", "resources", "shared", "smaller", "software", "staff", "status", "suitable", "system", "systems", "task", "technology", "traditional", "transactions", "view". Score: 0.4815. Entity: vertical-level.
0.4773
vertical-level
academiccollegedifferenteducationeducationalformgenerallyhighinstitutioninstitutionsmaintainopenpolicyprogramsschoolsimilarstudentstransfertypeuniversityworkforce
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "college", "different", "education", "educational", "form", "generally", "high", "institution", "institutions", "maintain", "open", "policy", "programs", "school", "similar", "students", "transfer", "type", "university", "workforce". Score: 0.4773. Entity: vertical-level.
0.4769
vertical-level
admadministrationartificialautomatedbusinessconductedconsequencesdatadecisionseconomiceducationeducationalemploymenthealthhumanimagesintelligenceinvolvelanguagelawlegalmediaprocessprocessingpublicrequiringsoftwaresourcessystemstechnicaltext
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adm", "administration", "artificial", "automated", "business", "conducted", "consequences", "data", "decisions", "economic", "education", "educational", "employment", "health", "human", "images", "intelligence", "involve", "language", "law", "legal", "media", "process", "processing", "public", "requiring", "software", "sources", "systems", "technical", "text". Score: 0.4769. Entity: vertical-level.
0.4615
vertical-level
accountingappropriateauditauditorsauditsconductedcriteriadetermineevidencefinancialinformationmaterialprovidereasonablestandardsstatedtypeverified
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "appropriate", "audit", "auditors", "audits", "conducted", "criteria", "determine", "evidence", "financial", "information", "material", "provide", "reasonable", "standards", "stated", "type", "verified". Score: 0.4615. Entity: vertical-level.
0.4553
vertical-level
accountingacquireacquisitionbusinesscapitalchangescreatecurrentdirectlydistributiondutieseconomyeducationemergencyemploymententryestablishesexpenditurefeesfinalfirmsfiscalgoodsgovernmentgovernmentshealthcareimportantindividualinfrastructureintendedinterestinvestmentsissuesissuinglevelslicensinglimitedmajornationalneedsnominallypaymentspolicypopulationpotentialpowerpublicpurchasingresearchresourcesrolesecurityspendingspenttransfertypes
KEYWORD OVERLAP (high): 56 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "acquire", "acquisition", "business", "capital", "changes", "create", "current", "directly", "distribution", "duties", "economy", "education", "emergency", "employment", "entry", "establishes", "expenditure", "fees", "final", "firms", "fiscal", "goods", "government", "governments", "healthcare", "important", "individual", "infrastructure", "intended", "interest", "investments", "issues", "issuing", "levels", "licensing", "limited", "major", "national", "needs", "nominally", "payments", "policy", "population", "potential", "power", "public", "purchasing", "research", "resources", "role", "security", "spending", "spent", "transfer", "types". Score: 0.4553. Entity: vertical-level.
0.4545
vertical-level
activebusinesscapitalcategorychangescontroldescribeddevelopmenteitherenterpriseequityevaluationsfinancefinancialfirmsfundsgeneralinvestmentsinvestorlimitedmanagementoperationalotherwiseownershippressprivateproductsprovidepublicratherrolespecializedspecificstrategyworking
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "business", "capital", "category", "changes", "control", "described", "development", "either", "enterprise", "equity", "evaluations", "finance", "financial", "firms", "funds", "general", "investments", "investor", "limited", "management", "operational", "otherwise", "ownership", "press", "private", "products", "provide", "public", "rather", "role", "specialized", "specific", "strategy", "working". Score: 0.4545. Entity: vertical-level.
0.4468
vertical-level
accountschaindepartmentfinancialintegrationinvoicelargestlinkingmanagementorderpayableplanningprocessprocurementpurchasepurchasingsoftwaresourcingspecificsupplysystems
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounts", "chain", "department", "financial", "integration", "invoice", "largest", "linking", "management", "order", "payable", "planning", "process", "procurement", "purchase", "purchasing", "software", "sourcing", "specific", "supply", "systems". Score: 0.4468. Entity: vertical-level.
0.4412
vertical-level
assetsauthoritycapabilitydataensureformsgovernancehighmanagementorganizationalpoliticalprocessesqualityrolevalue
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "assets", "authority", "capability", "data", "ensure", "forms", "governance", "high", "management", "organizational", "political", "processes", "quality", "role", "value". Score: 0.4412. Entity: vertical-level.
0.4407
vertical-level
agenciesanalyzingapplyassessmentbeneficialbusinessescomprehensivedesigndestinationsevaluationfacilitiesgenerallygoodsgovernmentinfluenceinvestmentsmovemovementneedsplanningpoliciesprivateprocesspublicsystemtransportation
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agencies", "analyzing", "apply", "assessment", "beneficial", "businesses", "comprehensive", "design", "destinations", "evaluation", "facilities", "generally", "goods", "government", "influence", "investments", "move", "movement", "needs", "planning", "policies", "private", "process", "public", "system", "transportation". Score: 0.4407. Entity: vertical-level.
0.4400
vertical-level
completioncontractcontractorguaranteeinsuranceintendedissuedmarginperformanceprojectwork
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "completion", "contract", "contractor", "guarantee", "insurance", "intended", "issued", "margin", "performance", "project", "work". Score: 0.4400. Entity: vertical-level.
0.4396
vertical-level
additionalapplicationaroundavailabilitybuycategorycloudcostdeliverydevelopmentdistinguisheconomyefficiencyeitherenvironmentfeefeesforminfrastructurelicensemodeloperatingownershipphysicalplatformpossessionpossiblepracticesproductsproviderrapidrequiredresourcesrevenueseparatessoftwarespecificsystemstestingtraditional
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "additional", "application", "around", "availability", "buy", "category", "cloud", "cost", "delivery", "development", "distinguish", "economy", "efficiency", "either", "environment", "fee", "fees", "form", "infrastructure", "license", "model", "operating", "ownership", "physical", "platform", "possession", "possible", "practices", "products", "provider", "rapid", "required", "resources", "revenue", "separates", "software", "specific", "systems", "testing", "traditional". Score: 0.4396. Entity: vertical-level.
0.4370
vertical-level
actuallyalternativeapproximatelyarchitectsbidchangescomparingcompleteconstructioncontactcontractcontractedcontractingcontractorcontractscostsdeliverydesigndesign-buildentityformshistoricalimportantindependentlyjointlegallongmastermethodownerpointprocedureprocurementprojectprojectsreduceremainsremediesreportedresponsibilityresponsibleroleruralschedulesidesinglespecializedspecificsubcontractorssystemtraditionalwork
KEYWORD OVERLAP (high): 52 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actually", "alternative", "approximately", "architects", "bid", "changes", "comparing", "complete", "construction", "contact", "contract", "contracted", "contracting", "contractor", "contracts", "costs", "delivery", "design", "design-build", "entity", "forms", "historical", "important", "independently", "joint", "legal", "long", "master", "method", "owner", "point", "procedure", "procurement", "project", "projects", "reduce", "remains", "remedies", "reported", "responsibility", "responsible", "role", "rural", "schedule", "side", "single", "specialized", "specific", "subcontractors", "system", "traditional", "work". Score: 0.4370. Entity: vertical-level.
0.4362
vertical-level
accountingactauditingbusinesscompliancecontrolcontrolsefficiencyensureentitiesfinancialimportantimprovementsinternalkeylawsmanagementmeansobjectiveobjectivesoperationalorganizationalpaymentsphysicalpoliciespracticesproceduresprocesspropertyprotectingpublicreducereliablereportingrequiredresourcesriskrolespecificstrategictransaction
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "act", "auditing", "business", "compliance", "control", "controls", "efficiency", "ensure", "entities", "financial", "important", "improvements", "internal", "key", "laws", "management", "means", "objective", "objectives", "operational", "organizational", "payments", "physical", "policies", "practices", "procedures", "process", "property", "protecting", "public", "reduce", "reliable", "reporting", "required", "resources", "risk", "role", "specific", "strategic", "transaction". Score: 0.4362. Entity: vertical-level.
0.4328
vertical-level
accessalternativeanotherassociatedbarriercategorieschangingcostcostsdifferenteconomicexperiencefinancialformedidentitylookmanagementmeasurableproceduralproductsproviderrelationalresourcesresultstrategicsuppliersswitchingtermsvalue
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "alternative", "another", "associated", "barrier", "categories", "changing", "cost", "costs", "different", "economic", "experience", "financial", "formed", "identity", "look", "management", "measurable", "procedural", "products", "provider", "relational", "resources", "result", "strategic", "suppliers", "switching", "terms", "value". Score: 0.4328. Entity: vertical-level.
0.4314
vertical-level
abilityadministrativeauthoritycourtsdecisiondescribedexecutivegovernmentgovernmentaljudicialjurisdictionslawspowerprocedureprocessreviewscopeseparationstatutestrongsubjectterms
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "administrative", "authority", "courts", "decision", "described", "executive", "government", "governmental", "judicial", "jurisdictions", "laws", "power", "procedure", "process", "review", "scope", "separation", "statute", "strong", "subject", "terms". Score: 0.4314. Entity: vertical-level.
0.4286
vertical-level
datadifferencesdifferententitiesentityfilesfindingkeylinkagenationalpreferencerecordrecordsresolutionshapesourcestaskterms
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "data", "differences", "different", "entities", "entity", "files", "finding", "key", "linkage", "national", "preference", "record", "records", "resolution", "shape", "sources", "task", "terms". Score: 0.4286. Entity: vertical-level.
0.4250
vertical-level
anotherbecomechaincompetitioncomplexconsolidationcorporationdescribeddifferentdirectlyeconomyfinalfordfreeintegratedintegrationlargemakingmanagementmarketmarketplacemethodneedopenownershippoliticalproduceproductsrathersellsupplierssuppliessupplyvertical
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "another", "become", "chain", "competition", "complex", "consolidation", "corporation", "described", "different", "directly", "economy", "final", "ford", "free", "integrated", "integration", "large", "making", "management", "market", "marketplace", "method", "need", "open", "ownership", "political", "produce", "products", "rather", "sell", "suppliers", "supplies", "supply", "vertical". Score: 0.4250. Entity: vertical-level.
0.4167
vertical-level
accordingboisecanyoncollegehomeidahomeaningmeridianmilesnampapopulationprincipaluniversitywestwestern
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "miles", "nampa", "population", "principal", "university", "west", "western". Score: 0.4167. Entity: vertical-level.
0.4129
vertical-level
abilityaccessamericanamongbestbusinessescapacitychangescitiescompetedevelopersdevelopmentearliereconomiceducationemployeesequalequityevaluatedformformalformsgovernmenthistoricallyhistoryhomehuman-resourcesincreaseissuesleastlevelsneedneedsnetworkoccurredopportunitiespracticespractitionersproblemsprogramspublicratherreadingregionreplacedresidentsrespondresponsibilityschoolsstrategystrongstudentssystemsystemsthemtiestraditionaltrainingtransportationviewwagewhoseworkersworkforce
KEYWORD OVERLAP (high): 64 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "access", "american", "among", "best", "businesses", "capacity", "changes", "cities", "compete", "developers", "development", "earlier", "economic", "education", "employees", "equal", "equity", "evaluated", "form", "formal", "forms", "government", "historically", "history", "home", "human-resources", "increase", "issues", "least", "levels", "need", "needs", "network", "occurred", "opportunities", "practices", "practitioners", "problems", "programs", "public", "rather", "reading", "region", "replaced", "residents", "respond", "responsibility", "schools", "strategy", "strong", "students", "system", "systems", "them", "ties", "traditional", "training", "transportation", "view", "wage", "whose", "workers", "workforce". Score: 0.4129. Entity: vertical-level.
0.4091
vertical-level
adaboisecanyoncountiesidahooregonregiontreasurevalley
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "canyon", "counties", "idaho", "oregon", "region", "treasure", "valley". Score: 0.4091. Entity: vertical-level.
0.4074
vertical-level
accessadministrationclouddemandformnetworkphysicalpoolresourcessharedstandardization
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "administration", "cloud", "demand", "form", "network", "physical", "pool", "resources", "shared", "standardization". Score: 0.4074. Entity: vertical-level.
0.4074
vertical-level
actuallyamountcasesclaimscompensationcontractcontractualcostcostscoveragecoveredcoverscreateddedicateddefaultdefendingdefensedutyespeciallyevenexpresslyformedgeneralgroupimposedindividualinsurancelegalliabilitylimitsotherwisepaymentpoliciespolicyprotectsratherriskrulesimilarspecificsystemthird-partyunlessvaluable
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actually", "amount", "cases", "claims", "compensation", "contract", "contractual", "cost", "costs", "coverage", "covered", "covers", "created", "dedicated", "default", "defending", "defense", "duty", "especially", "even", "expressly", "formed", "general", "group", "imposed", "individual", "insurance", "legal", "liability", "limits", "otherwise", "payment", "policies", "policy", "protects", "rather", "risk", "rule", "similar", "specific", "system", "third-party", "unless", "valuable". Score: 0.4074. Entity: vertical-level.
0.4037
vertical-level
accuratelyactiveagenciesallowsalternativeassociatedbusinessescapacitycasescompetitioncompetitiveconsequencesdeterminedistributiondominateeconomicemployedemploymententryexistingfirmshighimportantindustrialissueslandlawmarketmetricsnumbersorderpowerpricesproposedraterelevantsettingsmallstructurethereforetotaltypeuserswork
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accurately", "active", "agencies", "allows", "alternative", "associated", "businesses", "capacity", "cases", "competition", "competitive", "consequences", "determine", "distribution", "dominate", "economic", "employed", "employment", "entry", "existing", "firms", "high", "important", "industrial", "issues", "land", "law", "market", "metrics", "numbers", "order", "power", "prices", "proposed", "rate", "relevant", "setting", "small", "structure", "therefore", "total", "type", "users", "work". Score: 0.4037. Entity: vertical-level.
0.4020
vertical-level
accountantsaccountingactiveamericananotherauditingawardedcertifiedcollegecontinuingdemandeducationevenexaminationexperiencefinancialfirmsgenerallygrowthlaborlawslegallylicenselicensinglicensuremaintainmobilityotherwisepractitionersprofessionalprovidepublicqualifiedregardingrequiredrequirementsstatustexastitleunitsunless
KEYWORD OVERLAP (high): 41 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountants", "accounting", "active", "american", "another", "auditing", "awarded", "certified", "college", "continuing", "demand", "education", "even", "examination", "experience", "financial", "firms", "generally", "growth", "labor", "laws", "legally", "license", "licensing", "licensure", "maintain", "mobility", "otherwise", "practitioners", "professional", "provide", "public", "qualified", "regarding", "required", "requirements", "status", "texas", "title", "units", "unless". Score: 0.4020. Entity: vertical-level.
0.3974
vertical-level
agricultureamountaroundcapitalcommercialcostcostsdifferentdrinkingfixedinstitutionalissueslargelargerpersonnelpolicyproperlypublicqualityresponsibilityruralseparatesmallstandardizationsupplysurroundingsystemsystemsurbanutilitieswater
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agriculture", "amount", "around", "capital", "commercial", "cost", "costs", "different", "drinking", "fixed", "institutional", "issues", "large", "larger", "personnel", "policy", "properly", "public", "quality", "responsibility", "rural", "separate", "small", "standardization", "supply", "surrounding", "system", "systems", "urban", "utilities", "water". Score: 0.3974. Entity: vertical-level.
0.3956
vertical-level
actadministeredadministrationagenciesamericanappearcurrentdebtdepartmentdepartmentsdollardutiesestablishedexecutivefederalfinancefinancialfiscalgovernmentinstitutionsinternallicenseslimitedmajormanagesmattersnationalofficepolicypresenceresponsiblerevenuesolelystatutorysystemtreasury
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "administered", "administration", "agencies", "american", "appear", "current", "debt", "department", "departments", "dollar", "duties", "established", "executive", "federal", "finance", "financial", "fiscal", "government", "institutions", "internal", "licenses", "limited", "major", "manages", "matters", "national", "office", "policy", "presence", "responsible", "revenue", "solely", "statutory", "system", "treasury". Score: 0.3956. Entity: vertical-level.
0.3947
vertical-level
accessbestcannotcharacterizedcommunicationcompetecompetingcontrolcostsdifferentdiscussedentityespeciallyfederalformsgoodsgovernmentinfrastructureinstitutionlargelocalmaintainsmarketminimalmultipleoperatesorderpointproduceproductspublicrangingrepresentrepresentsspecificstatewidesubjectsupplysystemstransportationtypesutilitiesutilitywastewater
KEYWORD OVERLAP (high): 45 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "best", "cannot", "characterized", "communication", "compete", "competing", "control", "costs", "different", "discussed", "entity", "especially", "federal", "forms", "goods", "government", "infrastructure", "institution", "large", "local", "maintains", "market", "minimal", "multiple", "operates", "order", "point", "produce", "products", "public", "ranging", "represent", "represents", "specific", "statewide", "subject", "supply", "systems", "transportation", "types", "utilities", "utility", "waste", "water". Score: 0.3947. Entity: vertical-level.
0.3933
vertical-level
accesscapablecreateddatadataseteducationeducationalespeciallyestablishedexplicitfairformformsgenerallygovgovernmentgrowthimportantinitiativesinstitutionsitselfknowledgelicenselicensedlongmovementopenpropertypurposeresourcesrightssimilarsoftwaresourcespecifications
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "capable", "created", "data", "dataset", "education", "educational", "especially", "established", "explicit", "fair", "form", "forms", "generally", "gov", "government", "growth", "important", "initiatives", "institutions", "itself", "knowledge", "license", "licensed", "long", "movement", "open", "property", "purpose", "resources", "rights", "similar", "software", "source", "specifications". Score: 0.3933. Entity: vertical-level.
0.3913
vertical-level
agencycertificationeducationalinterestprofessionalpublicqualificationsimplytask
KEYWORD OVERLAP (high): 9 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "certification", "educational", "interest", "professional", "public", "qualification", "simply", "task". Score: 0.3913. Entity: vertical-level.
0.3908
vertical-level
academicallocationamericanamongassessesauthoritiescarrycentraldecisiondirectdistributioneconomiceconomyefficientexpenditurefailurefieldfinanceframeworkgovernmentgovernmentalgovernmentsmarketonespolicypoliticalpublicresearchresourcesrevenuerolesettingsspecificsubject
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "allocation", "american", "among", "assesses", "authorities", "carry", "central", "decision", "direct", "distribution", "economic", "economy", "efficient", "expenditure", "failure", "field", "finance", "framework", "government", "governmental", "governments", "market", "ones", "policy", "political", "public", "research", "resources", "revenue", "role", "settings", "specific", "subject". Score: 0.3908. Entity: vertical-level.
0.3770
vertical-level
accountingagencyanotherassignmentscharacterizedconsultantscontractcontractscontractualdevelopmentdifferenteconomyemployeeemployeesemploymentengineeringfindinghealthhumanincreasinglyindividualinsurancelaborlimitedmarketneedneedsorganizationspermanentprofessionalsprovidereceiverequiringresearchresourcesrightsstaffstaffingtemporarytermstrainingtypeworkworkerworkersworking
KEYWORD OVERLAP (high): 46 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "agency", "another", "assignments", "characterized", "consultants", "contract", "contracts", "contractual", "development", "different", "economy", "employee", "employees", "employment", "engineering", "finding", "health", "human", "increasingly", "individual", "insurance", "labor", "limited", "market", "need", "needs", "organizations", "permanent", "professionals", "provide", "receive", "requiring", "research", "resources", "rights", "staff", "staffing", "temporary", "terms", "training", "type", "work", "worker", "workers", "working". Score: 0.3770. Entity: vertical-level.
0.3623
vertical-level
casescertificationcompetencecompleteextendfieldformalfoundgainlaborlicensemastermeasurableoutsidepermanentpotentialpractitionersprofessionprofessionalreachregulatedsystemterminologytrainingworking
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cases", "certification", "competence", "complete", "extend", "field", "formal", "found", "gain", "labor", "license", "master", "measurable", "outside", "permanent", "potential", "practitioners", "profession", "professional", "reach", "regulated", "system", "terminology", "training", "working". Score: 0.3623. Entity: vertical-level.
0.3556
vertical-level
adaannualboisecapitalcountiesestimatedhomeidaholocallymajormilesoregonpopulationtechnologytreasurevalley
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "annual", "boise", "capital", "counties", "estimated", "home", "idaho", "locally", "major", "miles", "oregon", "population", "technology", "treasure", "valley". Score: 0.3556. Entity: vertical-level.
0.3448
vertical-level
algorithmicallocationanalysisattributesconsequencesdatadecisiondecisionsdesigneliminatefairgenerallyindividualitselflegalmeansprocessesrelevantresponsibilityresulting
KEYWORD OVERLAP (high): 20 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "algorithmic", "allocation", "analysis", "attributes", "consequences", "data", "decision", "decisions", "design", "eliminate", "fair", "generally", "individual", "itself", "legal", "means", "processes", "relevant", "responsibility", "resulting". Score: 0.3448. Entity: vertical-level.
0.3371
vertical-level
actactivityassociatedauthoritybackcodescollectivelyconsequencescourtsformsgoverninggovernmenthumanindependentlyinstitutionslawlegallessofficeroperateorganizationspowerpropertyprotectingpublicrecordrulessystemthroughoutumbrella
KEYWORD OVERLAP (high): 30 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "activity", "associated", "authority", "back", "codes", "collectively", "consequences", "courts", "forms", "governing", "government", "human", "independently", "institutions", "law", "legal", "less", "officer", "operate", "organizations", "power", "property", "protecting", "public", "record", "rules", "system", "throughout", "umbrella". Score: 0.3371. Entity: vertical-level.
0.3288
vertical-level
agencyanothercompensationcontractcontractscontractualdifferentdutyexpresslyformguaranteeholdinsuranceitselflawlimitedmaximummedicalownerprincipalpurchaserelationshiprelevantresponsibilities
KEYWORD OVERLAP (high): 24 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agency", "another", "compensation", "contract", "contracts", "contractual", "different", "duty", "expressly", "form", "guarantee", "hold", "insurance", "itself", "law", "limited", "maximum", "medical", "owner", "principal", "purchase", "relationship", "relevant", "responsibilities". Score: 0.3288. Entity: vertical-level.
0.3284
vertical-level
abilitydifferentemergenciesemergencyfederalgenerallygovernmentsissuinglocalmanagementneedsorganizationsoutcomepossibleprofessionalrecoveryreducerequiresrescueresponseriskterms
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ability", "different", "emergencies", "emergency", "federal", "generally", "governments", "issuing", "local", "management", "needs", "organizations", "outcome", "possible", "professional", "recovery", "reduce", "requires", "rescue", "response", "risk", "terms". Score: 0.3284. Entity: vertical-level.
0.3208
vertical-level
approximatelyboisedatadistrictdistrictseitherevenfoundgovernmentidaholimitslowerpopulationrepresentingresidentssinglesplit
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "data", "district", "districts", "either", "even", "found", "government", "idaho", "limits", "lower", "population", "representing", "residents", "single", "split". Score: 0.3208. Entity: vertical-level.
0.3182
vertical-level
becomescybersecuritydatadependencedigitaldisruptionelectronicembeddedexpandedfieldfinancefunctionsinformationinfrastructureinvolvenetworknetworksphysicalpowerprocessesprotectingprovidesecuritysoftwarestandardssystemstechnologytherefore
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "becomes", "cybersecurity", "data", "dependence", "digital", "disruption", "electronic", "embedded", "expanded", "field", "finance", "functions", "information", "infrastructure", "involve", "network", "networks", "physical", "power", "processes", "protecting", "provide", "security", "software", "standards", "systems", "technology", "therefore". Score: 0.3182. Entity: vertical-level.
0.3167
vertical-level
advantagebuildingscarrycombinedcommercialdirectlyindustrialinfrastructurepipeseparateservingsewersmallersystemsystemstreatmenttypeurbanwastewater
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "advantage", "buildings", "carry", "combined", "commercial", "directly", "industrial", "infrastructure", "pipe", "separate", "serving", "sewer", "smaller", "system", "systems", "treatment", "type", "urban", "wastewater". Score: 0.3167. Entity: vertical-level.
0.3137
vertical-level
actadditionaladministrationapplyappropriationsbillionbudgetbusinessbusinesseschangingclasscompensationconsolidateddevelopmentdirecteconomicfundinggenerallygovernmentshealthhistoryimpactindividualinitiallargerlargestlaterlawleavelocalmajornearlynegotiationsofficeoriginalpaymentsprogramprogramsprotectionsresearchresponseresultscopesecuritysinglesmallspendingtotal
KEYWORD OVERLAP (high): 48 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "additional", "administration", "apply", "appropriations", "billion", "budget", "business", "businesses", "changing", "class", "compensation", "consolidated", "development", "direct", "economic", "funding", "generally", "governments", "health", "history", "impact", "individual", "initial", "larger", "largest", "later", "law", "leave", "local", "major", "nearly", "negotiations", "office", "original", "payments", "program", "programs", "protections", "research", "response", "result", "scope", "security", "single", "small", "spending", "total". Score: 0.3137. Entity: vertical-level.
0.3056
vertical-level
accordingaccountagencyamericanbusinessbusinessescentralcertificationcertifiedcontrolleddailydevelopmententerprisefederalfirmsleastmillionnearlyoperatedrevenuesreviewwest
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "account", "agency", "american", "business", "businesses", "central", "certification", "certified", "controlled", "daily", "development", "enterprise", "federal", "firms", "least", "million", "nearly", "operated", "revenues", "review", "west". Score: 0.3056. Entity: vertical-level.
0.3030
vertical-level
amountcontractdebtfailurefinanceprincipalprotectsresponsibilityresultingterms
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "amount", "contract", "debt", "failure", "finance", "principal", "protects", "responsibility", "resulting", "terms". Score: 0.3030. Entity: vertical-level.
0.2857
vertical-level
accessaccountableassociatedconstructiondevelopmentdocumentsgoalgoverninggovernmentincreasinglyinformationinstitutionsmaintainsopenpublicpublicly
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "accountable", "associated", "construction", "development", "documents", "goal", "governing", "government", "increasingly", "information", "institutions", "maintains", "open", "public", "publicly". Score: 0.2857. Entity: vertical-level.
0.2857
vertical-level
associatedautomaticallybecomedatadescribeddesignhumaninformationmakesmethodopenpagesprojectpublicationratherthem
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "associated", "automatically", "become", "data", "described", "design", "human", "information", "makes", "method", "open", "pages", "project", "publication", "rather", "them". Score: 0.2857. Entity: vertical-level.
0.2791
vertical-level
catalogcodefoodmunicipalpublicroleseparatelysolidsourcestraditionaltypewaste
KEYWORD OVERLAP (high): 12 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "catalog", "code", "food", "municipal", "public", "role", "separately", "solid", "sources", "traditional", "type", "waste". Score: 0.2791. Entity: vertical-level.
0.2771
vertical-level
collegeeconomiceducationeducationalformalformsgeneralindividualinstitutionknowledgelevelsmethodsnamespreparesprovideschoolschoolsspecializedspecifictechnicaltechnologytrainingtype
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "college", "economic", "education", "educational", "formal", "forms", "general", "individual", "institution", "knowledge", "levels", "methods", "names", "prepares", "provide", "school", "schools", "specialized", "specific", "technical", "technology", "training", "type". Score: 0.2771. Entity: vertical-level.
0.2742
vertical-level
appropriationapprovalconstitutionalcontrolledeitherexpenditurefundsgeneralgenerallygovernmentlawprimeproposedspecificspendingsupplysystem
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "appropriation", "approval", "constitutional", "controlled", "either", "expenditure", "funds", "general", "generally", "government", "law", "prime", "proposed", "specific", "spending", "supply", "system". Score: 0.2742. Entity: vertical-level.
0.2716
vertical-level
capacitychangecompetingcontrolinformationlanelawslocalnationalneedorderreduceroadsignalsignalssquaresystemsystemstechnologytrafficusersvertically
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "capacity", "change", "competing", "control", "information", "lane", "laws", "local", "national", "need", "order", "reduce", "road", "signal", "signals", "square", "system", "systems", "technology", "traffic", "users", "vertically". Score: 0.2716. Entity: vertical-level.
0.2627
vertical-level
actualaddressescleaningcodecompletedatadatasetdifferentdiffersentitiesentryexistingidentifyingincompleteinformationinvolvemeansnormalizationnumbersperformedprocessprocessingqualityratherrecordsroadsimilarsolutionssystemtoolsuser
KEYWORD OVERLAP (high): 31 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actual", "addresses", "cleaning", "code", "complete", "data", "dataset", "different", "differs", "entities", "entry", "existing", "identifying", "incomplete", "information", "involve", "means", "normalization", "numbers", "performed", "process", "processing", "quality", "rather", "records", "road", "similar", "solutions", "system", "tools", "user". Score: 0.2627. Entity: vertical-level.
0.2113
Prison ↗ Q40357 KW HIGH
vertical-level
administrationauthoritycenterdetentionfacilityfairformsfunctionsgoverningholdinglargelawpoliticalprocesssystem
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "administration", "authority", "center", "detention", "facility", "fair", "forms", "functions", "governing", "holding", "large", "law", "political", "process", "system". Score: 0.2113. Entity: vertical-level.
Provenance
Procurement Public Spending refinery-treasurevalley-v1.0.0 69,835 chars · 0 entities · 0 sections 135 articles · 135 edges 909f5cd95fe7b21a