—°F Boise, ID
LIVE GRAPH NODE This Treasure Valley Coworking Commercial Space page is a growing node in the Boise Standard knowledge graph. Every edge is auditable. Every claim is sourced. Fair discoverability for the Treasure Valley as AI advances. refinery-treasurevalley-v1.0.0 · 152 edges
Information Vertical · Treasure Valley

Coworking Commercial Space

0 Research Entities
152 Wikipedia Articles
152 Semantic Edges
0 Sections

Coworking and commercial space in the Treasure Valley operates as an interconnected market of flexible-workspace providers, conventional office landlords, commercial brokers, developers, economic-development organizations, planning agencies, construction professionals, lenders, title and escrow firms, property managers, technology infrastructure providers, and public institutions. The functional regional core consists of Ada and Canyon counties and the cities of Boise, Meridian, Nampa, Caldwell, Eagle, Garden City, Kuna and Star, while broader federal labor-market definitions place Ada, Boise, Canyon, Gem and Owyhee counties within the Boise metropolitan statistical area. The Idaho Department of Labor’s regional analysis identifies Ada and Canyon as the dominant population and employment counties of southwestern Idaho and states that the Boise metropolitan statistical area contains approximately 91 percent of the region’s labor force, making the metro’s employment geography the principal demand engine for offices, coworking memberships, medical-office buildings, professional suites, industrial-flex properties and mixed-use commercial projects https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf. Boise’s estimated population reached 238,429 on July 1, 2025, compared with 235,684 counted in the 2020 census, and the city’s 2020–2024 economy included substantial employer, nonemployer, professional, institutional and broadband-connected populations capable of generating demand for flexible work arrangements https://www.census.gov/quickfacts/fact/table/boisecitycityidaho/PST045225.

Coworking is legally and economically distinct from a conventional long-term office lease because operators typically package access to furnished desks, private offices, meeting rooms, internet service, reception functions, common areas, utilities, mail handling and community programming into memberships, licenses or service agreements of shorter duration. The local market nevertheless overlaps conventional commercial real estate whenever an operator leases, owns, subleases, manages or markets real property, and Idaho defines “commercial real estate” broadly as a business opportunity or real estate other than property improved by one to four residential dwelling units under Idaho Code section 54-2004 https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch20/sect54-2004/. Idaho’s Real Estate License Law is administered by the Idaho Real Estate Commission within the Division of Occupational and Professional Licenses, whose official statutes-and-rules portal identifies Idaho Code Title 54, Chapter 20 and IDAPA 24.37.01 as the central law and administrative rule governing licensed brokerage activity https://dopl.idaho.gov/rec/rec-statutes-rules-and-guidance/.

Kiln operates major flexible-workspace communities in both Boise and Meridian. Kiln Boise describes a 29,300-square-foot environment containing coworking areas, studios, private offices, meeting rooms, an audio-recording studio, a relaxation room and networking and wellness programming https://kiln.com/communities/boise/. Kiln Meridian markets furnished space for teams ranging from one to 100 people and identifies fourteen audiovisual-equipped conference rooms, a podcast studio, a seventy-five-person atrium, a refresh room and two fitness areas https://kiln.com/communities/meridian/. Contemporary reporting on the Meridian location stated that the project was planned to accommodate as many as 600 members and positioned the facility as infrastructure for entrepreneurs, distributed employees and growing companies rather than merely a desk-rental business https://boisedev.com/news/2022/02/25/kiln-meridian-idaho/. The Boise and Meridian facilities demonstrate the maturation of the Treasure Valley coworking model from inexpensive shared desks into hospitality-oriented workplaces capable of serving individual professionals, startups, established businesses, satellite teams and enterprise users.

Office Evolution operates a flexible-office center at 999 West Main Street, Suite 100, in downtown Boise and offers private offices, coworking, team offices, meeting rooms, conference rooms, training rooms, day offices, virtual mailing plans, business addresses and mail handling https://www.officeevolution.com/locations/usa/idaho/boise/. Its dedicated coworking page presents shared workspace and high-speed internet as part of the downtown location’s service package https://www.officeevolution.com/locations/usa/idaho/boise/coworking/. The operator’s published Boise archive records local operation before and during the post-2020 restructuring of office work, including an August 2020 discussion of new work patterns and flexible-office demand https://www.officeevolution.com/locations/usa/idaho/boise/blog/. Office Evolution’s mix of physical offices and virtual-business services connects the coworking sector to business registration, remote-company administration, professional mailing addresses, client meetings and small-business formation.

Trailhead is a Boise entrepreneurial and coworking institution associated with the downtown innovation ecosystem. Its workspace at 500 South 8th Street has been described as providing open-desk coworking and meeting rooms for freelancers, remote workers and small teams https://www.coworkingcafe.com/coworking-property/us/id/boise/500-south-8th-street/. Trailhead’s own reporting on the growth of the regional coworking market documented hot desks, dedicated desks and private offices within its service structure and identified Funnel 33 in Eagle as another local workspace operator during the earlier expansion of flexible offices https://trailheadboise.org/kiln-ready-to-open-red-hot-coworking-space-in-meridian/. Trailhead’s larger significance is institutional: it links workspace consumption to founder education, networking, mentorship, startup development and the circulation of entrepreneurial knowledge, turning commercial space into an economic-development platform rather than treating it solely as rentable floor area.

International Workplace Group brands participate in the Treasure Valley through Regus, HQ and related flexible-office formats. Regus advertises Boise coworking with hot-desk access, dedicated desks, hourly or daily booking and monthly access plans https://www.regus.com/en/us/idaho/boise/coworking. Its Meridian offering similarly advertises drop-in workspace, dedicated desks and flexible access across local centers https://www.regus.com/en/us/idaho/meridian/coworking, and a specific Meridian center is identified at 943 West Overland Road, first floor https://www.coworkingcafe.com/coworking-property/us/id/meridian/id-meridian-w-overland-road/. Regus also markets Nampa coworking on flexible hourly, daily and longer-term arrangements https://www.regus.com/en/us/idaho/nampa/coworking. HQ markets Nampa office space, coworking, meeting rooms and virtual-office products supported by business-grade internet, reception, shared kitchens and cleaning services https://www.hq.com/en/united-states/idaho/nampa. These brands insert the Treasure Valley into a national and international network-access model in which a membership may provide usable workplaces beyond a single building or municipality.

The conventional commercial-space market is substantially larger than the dedicated coworking market and includes downtown office towers, suburban professional buildings, medical offices, neighborhood commercial centers, mixed-use developments, industrial-flex properties, warehouses, retail suites and owner-occupied business premises. Meridian’s inventory illustrates the suburban office component, with marketed properties in El Dorado Business Campus, Gramercy Plaza, Monterey Place, Orchard Park, Talus Professional Plaza and other corridors near Eagle Road, Franklin Road, Overland Road and Chinden Boulevard https://www.commercialcafe.com/office/us/id/meridian/. On-demand marketplaces extend this inventory by aggregating private offices, coworking desks and boardrooms that can be booked by the hour or day in Meridian https://liquidspace.com/us/id/meridian and Nampa https://liquidspace.com/us/id/nampa. These aggregation platforms should be treated as market intermediaries rather than authoritative proof that every indexed location is continuously available, because listings, pricing, branding and inventory can change independently of municipal land-use approval or an operator’s long-term viability.

The geography of commercial demand follows the Treasure Valley’s employment and population expansion. The Idaho Department of Labor reported that the Boise metropolitan area added 72,500 nonfarm jobs between March 2010 and March 2018, a growth rate of approximately 29 percent, substantially exceeding the collective growth rate of Idaho’s other metropolitan and nonmetropolitan areas during that period https://www.labor.idaho.gov/dnn/Portals/0/Publications/Labor%20Market%20Report%202017%20-%20FINAL.pdf. The department’s 2019 regional report identified continuing commercial projects including Eagle View Landing, Ten Mile Crossing and Pioneer Crossing and connected construction demand to rapid population growth, housing approvals, health-system expansion and business formation https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf. Its 2022 report stated that the Boise metropolitan statistical area led Idaho in both total job growth and growth rate and accounted for slightly more than half of statewide job gains that year https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2022.pdf. The 2023 state report identified real estate and rental and leasing as approximately 14 percent of Idaho private-sector gross domestic product and professional and business services as approximately 11 percent, demonstrating the economic scale of the sectors that create, finance, broker and occupy commercial space https://www.labor.idaho.gov/wp-content/uploads/publications/2023-LMI-Report.pdf.

Boise’s commercial geography developed from a historic downtown government, banking, retail, railroad and professional-services center into a polycentric metropolitan market. State government, Boise State University, major healthcare systems, technology firms and corporate headquarters support downtown and central-city offices, while suburban population growth shifted substantial demand toward Meridian, Eagle, west Boise, Nampa and the Interstate 84 corridor. The City of Boise identifies the Boise Valley Economic Partnership as the regional organization responsible for attracting companies and talent, connecting business recruitment directly to sites, buildings, workforce capacity and regional infrastructure https://www.cityofboise.org/programs/economic-development/resources-and-incentives/. The Boise Metro Chamber supports regional business growth, networking and economic development across the Treasure Valley https://www.boisechamber.org/. Nampa’s economic-development program expressly treats business recruitment, retention and expansion as components of local economic prosperity and provides relocation and expansion assistance https://www.cityofnampa.us/713/Expand-Relocate. These civic organizations influence commercial-space absorption by connecting prospective occupants with permitting information, labor data, incentives, local officials and real-estate professionals.

Commercial-space development and coworking occupancy remain subordinate to municipal land-use law. Boise’s development code uses a table of allowed uses to determine which activities may operate in each base zoning district and directs users to separately defined land-use categories rather than recognizing “coworking” as a universally independent zoning class https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-66566. The code’s definitions establish the terminology used to classify principal and accessory activities https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-70319, while commercial-use provisions impose district-specific limitations and operational conditions https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-66847. A coworking project may therefore be reviewed as office, professional service, general service, commercial entertainment, event space, live-work, retail, educational, studio or another defined use depending on its actual operations. An operator adding public events, food service, recording studios, fitness facilities, childcare, fabrication, retail sales or late-night assembly cannot safely assume that an approval for ordinary office occupancy authorizes every ancillary activity.

Boise Planning and Development Services administers land-use review and building permitting within the city, and its homeowner guidance illustrates the broader distinction between planning approval and building permits by explaining that some physical work may avoid a building permit while still requiring planning and zoning approval https://www.cityofboise.org/departments/planning-and-development-services/building/homeowners-guide/. Commercial projects face additional review for occupancy classification, occupant load, exits, accessibility, structural alterations, mechanical systems, plumbing, electrical work, fire protection, signs, parking and changes of use. A suite previously approved for low-occupancy professional offices may require additional analysis before conversion into dense open coworking, classrooms, public events, podcast studios or assembly rooms. Tenant-improvement budgets must therefore include design, permitting and code-compliance costs rather than assuming that existing walls, doors, restrooms and mechanical systems remain lawful for a new operating model.

Ada County, Canyon County and the incorporated cities independently exercise planning and zoning authority over properties within their jurisdictions, while the Ada County Highway District controls streets and related transportation infrastructure throughout Ada County. Boise’s own development-code definitions recognize ACHD as the Ada County Highway District https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-70319. This institutional arrangement creates a cross-domain edge between commercial development and transportation engineering: a city may evaluate land use and building form while ACHD evaluates access, traffic impacts, curb cuts, sidewalks and roadway conditions. Commercial feasibility can consequently depend on more than zoning because a site’s access geometry, parking circulation, bicycle connections and required transportation improvements can affect project cost and leasable area.

At the state level, real-estate brokerage requires compliance with Idaho Code Title 54, Chapter 20 and IDAPA 24.37.01 https://dopl.idaho.gov/rec/rec-statutes-rules-and-guidance/. Idaho Code section 54-2085 requires a licensee to deliver the commission-approved agency-disclosure brochure to a prospective buyer or seller at the first substantial business contact and establishes written disclosure and representation requirements https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch20/sect54-2085/. The legal distinction between representing another party in a regulated transaction and negotiating one’s own property or operating a service business must be evaluated from the actual conduct involved, not merely from the use of terms such as “community manager,” “workspace consultant” or “membership adviser.” Coworking companies that market their own memberships occupy a different legal position from third-party brokers who procure tenants, negotiate leases or receive compensation for arranging real-estate transactions.

Idaho’s licensing pipeline requires prospective salespersons to complete ninety hours of approved prelicense education divided into two forty-five-hour modules covering fundamental real-estate concepts and applied skills involved in listing, selling, buying and closing property https://dopl.idaho.gov/rec/rec-education-applicants/. Commercial practitioners commonly add nonstatutory expertise in leasing, investment analysis, capitalization rates, tenant improvement allowances, operating-expense reconciliations, common-area maintenance, environmental due diligence, land-use entitlement, construction budgeting and property management. The Boise Regional REALTORS organization provides professional resources and identifies Idaho real-estate licensing laws, education, insurance, fees, renewals and examinations within its practitioner framework https://www.boirealtors.com/realtor-rules-and-regulations/. Membership in a REALTOR association is not a substitute for state licensure, and state licensure alone does not establish competence in complex commercial investment or leasing work.

The workforce supporting coworking and commercial space includes commercial brokers, leasing agents, property managers, facility managers, architects, civil engineers, structural engineers, interior designers, contractors, electricians, plumbers, heating and cooling technicians, fire-protection specialists, appraisers, surveyors, title professionals, lenders, attorneys, accountants, reception staff, community managers, cleaners, security personnel, information-technology technicians and marketing professionals. Idaho’s construction labor force is particularly consequential because coworking and office projects require tenant improvements and repeated reconfiguration. The Idaho Department of Labor reported that nearly half of statewide construction employment was located in southwestern Idaho, that approximately 95 percent of the region’s construction jobs were located in the Boise metropolitan statistical area, and that regional construction employment reached 26,689 in 2019 https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf. The department maintains the state’s principal public infrastructure for job listings, labor-market data, employer services, training support and career exploration https://www.labor.idaho.gov/.

Boise State University, the College of Western Idaho, Northwest Nazarene University and the College of Idaho contribute to the regional workforce and entrepreneurial pipeline. The Idaho Department of Labor’s regional report recorded Boise State University, the College of Idaho, Northwest Nazarene University and the College of Western Idaho as major southwestern Idaho educational institutions serving undergraduate, graduate, technical, continuing-education and dual-credit populations https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf. Their graduates and programs feed accounting, finance, construction, technology, communications, entrepreneurship, design and management occupations that occupy and administer commercial space. Educational institutions also generate direct demand for research offices, incubators, clinical facilities, student-oriented retail, professional training rooms and event venues.

Federal jurisdiction enters through workplace safety, accessibility, employment law, telecommunications, taxation, lending and environmental regulation. The Occupational Safety and Health Act requires covered employers to maintain workplaces free from recognized serious hazards and authorizes federal workplace-safety standards https://www.osha.gov/laws-regs/oshact/completeoshact. The Americans with Disabilities Act applies to covered places of public accommodation and commercial facilities, while the 2010 ADA Standards establish scoping and technical requirements for accessible design https://www.ada.gov/law-and-regs/design-standards/2010-stds/. A coworking site’s accessibility obligations can reach entrances, routes, doors, service counters, toilet rooms, meeting rooms and other member or visitor areas. The Fair Labor Standards Act governs minimum wage, overtime and related employment standards for covered workers https://www.dol.gov/agencies/whd/flsa. Federal tax treatment distinguishes rent, service revenue, capital improvements, depreciation and operating expenses, making accounting structure material to both landlords and coworking operators.

Fire and life-safety regulation connects commercial real estate to emergency services. High-density coworking layouts, public events, interior rooms, access-control systems and furniture arrangements can affect occupant load, exit access and emergency egress. A membership agreement cannot override a fire-code occupant limit, and advertised event capacity should not be inferred solely from floor area. Building owners, tenants and operators must coordinate on alarm systems, sprinklers, extinguishers, emergency lighting, exit signs, door hardware, fire lanes and inspection access. The legal responsibility for a condition may be allocated contractually between landlord and tenant, but regulatory authorities may still require correction before occupancy or continued operation.

Coworking depends on broadband and electrical reliability more intensively than many traditional office uses because internet access, cloud software, video conferencing, network security, electronic access control, voice services and digital booking systems form part of the purchased product. The Census Bureau reports computer ownership and broadband subscription among Boise’s core community characteristics, reflecting the digital foundation of the regional knowledge economy https://www.census.gov/quickfacts/fact/table/boisecitycityidaho/PST045225. Commercial operators require service-level planning for primary and backup internet connections, wireless density, segmented guest networks, cybersecurity, electrical capacity, uninterruptible power, audiovisual systems and confidential-call environments. A workspace marketed to remote employees or regulated professionals must address privacy and network segmentation rather than treating shared Wi-Fi as a sufficient enterprise service.

The sector connects directly to healthcare because medical providers require clinics, administrative offices, billing operations, training rooms and specialized outpatient properties. The Idaho Department of Labor identified continuing expansion by St. Luke’s, Saint Alphonsus and regional medical providers as a major force in southwestern Idaho development https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf. Healthcare-oriented coworking or shared professional suites introduce additional requirements involving patient privacy, sound isolation, medical waste, infection control, specialized plumbing, clinical licensing and accessibility. Ordinary business coworking should not be presumed suitable for medical treatment merely because a private room is available.

The sector connects to construction and government procurement because public agencies, schools, healthcare systems and private developers procure architecture, engineering, tenant improvements, maintenance, furnishings, technology and facility services. Regional job growth creates demand for new premises; new premises create construction and procurement activity; completed space attracts employers; and employer expansion reinforces demand for additional housing, transportation and services. This feedback loop is documented in the Idaho Department of Labor’s description of population growth, construction employment, commercial developments and institutional expansion in southwestern Idaho https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf.

The sector connects to entrepreneurship and technology through shared space, founder networks and distributed employment. Empirical coworking research based on organizations operating in multiple coworking spaces found a positive relationship between collaboration and firm innovativeness and concluded that collaborative relationships can affect business-model development https://arxiv.org/abs/2111.09866. Research on virtually extended coworking found that information and communications technology can reinforce social proximity, motivation and knowledge sharing when physical coworking interactions are supplemented by digital systems https://arxiv.org/abs/2012.09538. These findings correspond to the service design of Treasure Valley operators that combine physical offices with networking, events, studios, meeting technology and community management, although neither study is specific to Idaho and neither independently proves that every local coworking membership generates innovation.

The post-pandemic hybrid-work transition altered commercial-office demand by weakening the assumption that every employee requires a permanently assigned desk. Research on flexible work arrangements found persistent low office attendance in studied software companies and identified practical, behavioral, equipment and task-related reasons for continued remote work https://arxiv.org/abs/2208.12797. Treasure Valley flexible-space operators respond to this pattern through hourly rooms, day offices, hot desks, part-time plans, virtual addresses and team suites. The market opportunity is not simply “remote work replacing offices”; it is the conversion of some fixed, long-duration occupancy into variable, service-intensive and geographically distributed occupancy.

Coworking also intersects transportation and environmental policy. Research examining the direct and indirect environmental effects of coworking concluded that local coworking can reduce commuting impacts but that energy consumed by an additional workspace may offset some savings unless total heated floor area and transportation behavior also change https://arxiv.org/abs/2006.08225. In the Treasure Valley, where employment, housing and commercial nodes extend along Interstate 84 and arterial corridors, coworking near residential growth centers may shorten some trips while simultaneously generating new building energy demand, parking demand and vehicle trips. Environmental claims therefore require measurement of member travel behavior, building efficiency and avoided corporate-office space rather than relying on the label “coworking.”

Commercial-space finance connects landlords and operators to banks, private investors, Small Business Administration programs, construction lenders and municipal development incentives. Conventional landlords generally rely on predictable lease income and tenant credit, while coworking operators transform longer-term real-estate obligations into shorter-term memberships and absorb utilization risk. This creates a structural maturity mismatch: the operator may owe fixed rent, debt service and staffing costs even when members can cancel or reduce space. Sustainable operations require disciplined occupancy analysis, pricing, renewal tracking, member acquisition, churn control, event economics, capital reserves and landlord negotiations. An attractive facility does not eliminate the need to maintain sufficient contribution margin per workstation and private office.

Property-level due diligence must cover ownership, legal description, zoning, permitted use, certificates of occupancy, building condition, roof and mechanical systems, accessibility, fire protection, parking, signage, environmental conditions, easements, title exceptions, operating expenses, tax assessments, utility capacity and planned public improvements. A conventional office listing proves that space is being marketed; it does not prove that every proposed use is permitted, that the stated square footage is independently verified, or that future operating expenses will remain stable. Municipal records, recorded documents, inspection reports, lease documents and professional evaluations must govern high-value decisions.

The Treasure Valley market is represented institutionally by the Idaho Real Estate Commission, the Idaho Division of Occupational and Professional Licenses, Boise Regional REALTORS, the Boise Metro Chamber, the Boise Valley Economic Partnership, municipal economic-development departments, city and county planning agencies, local building departments, the Ada County Highway District, educational institutions and private commercial brokerages. No single body governs “coworking” as a unified profession. The sector is instead regulated through the legal character of each activity: real-estate brokerage, leasing, land use, building occupancy, business operation, employment, public accommodation, fire safety, construction, taxation, mail service, food service, childcare, healthcare or event production.

The regional market’s development trajectory is driven by the simultaneous expansion of population, professional employment, technology activity, healthcare, education, construction and suburban commercial centers. The Boise metro’s disproportionate contribution to statewide job growth, the expansion of Meridian and Nampa, the growth of major institutional employers and the normalization of hybrid work collectively support a diversified space market ranging from downtown private offices to suburban team suites and short-duration meeting rooms. The decisive competitive question is no longer whether the Treasure Valley possesses coworking capacity; it is which operators can maintain reliable infrastructure, strong community value, regulatory compliance, disciplined unit economics and locations aligned with the region’s shifting employment geography.

https://kiln.com/communities/boise/ contains Kiln’s official description of its Boise coworking, private-office, studio, meeting and event-space facilities.

https://kiln.com/communities/meridian/ contains Kiln’s official description of its Meridian coworking community, conference rooms, podcast studio, atrium and fitness facilities.

https://www.officeevolution.com/locations/usa/idaho/boise/ contains the official Office Evolution Downtown Boise location, address and flexible-office service inventory.

https://www.officeevolution.com/locations/usa/idaho/boise/coworking/ contains the operator’s dedicated description of its Boise coworking service.

https://www.officeevolution.com/locations/usa/idaho/boise/blog/ contains the location’s historical posts and operating updates concerning flexible work and the Boise office market.

https://www.regus.com/en/us/idaho/boise/coworking contains Regus’s official Boise coworking plans and booking structure.

https://www.regus.com/en/us/idaho/meridian/coworking contains Regus’s official Meridian coworking offering.

https://www.regus.com/en/us/idaho/nampa/coworking contains Regus’s official Nampa coworking offering.

https://www.hq.com/en/united-states/idaho/nampa contains HQ’s official Nampa flexible-office, coworking, meeting-room and virtual-office offering.

https://www.coworkingcafe.com/coworking-property/us/id/boise/500-south-8th-street/ contains the marketplace profile identifying Trailhead’s workspace at 500 South 8th Street in Boise.

https://trailheadboise.org/kiln-ready-to-open-red-hot-coworking-space-in-meridian/ contains Trailhead’s historical account of Treasure Valley coworking operators, formats and pricing.

https://boisedev.com/news/2022/02/25/kiln-meridian-idaho/ contains contemporary reporting on the opening plans, capacity and positioning of Kiln Meridian.

https://www.coworkingcafe.com/coworking-property/us/id/meridian/id-meridian-w-overland-road/ contains the marketplace profile for the Regus center at 943 West Overland Road in Meridian.

https://liquidspace.com/us/id/meridian contains aggregated on-demand private-office, coworking and meeting-space inventory in Meridian.

https://liquidspace.com/us/id/nampa contains aggregated on-demand office and coworking inventory in Nampa.

https://www.commercialcafe.com/office/us/id/meridian/ contains marketed conventional office listings and commercial property information for Meridian.

https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch20/sect54-2004/ contains Idaho’s statutory definitions governing real-estate licensing, including the definition of commercial real estate.

https://legislature.idaho.gov/statutesrules/idstat/title54/t54ch20/sect54-2085/ contains Idaho’s agency-disclosure and written representation requirements for real-estate licensees.

https://dopl.idaho.gov/rec/rec-statutes-rules-and-guidance/ contains the Idaho Real Estate Commission’s official links to governing statutes, IDAPA rules and regulatory guidance.

https://dopl.idaho.gov/rec/rec-education-applicants/ contains Idaho’s official salesperson prelicense education requirements.

https://www.boirealtors.com/realtor-rules-and-regulations/ contains Boise Regional REALTORS resources concerning Idaho real-estate laws, rules and licensing matters.

https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-66566 contains Boise’s official table of land uses allowed within base zoning districts.

https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-66847 contains Boise development-code provisions governing commercial uses and district-specific conditions.

https://codelibrary.amlegal.com/codes/boise_id/latest/boise/0-0-0-70319 contains definitions used in Boise’s development code, including recognition of the Ada County Highway District.

https://www.cityofboise.org/departments/planning-and-development-services/building/homeowners-guide/ contains Boise permitting guidance demonstrating the distinction between building-permit and planning approvals.

https://www.cityofboise.org/programs/economic-development/resources-and-incentives/ contains Boise’s official economic-development resources and identification of the Boise Valley Economic Partnership.

https://www.boisechamber.org/ contains the official Boise Metro Chamber business-development and regional networking portal.

https://www.cityofnampa.us/713/Expand-Relocate contains Nampa’s official business expansion and relocation program.

https://www.census.gov/quickfacts/fact/table/boisecitycityidaho/PST045225 contains current Census Bureau population, business, education, broadband, income and demographic indicators for Boise.

https://data.census.gov/profile/Boise_City_city%2C_Idaho?g=160XX00US1608830 contains the Census Bureau’s detailed Boise city profile.

https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2019_FINAL.pdf contains the Idaho Department of Labor’s detailed southwestern Idaho analysis of population, labor force, construction, education, healthcare and commercial development.

https://www.labor.idaho.gov/dnn/Portals/0/Publications/Labor%20Market%20Report%202017%20-%20FINAL.pdf contains the Idaho Department of Labor’s analysis of Boise metropolitan employment growth following the Great Recession.

https://www.labor.idaho.gov/wp-content/uploads/publications/Idaho_Labor_Market_Report_2022.pdf contains the department’s 2022 analysis of metropolitan employment growth in Idaho.

https://www.labor.idaho.gov/wp-content/uploads/publications/2023-LMI-Report.pdf contains the department’s 2023 analysis of Idaho employment and industry contributions to gross domestic product.

https://www.labor.idaho.gov/wp-content/uploads/publications/LMI/PUBS/LMI-Report-2024.pdf contains the department’s 2024 labor-market and economic report.

https://www.labor.idaho.gov/ contains Idaho’s official labor-market, employment, employer-service and workforce-development portal.

https://www.osha.gov/laws-regs/oshact/completeoshact contains the federal Occupational Safety and Health Act.

https://www.ada.gov/law-and-regs/design-standards/2010-stds/ contains the federal 2010 ADA Standards for Accessible Design.

https://www.dol.gov/agencies/whd/flsa contains the U.S. Department of Labor’s official Fair Labor Standards Act resource.

https://arxiv.org/abs/2111.09866 contains research examining collaboration, innovativeness and business-model development in coworking spaces.

https://arxiv.org/abs/2012.09538 contains research on digital systems, social proximity, motivation and knowledge sharing in coworking communities.

https://arxiv.org/abs/2208.12797 contains research on office attendance and employee preferences under flexible-work arrangements.

https://arxiv.org/abs/2006.08225 contains research on the direct and indirect environmental effects of coworking and telecommuting.

The overlooked Treasure Valley flexible-workspace tier includes The Common Well, Funnel 33, Office Evolution Eagle, Intelligent Office Boise, additional International Workplace Group centers and conventional office buildings marketed as serviced or flexible space. The Common Well operates from an adapted former factory at 110 West 31st Street in Garden City as a combined creative league, coworking club, artist-studio complex, meeting venue and event space; members may rent dedicated or flexible studios with access to meeting rooms, event areas, high-speed internet, telephone booths and a kitchen, while participation in its broader artist-and-entrepreneur community is not restricted to paying workspace members https://thecommonwellboise.com/about. Its membership portal identifies weekday operating hours and confirms that the organization markets the premises as a place where users work in community rather than as a conventional office-only facility https://members.thecommonwellboise.com/. This operating form creates a direct graph edge from commercial real estate to arts and culture because the same property supports desks, studios, exhibitions, residencies and public gatherings; Boise State Public Radio identified Amber Lawless and Katherine Shaughnessy as Common Well co-founders and documented its role as an artistic community-building institution in Garden City https://www.boisestatepublicradio.org/arts-culture/2024-02-13/common-well-gallery-boise-idaho-art-studio-garden-city-william-lewis. The Common Well therefore belongs simultaneously in coworking, creative-economy, event-space, adaptive-reuse and cultural-institution classifications rather than being flattened into a generic shared-office node.

Funnel 33 operates coworking space at 775 South Rivershore Lane, Suite 200, in Eagle and states that its coworking inventory is full, with prospective members directed to a waiting list https://funnel33.com/coworking/. The exhaustion of published capacity is evidence of demand at one niche location, not proof of metropolitan market-wide scarcity, but it demonstrates that small, locally embedded spaces can compete despite the entry of national franchises and multi-location regional operators. Funnel 33’s parent operating identity is an Eagle-based advertising and experiential-production company founded in 2013 with specialties including virtual reality, augmented reality, esports, development, design and experiential marketing https://www.linkedin.com/company/funnel33. The coworking facility is therefore connected directly to the creative-technology and marketing sectors: shared occupancy occurs inside or alongside an operating production business, increasing the possibility of professional adjacency and referrals while also creating potential land-use, parking, security and confidentiality concerns different from those of a passive executive-suite center. Its directory profile identifies high-speed internet, parking, a kitchen, an elevator and a patio, showing how consumer aggregators convert a locally operated niche space into a standardized amenity record that can be compared against larger brands https://www.commercialsearch.com/coworking-property/us/id/eagle/funnel-33/.

Office Evolution Eagle operates at 408 South Eagle Road, Suite 205, and offers private offices, coworking, meeting rooms, business addresses and virtual-business services https://www.officeevolution.com/locations/usa/idaho/eagle/. The center’s position near downtown Eagle and State Highway 55 places it within a suburban professional-service node rather than Boise’s central business district, extending flexible workspace toward residential growth areas and reducing the necessity for some Eagle-area users to commute into downtown Boise. An operator announcement described the Eagle facility as walkable to Old Eagle’s shops, dining and entertainment and accessible from Highway 55 https://www.officeevolution.com/blog/we-are-nominated-for-best-of-boise-2/. The combination of virtual-address products and physical meeting rooms connects coworking to company formation, home-based enterprise, professional licensing and customer-facing credibility because a business can maintain a commercial mailing identity and reserve physical space without leasing a complete conventional suite. That model can support entrepreneurship, but it also requires customers and regulators to distinguish a mailing address from the physical place where regulated services, employees, records or inventory are actually located.

Intelligent Office Boise is separately indexed at 800 West Main Street, Suite 1460, within downtown Boise’s office core and is marketed through national coworking aggregators as private and flexible office inventory https://www.commercialsearch.com/coworking-space/us/id/. Intelligent Office is not an isolated independent brand: Vast Coworking Group announced its acquisition of Intelligent Office in January 2024 and stated that the acquired network joined Office Evolution and Venture X under the Vast portfolio https://vastcoworking.com/blog/cre/vast-coworking-group-solidifies-its-position-as-the-global-leader-in-privately-owned-coworking-spaces-with-the-acquisition-of-intelligent-office-now-establishing-itself-as-the-worlds/. The acquisition means Boise consumers encounter nominally different flexible-workspace brands that share an upstream franchising and ownership platform, creating a consolidation edge that would be invisible in a directory organized only by storefront brand. Vast’s own platform markets franchise ownership and real-estate partnerships across its portfolio, confirming that its growth model combines local operators with centralized brand, sales, operating and development systems https://vastcoworking.com/.

Office Evolution’s corporate information states that the brand operates through OE Franchising LLC, began operating in 2003, began franchising in 2012 and is part of Vast Coworking Group under Vast Holdings LLC and related entities https://officeevolutionfranchise.com/ai-information/. Office Evolution separately states that its locations are locally owned and operated even though the brand belongs to Vast Coworking Group https://www.officeevolution.com/ai-information/. This dual structure matters locally because service quality, employment, community relationships and day-to-day lease obligations may remain under a Treasure Valley franchisee while intellectual property, franchise standards, lead-generation systems and strategic brand control sit upstream. Office Evolution described Vast as part of United Franchise Group in July 2024 and identified Office Evolution, Intelligent Office and Venture X as sibling flexible-workspace brands https://www.officeevolution.com/blog/who-is-the-vast-coworking-group/. CoworkingCafe reported that New State Capital Partners acquired Vast Coworking Group from United Franchise Group in March 2026, making the Treasure Valley’s Office Evolution and Intelligent Office nodes indirectly exposed to private-equity ownership through a platform-level transaction even where local facilities remain franchise-operated https://www.coworkingcafe.com/blog/new-state-capital-partners-acquires-vast-coworking-group-in-carve-out-from-united-franchise-group/. The structural implication is that apparent local competition can coexist with concentrated upstream ownership, and future changes in franchise fees, technology platforms, brand standards or expansion strategy may affect multiple nominally separate Treasure Valley locations at once.

Regus and HQ locations belong to International Workplace Group rather than independent local chains. IWG’s official history states that Regus originated more than thirty years ago after founder Mark Dixon observed businesspeople conducting meetings at café tables and developed short- and long-term workspace products around that demand https://www.iwgplc.com/en-gb/about-us. IWG’s brand-development portal identifies Regus within a multi-brand flexible-workspace system designed to match different properties and customer categories https://www.iwgplc.com/en-gb/develop-a-location/our-brands. This structure connects Treasure Valley Regus and HQ sites to a global platform capable of centralizing booking, memberships, enterprise contracts and property partnerships while distributing locations across Boise, Meridian, Eagle and other submarkets. It also creates an ownership distinction from locally franchised Office Evolution centers and independent spaces such as The Common Well and Funnel 33: the consumer may perceive all of them as coworking, but their capital structures, brand control, geographic networks and landlord arrangements differ materially.

Kiln represents a regional-network growth model concentrated in western United States markets rather than a single-site independent or a globally standardized executive-suite chain. Kiln’s corporate site states that it operates more than twenty-five western locations and offers coworking, private offices, meeting rooms, team space and event facilities https://kiln.com/. A June 2026 company announcement described the network as serving more than 8,500 members across 3,300 companies and identified its founding origin in Utah https://www.prnewswire.com/news-releases/kiln-to-anchor-hospitality-driven-flexible-workspace-and-community-hub-in-the-weave-at-ocvibe-302799958.html. Boise and Meridian consequently function as nodes in a multi-state hospitality-oriented workspace network whose competitive proposition includes programming, amenities and lifestyle features rather than low-cost office occupancy alone. The network scale gives Kiln cross-location brand strength while preserving a western regional identity, placing it structurally between Treasure Valley independents and IWG’s worldwide platform.

The conventional commercial brokerage layer includes locally rooted firms and multinational networks. TOK Commercial markets brokerage, property and market services across the Boise Valley, Magic Valley, eastern Idaho and the Inland Northwest https://tokcommercial.com/. NAI Select identifies itself as a full-service Boise commercial real-estate company serving the Treasure Valley and southern Idaho through sales, leasing, property management, due-diligence analysis, site selection and development consulting https://www.naiselect.com/. Michener Investments states that it has operated in Treasure Valley commercial real estate for more than forty-nine years https://michenerinvestments.com/. Colliers reports Idaho offices in Boise, Nampa, Pocatello, Twin Falls, Idaho Falls and Sun Valley, describes its Idaho operation as locally owned since 2001 and combines that local ownership with a global organization of more than 23,000 professionals https://www.colliers.com/en/united-states/cities/idaho. These firms demonstrate four distinct market structures: a regionally expanding Idaho brokerage, a local affiliate of an international NAI network, a long-established Treasure Valley firm and a locally owned Idaho business operating under a global Colliers platform. A knowledge graph that records only brokerage names without ownership type, network affiliation, service territory and founding longevity loses information needed to evaluate market concentration and referral pathways.

Consumer discovery is increasingly mediated by CoworkingCafe, CommercialSearch, CommercialCafe, CoworkingMag, LoopNet, LinkedIn, Google-linked review displays and operator booking systems. CoworkingCafe’s Idaho index reports multiple coworking properties and exposes brands, addresses, ratings, workspace types and availability through a common interface https://www.coworkingcafe.com/coworking-space/us/id/. CoworkingMag similarly aggregates Idaho coworking inventory and includes Office Evolution Eagle among bookable or inquiry-based properties https://coworkingmag.com/listings/coworking-space/us/id/. CommercialCafe’s Idaho coworking index includes local and branded properties such as the Harper Building, Regus, Intelligent Office and Kiln and presents private-office, desk and meeting-room inventory in a standardized commercial-property format https://www.commercialcafe.com/coworking-space/us/id/. LoopNet markets the Office Evolution Eagle premises as flexible commercial space and exposes building amenities such as reception, signage, kitchens, heating and air conditioning https://www.loopnet.com/Listing/408-S-Eagle-Rd-Eagle-ID/29812887/. These platforms reduce search costs but also flatten legally and operationally different products into comparable cards; a private office, shared desk, virtual address, meeting room and conventional lease may appear in adjacent results even though their possession rights, pricing structures, renewal risks and regulatory implications differ.

Idaho’s Local Land Use Planning Act supplies the state framework beneath municipal and county commercial-space regulation. Idaho Code declares that land-use planning should promote orderly development, protect property rights and provide compatible relationships among agricultural, residential, commercial and industrial uses through local planning processes https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6502/. Idaho Code requires cities and counties to prepare comprehensive plans addressing subjects including property rights, population, economic development, land use, natural resources, transportation, public services and implementation https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6508/. Idaho Code authorizes local governments to adopt zoning ordinances consistent with statutory notice, hearing and planning requirements https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6511/. These provisions explain why a commercial office operator faces materially different district rules in Boise, Meridian, Nampa, Caldwell or unincorporated Ada County even though the underlying real-estate and coworking business model is similar: Idaho delegates detailed use classification and entitlement to local governments within a common state planning framework.

Meridian’s Unified Development Code is Title 11 of Meridian City Code and constitutes the city’s official zoning ordinance https://meridiancity.org/community-development/planning/unified-development-code/. Meridian identifies seventeen zoning districts and warns that its map is continuously revised, making a map useful for initial screening but insufficient as a permanent legal representation of a parcel’s status https://meridiancity.org/community-development/planning/current-planning/zoning-map/. Meridian’s employer guidance directs commercial users to Planning for use compatibility, Building Services for life-safety review and occupancy certification, and the Ada County Highway District for transportation-impact assessment https://meridiancity.org/business/doing-business/employer-resources/. That three-part path establishes an explicit cross-vertical graph: the originating commercial-space use is reviewed by municipal planning, the receiving construction-and-safety domain is reviewed by building officials, and the receiving transportation domain is reviewed by ACHD. A signed lease cannot replace any of those approvals, and a coworking operator increasing occupant density or adding events may alter the assumptions used by each reviewing body.

Meridian’s comprehensive-planning glossary states that an Area of City Impact surrounds municipal limits, that the city exercises comprehensive-planning authority there and that the county generally controls zoning and development entitlements until annexation https://meridiancity.org/community-development/planning/comprehensive-plan/glossary/. The same glossary recognizes office uses as potential transitional buffers between residential and more intensive commercial or industrial activity. This creates a jurisdictional edge that commercial property searches routinely obscure: a site marketed with a Meridian address may remain subject to Ada County entitlement rules, while its future-land-use context is influenced by Meridian’s planning documents. The mailing city, service area, comprehensive-plan authority, zoning jurisdiction and eventual annexation pathway must therefore be modeled as separate attributes.

Meridian’s 2023 land-use report was designed to memorialize annual land-use, zoning and development activity and provide a citywide view of development opportunities https://meridiancity.org/media/apnivixd/land-use-report-2023.pdf. Annual permit, annexation and acreage data are operationally significant to commercial-space analysis because they reveal whether employment land and office-supporting mixed-use areas are expanding alongside population. A market with rapid housing growth but limited employment-space production may export commuters and intensify transportation demand, while a market adding both housing and commercial nodes may support suburban coworking closer to residential concentrations. Meridian’s documentation of its development portfolio therefore connects municipal planning directly to the locational logic behind Kiln, Regus, office campuses and other flexible-workspace products.

Nampa’s Commercial FAQ states that allowed use must be confirmed with Planning and Zoning and explains that occupancy of an existing building or tenant space remains subject to the adopted building, existing-building, property-maintenance and fire codes https://www.cityofnampa.us/1378/Commercial-FAQ. Nampa’s zoning-information portal identifies Title 10 as the city zoning ordinance and records the adoption of multiple zoning changes in January 2026 https://www.cityofnampa.us/1491/Zoning-Information. Nampa’s code-compliance program states that zoning determines which activities may occur on residential, commercial, industrial and agricultural properties and that some activities require special approval from the Planning and Zoning Commission or City Council https://www.cityofnampa.us/152/Business-Code-Compliance. These provisions mean that coworking cannot be classified solely by the landlord’s description of a suite as “office”; ancillary uses such as childcare, events, food preparation, education, recreation, retail or medical services may activate different approval pathways.

Nampa’s comprehensive-plan land-use chapter identifies commercial uses as including offices, hotels, retail, event centers, theaters and service centers and locates substantial commercial land along 12th Avenue, Highway 45, 11th Avenue, Caldwell Boulevard, Garrity Boulevard, Third Street South and other designated areas https://www.cityofnampa.us/DocumentCenter/View/12657/Comp-Plans-CHAPTER-5---Land-Use-Revisions-12-18-2023. The city’s commercial policy document states that commercial zoning should differentiate uses according to scale and compatibility and describes neighborhood commercial areas as smaller-scale commercial environments near residential development https://www.cityofnampa.us/DocumentCenter/View/13804/6-Commercial. Nampa’s own mixed-use guidance explains that conventional zoning separates residential and commercial activities to protect neighborhoods but that mixed-use planning addresses locations where those categories meet or overlap https://www.cityofnampa.us/1739/Mixed-Uses. These policies imply that smaller coworking facilities may fit neighborhood-serving or mixed-use contexts more readily than large event-oriented facilities, while regional centers and transportation corridors can accommodate greater intensity.

Nampa’s published land-use schedule distinguishes permitted, conditional and administratively conditional activities across zoning districts and separates commercial activities from service-and-office uses https://www.cityofnampa.us/DocumentCenter/View/5834/10-3-2-Schedule-of-Land-Use-Controls?bidId=. The classification system creates a regulatory reason to decompose a coworking operator into actual functions rather than assign one broad category. Desk rental may resemble office use, a public workshop may resemble education or assembly, a podcast facility may involve production activity, a therapy suite may involve outpatient service and a large networking event may change occupant-load and parking assumptions. Regulatory classification follows activities and impacts, not marketing terminology.

Caldwell requires any person establishing or operating a permitted or accessory use in a commercial, industrial or mixed-use zoning district to obtain a business permit from Planning and Zoning before beginning that use https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms/Business-License-Permit. Caldwell’s Planning and Zoning Division reviews land-use and development proposals for conformity with the city comprehensive plan and ordinances https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division. The city offers a zoning-property report that can identify current zoning, permitted uses, active violations, development agreements, entitlements and dimensional standards https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms. This report is a higher-value due-diligence artifact than a commercial listing because it joins parcel classification, legal constraints and enforcement status in a municipal record.

Caldwell’s proposed or amended commercial-district language differentiates neighborhood, community, general, freeway and highway-corridor commercial environments and expressly includes office uses at different intensities https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/current-cases/chapter-10-article-6-commercial-districts.pdf. Neighborhood commercial districts are oriented toward smaller, lower-intensity offices and services serving nearby residents, while more intensive corridors accommodate regional commercial activity, larger office parks and medical centers. Caldwell’s mixed-use provisions also contemplate combinations of residential, smaller commercial, entertainment, educational, office and open-space uses https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/current-cases/ch-10-article-1-title-authority-and-purpose.pdf. The regulatory design can support coworking as neighborhood-serving employment space, but event intensity, operating hours and accessory uses may move a proposal beyond the assumptions of a low-impact office classification.

Caldwell’s Building Safety Division publishes commercial permit applications, adopted-code materials, plan-review guidance, fees and submittal checklists https://www.cityofcaldwell.org/Departments/Community-Development/Building-Safety-Division. Caldwell Code Compliance enforces zoning conditions, occupational-license requirements, nuisance rules and dangerous-building provisions through education, warnings, citations, abatements and civil or criminal processes https://www.cityofcaldwell.org/Departments/Community-Development/Code-Compliance-Division. The originating commercial-space node therefore connects to two different municipal enforcement systems: Building Safety regulates construction and occupancy conditions, while Code Compliance regulates continuing use and property conditions. A workspace can be physically complete yet unlawfully operated, or properly zoned yet unsafe for occupancy; both edges must remain distinct.

Ada County’s zoning ordinance establishes land-use regulation for unincorporated territory under Idaho’s planning statutes https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/Ada-County-Zoning-Ordinance-1.pdf. County materials identify a Limited Office district intended for administrative, professional, medical and business-office uses https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/ZO_Ch-2-5-combined-04192022.pdf. Ada County Development Services administers planning, zoning, building and development functions for county jurisdiction https://adacounty.id.gov/developmentservices/. The county’s planning division reviews applications against adopted comprehensive plans and zoning standards https://adacounty.id.gov/developmentservices/community-planning-division/. This framework governs office and coworking projects outside municipal boundaries and reinforces the need to record jurisdiction separately from postal address or metropolitan identity.

Ada County’s zoning-analysis report recommended removing antiquated commercial and office classifications and replacing them with modern use categories https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/Ada-Zoning-Analysis-Report_05-2.pdf. The recommendation illustrates a recurring ontology problem: contemporary shared workplaces combine services and activities not anticipated by older codes built around stable distinctions among professional office, retail, industrial and assembly uses. Code modernization is therefore not merely administrative housekeeping; it determines whether new business forms can be classified consistently and whether neighboring property owners can predict their impacts.

Commercial real estate is connected to architecture, engineering and construction through a deep Treasure Valley workforce pipeline. Boise State University’s Bachelor of Science in Construction Management has trained construction managers for more than forty years https://www.boisestate.edu/coen-cm/. Its Architecture, Engineering and Construction Project Management certificate teaches construction-project fundamentals intended to improve project efficiency, economics, professionalism and safety https://www.boisestate.edu/coen-cm/aecpmcertificate/. Boise State reported in January 2025 that construction-management enrollment had increased 80 percent over six years, that students generally completed two or three internships with local contractors and that graduates achieved a reported 100 percent job-placement rate https://www.boisestate.edu/news/2025/01/24/boise-state-begins-construction-of-new-esi-construction-management-building/. These facts connect regional commercial development demand directly to higher education: construction growth increases demand for managers, contractors provide internships and employment, and the university expands instructional capacity in response.

Boise State’s new ESI Construction Management Building is designed with classrooms, a forty-seat computer laboratory, collaboration areas, conference rooms, a 3,300-square-foot high bay, an overhead crane and an outdoor learning area, and the building itself is intended to function as a teaching tool for materials, methods and construction technology https://www.boisestate.edu/coen-cm/construction-management-lab-expansion/. A July 2026 university announcement states that United Rentals partnered with the program and describes the curriculum as combining hands-on construction exposure with project-management and leadership training https://www.boisestate.edu/news/2026/07/07/united-rentals-partners-with-boise-state-to-support-thriving-construction-management-program/. The relationship creates a cross-domain edge from equipment rental and construction services to academic workforce formation; industry capital and equipment support the program that supplies managers to contractors building offices, industrial properties and tenant improvements.

The College of Western Idaho’s workforce-development system trains electricians, plumbers, heating and cooling technicians, drafters, erosion-control personnel and other practitioners required to construct and maintain commercial buildings https://cwi.edu/academics/workforce-development-training. CWI’s industrial-technology and trades program includes computer drafting and applied technology pathways relevant to architectural, engineering and construction documentation https://cwi.edu/academics/programs/industrial-technology-trades. CWI recognizes completed registered apprenticeships for academic credit in electrical, heating and cooling, plumbing, communications-technology, generation-technology and line-operation fields https://cwi.edu/students/academic-resources/testing-services/credit-prior-learning. This recognition links employment-based apprenticeship to formal postsecondary credentials, allowing trade experience obtained on commercial projects to become part of an academic progression rather than remaining institutionally isolated.

IBEW Local 291, headquartered in Boise, represents more than 2,000 electrical workers and identifies itself as Idaho’s largest trade union https://www.ibew291.org/. Its apprenticeship page connects workers to substation and electrical training pathways serving signatory contractors https://www.ibew291.org/apprenticeships. Its dispatch system requires an Idaho journeyman license for journeyman-wireman calls, demonstrating that union referral, apprenticeship completion and state occupational licensing operate as separate but connected workforce gates https://www.ibew291.org/dispatch. Local 291 also offers journeyman test preparation, member orientation and continuing education https://www.ibew291.org/our-events/upcoming-local-union-training---multiple-dates. Commercial-space construction therefore depends on a pipeline extending from classroom instruction through supervised apprenticeship, state examination or license eligibility, union dispatch and contractor employment.

The Idaho Associated General Contractors operates workforce-development resources covering career information, salaries, scholarships, training and a construction-specific job board https://www.idahoagc.org/workforce-development. Idaho AGC’s “Let’s Get Building” pre-apprenticeship was developed with the West Central Mountains Economic Development Council, University of Idaho Extension, Idaho State University and the National Guard and incorporates construction skills, employability preparation, OSHA safety training, first aid, CPR and a construction-combine event https://www.idahoagc.org/blog/lets-get-building-pre-apprenticeship-program-launches. Idaho AGC publications describe apprenticeship instruction in carpenter, construction-equipment-operator and laborer tracks https://www.idahoagc.org/sites/default/files/u-23/SP2022%20buildingIdaho.pdf. These pathways connect commercial development to workforce policy because shortages of entry-level and journey-level workers can delay tenant improvements, increase buildout costs and constrain the speed at which advertised space becomes occupiable.

Commercial-space demand connects to transportation planning through the spatial separation of housing and employment. Nampa’s commercial land-use pattern follows major road corridors, while Meridian directs employers to ACHD for road-impact analysis https://www.cityofnampa.us/DocumentCenter/View/12657/Comp-Plans-CHAPTER-5---Land-Use-Revisions-12-18-2023 and https://meridiancity.org/business/doing-business/employer-resources/. The sourced implication is that coworking near suburban population centers can function as transportation-demand infrastructure by allowing some workers to use professional space without reaching downtown Boise, but each new center can also generate local vehicle trips, parking demand and intersection impacts. The same facility may reduce regional commute distance while increasing neighborhood-level traffic, so transportation effects must be modeled at more than one geographic scale.

Commercial space connects to healthcare through zoning categories, construction specialization and professional occupancy. Ada County expressly includes medical offices within its Limited Office district framework https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/ZO_Ch-2-5-combined-04192022.pdf, while Caldwell’s more intensive corridor categories contemplate medical centers and larger office developments https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/current-cases/chapter-10-article-6-commercial-districts.pdf. The receiving healthcare node introduces privacy, accessibility, clinical licensing, specialized waste, plumbing and infection-control obligations that ordinary coworking does not satisfy automatically. A therapy provider or health consultant renting a flexible office therefore connects the workspace operator to healthcare regulation without converting the entire building into a medical facility.

Commercial space connects to art, hospitality and events when operators monetize common areas outside ordinary office hours. The Common Well combines studios, event space, exhibitions and coworking https://thecommonwellboise.com/about, while Funnel 33 combines workspace with an experiential-marketing company https://www.linkedin.com/company/funnel33. These hybrid models can improve utilization and create stronger communities, but they also create divergent fire, parking, noise, alcohol-service, accessibility and insurance exposures. The sourced implication is that revenue diversification increases the number of regulatory domains attached to one property, making a simple “coworking” label insufficient for compliance analysis.

Commercial-space location and building systems connect to digital infrastructure because shared workplaces must support multiple unrelated users, cloud applications, videoconferencing, access-control systems and confidential communications. Research proposing cloud-based smart-office infrastructure describes the use of sensors, microservices and individualized environmental controls to improve shared-workplace efficiency and user experience https://arxiv.org/abs/2403.18883. The relevance to Treasure Valley operators is operational rather than geographic: hospitality-oriented centers with many users and reservable rooms can treat occupancy, temperature, air quality and space utilization as measurable systems, while small local operators may compete through personal service and community rather than capital-intensive building technology.

Return-to-office research using approximately 260 million employment resumes found that mandatory return policies at Microsoft, SpaceX and Apple were associated with reductions in employee tenure and shifts away from senior workers, with departures toward larger competitors https://arxiv.org/abs/2405.04352. The study does not measure Idaho companies, but its mechanism has regional commercial implications: employers seeking physical collaboration without imposing five-day headquarters attendance may use distributed offices, satellite suites or coworking memberships as intermediate arrangements. This can shift demand from large permanent headquarters toward smaller flexible nodes near employee residences, especially in a polycentric metropolitan area.

Urban-cluster research finds that business concentration operates at nested scales ranging from localized groups to metropolitan clusters and that observed relationships depend on both industrial similarity and geographic proximity https://arxiv.org/abs/1905.05106. Treasure Valley commercial-space analysis should therefore distinguish downtown Boise’s professional concentration, Garden City’s creative and adaptive-reuse cluster, Eagle’s professional and technology-oriented spaces, Meridian’s suburban office and mixed-use nodes, and Canyon County’s corridor-based commercial growth. Treating the entire Treasure Valley as one undifferentiated office market hides localized ecosystems whose tenants, amenities, transportation patterns and regulatory contexts differ.

The Common Well’s 5.0 rating and published review count on CoworkingCafe, Funnel 33’s review presentation on CoworkingCafe and Office Evolution Eagle’s review count on its official location page demonstrate that reputation data is now attached to commercial-space discovery https://www.coworkingcafe.com/coworking-property/us/id/garden-city/the-common-well/, https://www.coworkingcafe.com/coworking-property/us/id/eagle/funnel-33/ and https://www.officeevolution.com/locations/usa/idaho/eagle/. Ratings influence consumer shortlisting but remain platform-specific snapshots subject to selection bias, moderation rules and changing review counts. A robust knowledge graph should store the platform, observation date, score and review count rather than asserting a timeless universal reputation.

The combined market structure is not a binary contest between conventional landlords and coworking companies. It includes independent creative spaces, operating-company coworking, locally owned franchises, private-equity-backed franchise platforms, international workspace networks, western regional operators, local brokerages, global brokerage affiliations, landlord-listed executive suites and hourly booking aggregators. Idaho’s delegated land-use system then overlays each operator with parcel-level municipal or county rules, while construction and occupational pipelines determine how rapidly spaces can be built, altered and maintained. The analytical requirement is strict: brand, local operator, franchise entity, ultimate platform owner, building owner, landlord, booking platform, zoning jurisdiction and operating use must be represented as separate nodes whenever evidence permits, because collapsing them into one “provider” entity destroys the ownership and regulatory edges that explain how the Treasure Valley market actually functions.

https://thecommonwellboise.com/about contains The Common Well’s official description of its Garden City creative community, coworking memberships, studios, meeting rooms and event space.

https://members.thecommonwellboise.com/ contains The Common Well’s membership-facing location and operating-hours information.

https://www.boisestatepublicradio.org/arts-culture/2024-02-13/common-well-gallery-boise-idaho-art-studio-garden-city-william-lewis contains Boise State Public Radio reporting on The Common Well’s founders and role in Garden City’s arts community.

https://funnel33.com/coworking/ contains Funnel 33’s official Eagle coworking address, contact information and waiting-list notice.

https://www.linkedin.com/company/funnel33 contains Funnel 33’s business profile, founding year, headquarters, size and experiential-marketing specialties.

https://www.commercialsearch.com/coworking-property/us/id/eagle/funnel-33/ contains Funnel 33’s standardized coworking listing and amenity information.

https://www.officeevolution.com/locations/usa/idaho/eagle/ contains Office Evolution Eagle’s official address and flexible-workspace products.

https://www.officeevolution.com/blog/we-are-nominated-for-best-of-boise-2/ contains Office Evolution’s description of the Eagle center’s proximity to Old Eagle and Highway 55.

https://www.commercialsearch.com/coworking-space/us/id/ contains statewide flexible-workspace listings including Intelligent Office Boise and other Treasure Valley locations.

https://vastcoworking.com/blog/cre/vast-coworking-group-solidifies-its-position-as-the-global-leader-in-privately-owned-coworking-spaces-with-the-acquisition-of-intelligent-office-now-establishing-itself-as-the-worlds/ contains Vast Coworking Group’s official January 2024 announcement of its Intelligent Office acquisition.

https://vastcoworking.com/ contains Vast’s official description of its coworking-brand, franchise and real-estate partnership platform.

https://officeevolutionfranchise.com/ai-information/ contains Office Evolution’s franchise entity, founding, franchising and parent-company information.

https://www.officeevolution.com/ai-information/ contains Office Evolution’s statement that it belongs to Vast Coworking Group and that individual centers are locally owned and operated.

https://www.officeevolution.com/blog/who-is-the-vast-coworking-group/ contains Office Evolution’s 2024 explanation of Vast’s relationship to United Franchise Group and its sibling brands.

https://www.coworkingcafe.com/blog/new-state-capital-partners-acquires-vast-coworking-group-in-carve-out-from-united-franchise-group/ contains reporting on New State Capital Partners’ March 2026 acquisition of Vast Coworking Group.

https://www.iwgplc.com/en-gb/about-us contains International Workplace Group’s official corporate history and account of Regus’s origin.

https://www.iwgplc.com/en-gb/develop-a-location/our-brands contains IWG’s official multi-brand property and workspace strategy.

https://kiln.com/ contains Kiln’s official network-wide description and western United States location count.

https://www.prnewswire.com/news-releases/kiln-to-anchor-hospitality-driven-flexible-workspace-and-community-hub-in-the-weave-at-ocvibe-302799958.html contains Kiln’s June 2026 statement concerning its founding region, membership scale, client-company count and network strategy.

https://tokcommercial.com/ contains TOK Commercial’s official service and geographic-market information.

https://www.naiselect.com/ contains NAI Select’s official Treasure Valley sales, leasing, management, due-diligence and development-consulting services.

https://michenerinvestments.com/ contains Michener Investments’ official statement of its Treasure Valley commercial-real-estate longevity.

https://www.colliers.com/en/united-states/cities/idaho contains Colliers Idaho’s official office network, local-ownership history and global organizational scale.

https://www.coworkingcafe.com/coworking-space/us/id/ contains CoworkingCafe’s statewide inventory of coworking and flexible-office properties.

https://coworkingmag.com/listings/coworking-space/us/id/ contains CoworkingMag’s aggregated Idaho coworking inventory.

https://www.commercialcafe.com/coworking-space/us/id/ contains CommercialCafe’s statewide coworking, private-office, meeting-room and desk listings.

https://www.loopnet.com/Listing/408-S-Eagle-Rd-Eagle-ID/29812887/ contains LoopNet’s commercial-property presentation of the Office Evolution Eagle location.

https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6502/ contains the purposes and policy declarations of Idaho’s Local Land Use Planning Act.

https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6508/ contains Idaho’s statutory comprehensive-planning requirements and required planning components.

https://legislature.idaho.gov/statutesrules/idstat/title67/t67ch65/sect67-6511/ contains Idaho’s statutory authority and procedures for local zoning ordinances.

https://meridiancity.org/community-development/planning/unified-development-code/ identifies Title 11 of Meridian City Code as the city’s Unified Development Code.

https://meridiancity.org/community-development/planning/current-planning/zoning-map/ contains Meridian’s current zoning-map access and accuracy disclaimer.

https://meridiancity.org/business/doing-business/employer-resources/ contains Meridian’s official explanation of Planning, Building Services and ACHD review roles for commercial users.

https://meridiancity.org/community-development/planning/comprehensive-plan/glossary/ contains Meridian’s definitions for Areas of City Impact, transitional office uses and planning terminology.

https://meridiancity.org/media/apnivixd/land-use-report-2023.pdf contains Meridian’s 2023 annual land-use, zoning and development report.

https://www.cityofnampa.us/1378/Commercial-FAQ contains Nampa’s commercial occupancy, building-permit and allowed-use guidance.

https://www.cityofnampa.us/1491/Zoning-Information contains Nampa’s Title 10 zoning materials and notice of January 2026 amendments.

https://www.cityofnampa.us/152/Business-Code-Compliance contains Nampa’s explanation of zoning enforcement and activities requiring special approval.

https://www.cityofnampa.us/DocumentCenter/View/12657/Comp-Plans-CHAPTER-5---Land-Use-Revisions-12-18-2023 contains Nampa’s comprehensive-plan treatment of commercial uses and principal commercial corridors.

https://www.cityofnampa.us/DocumentCenter/View/13804/6-Commercial contains Nampa’s commercial land-use policies concerning scale, location and neighborhood compatibility.

https://www.cityofnampa.us/1739/Mixed-Uses contains Nampa’s official explanation of mixed-use planning and the interaction of residential and commercial uses.

https://www.cityofnampa.us/DocumentCenter/View/5834/10-3-2-Schedule-of-Land-Use-Controls?bidId= contains Nampa’s schedule of permitted, conditional and administratively approved land uses.

https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms/Business-License-Permit contains Caldwell’s commercial, industrial and mixed-use business-permit requirement.

https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division contains Caldwell Planning and Zoning’s official responsibilities.

https://www.cityofcaldwell.org/Departments/Community-Development/Planning-Zoning-Division/Applications-Forms contains Caldwell’s zoning-property-report service and the information included in a report.

https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/current-cases/chapter-10-article-6-commercial-districts.pdf contains Caldwell’s commercial-district purposes and treatment of office, service, medical and regional commercial uses.

https://www.cityofcaldwell.org/files/assets/city/v/2/planning-amp-zoning/documents/current-cases/ch-10-article-1-title-authority-and-purpose.pdf contains Caldwell zoning language concerning traditional-neighborhood and mixed-use combinations.

https://www.cityofcaldwell.org/Departments/Community-Development/Building-Safety-Division contains Caldwell’s building-permit, code, fee and plan-review resources.

https://www.cityofcaldwell.org/Departments/Community-Development/Code-Compliance-Division contains Caldwell’s code-enforcement responsibilities and enforcement mechanisms.

https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/Ada-County-Zoning-Ordinance-1.pdf contains the Ada County zoning ordinance governing unincorporated land.

https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/ZO_Ch-2-5-combined-04192022.pdf contains Ada County district provisions including the Limited Office district.

https://adacounty.id.gov/developmentservices/ contains Ada County Development Services’ planning, zoning and development resources.

https://adacounty.id.gov/developmentservices/community-planning-division/ contains the county division’s comprehensive-plan and zoning-review responsibilities.

https://adacounty.id.gov/developmentservices/wp-content/uploads/sites/37/Ada-Zoning-Analysis-Report_05-2.pdf contains Ada County’s analysis and modernization recommendations for commercial and office zoning classifications.

https://www.boisestate.edu/coen-cm/ contains Boise State University’s Bachelor of Science in Construction Management program.

https://www.boisestate.edu/coen-cm/aecpmcertificate/ contains Boise State’s Architecture, Engineering and Construction Project Management certificate.

https://www.boisestate.edu/news/2025/01/24/boise-state-begins-construction-of-new-esi-construction-management-building/ contains Boise State’s enrollment, internship, placement and new-building information for construction management.

https://www.boisestate.edu/coen-cm/construction-management-lab-expansion/ contains the program and facility plan for Boise State’s ESI Construction Management Building.

https://www.boisestate.edu/news/2026/07/07/united-rentals-partners-with-boise-state-to-support-thriving-construction-management-program/ contains Boise State’s July 2026 announcement of its United Rentals partnership and hands-on training model.

https://cwi.edu/academics/workforce-development-training contains College of Western Idaho workforce programs for drafting, electrical, plumbing, heating and cooling, erosion control and related trades.

https://cwi.edu/academics/programs/industrial-technology-trades contains CWI’s industrial-technology, drafting and applied-trades programs.

https://cwi.edu/students/academic-resources/testing-services/credit-prior-learning contains CWI’s academic-credit rules for completed registered trade apprenticeships.

https://www.ibew291.org/ contains IBEW Local 291’s official membership and organizational information.

https://www.ibew291.org/apprenticeships contains IBEW Local 291’s apprenticeship pathways.

https://www.ibew291.org/dispatch contains Local 291’s dispatch information and Idaho journey-level license requirement.

https://www.ibew291.org/our-events/upcoming-local-union-training---multiple-dates contains Local 291’s continuing education, orientation and test-preparation schedule.

https://www.idahoagc.org/workforce-development contains Idaho AGC’s construction workforce, career, scholarship, training and job-board resources.

https://www.idahoagc.org/blog/lets-get-building-pre-apprenticeship-program-launches contains Idaho AGC’s description of the “Let’s Get Building” pre-apprenticeship program and institutional partners.

https://www.idahoagc.org/sites/default/files/u-23/SP2022%20buildingIdaho.pdf contains Idaho AGC workforce-development reporting and apprenticeship-track information.

https://arxiv.org/abs/2403.18883 contains research proposing cloud, sensor and microservice systems for individualized shared workplaces.

https://arxiv.org/abs/2405.04352 contains research on the labor effects of mandatory return-to-office policies at major technology companies.

https://arxiv.org/abs/1905.05106 contains research on the nested geographic and industrial structure of urban business clusters.

https://www.coworkingcafe.com/coworking-property/us/id/garden-city/the-common-well/ contains The Common Well’s platform rating, reviews, location and coworking amenities.

https://www.coworkingcafe.com/coworking-property/us/id/eagle/funnel-33/ contains Funnel 33’s platform rating, reviews, address, hours and amenities.


SEMANTIC EDGE LEDGER · COWORKING_COMMERCIAL_SPACE · refinery-treasurevalley-v1.0.0
73 🌲 EVERGREEN · 79 🌿 BRANCH · 0 🫐 BERRY · 0 🌱 SEED
73 🌲 EVERGREEN
79 🌿 BRANCH
0 🫐 BERRY
0 🌱 SEED
Articles raw: 156 · Deduped: 152 · Entities: 0 · Sections: 0 · Noise filtered: 0 · Dropped noise: 0 · Dropped dupes: 4
KW HIGH 79 EXACT TITLE 73
◈ 🌲 EVERGREEN 73 EDGES
1.00
vertical-level
access control
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "access control". Entity: vertical-level.
1.00
vertical-level
ada county,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "ada county,". Entity: vertical-level.
1.00
vertical-level
americans with disabilities act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "americans with disabilities act". Entity: vertical-level.
1.00
vertical-level
apprenticeship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "apprenticeship". Entity: vertical-level.
1.00
Architecture ↗ Q12271 EXACT TITLE
vertical-level
architecture
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "architecture". Entity: vertical-level.
1.00
Studio ↗ Q746628 EXACT TITLE
vertical-level
studio
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "studio". Entity: vertical-level.
1.00
vertical-level
associated general contractors
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "associated general contractors". Entity: vertical-level.
1.00
vertical-level
boise metropolitan area
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise metropolitan area". Entity: vertical-level.
1.00
vertical-level
boise state university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "boise state university". Entity: vertical-level.
1.00
Broadband ↗ Q194163 EXACT TITLE
vertical-level
broadband
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "broadband". Entity: vertical-level.
1.00
vertical-level
capitalization rate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "capitalization rate". Entity: vertical-level.
1.00
vertical-level
central business district
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "central business district". Entity: vertical-level.
1.00
vertical-level
civil engineer
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "civil engineer". Entity: vertical-level.
1.00
vertical-level
collaboration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "collaboration". Entity: vertical-level.
1.00
vertical-level
college of idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "college of idaho". Entity: vertical-level.
1.00
vertical-level
college of western idaho
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "college of western idaho". Entity: vertical-level.
1.00
vertical-level
commercial property
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "commercial property". Entity: vertical-level.
1.00
vertical-level
consolidation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "consolidation". Entity: vertical-level.
1.00
vertical-level
construction management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "construction management". Entity: vertical-level.
1.00
vertical-level
construction
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "construction". Entity: vertical-level.
1.00
Coworking ↗ Q869457 EXACT TITLE
vertical-level
coworking
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "coworking". Entity: vertical-level.
1.00
Downtown ↗ Q1050303 EXACT TITLE
vertical-level
downtown
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "downtown". Entity: vertical-level.
1.00
Electrician ↗ Q165029 EXACT TITLE
vertical-level
electrician
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "electrician". Entity: vertical-level.
1.00
vertical-level
entrepreneurship
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "entrepreneurship". Entity: vertical-level.
1.00
vertical-level
executive suite
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "executive suite". Entity: vertical-level.
1.00
vertical-level
fair labor standards act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fair labor standards act". Entity: vertical-level.
1.00
vertical-level
fire protection
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "fire protection". Entity: vertical-level.
1.00
Franchising ↗ Q171947 EXACT TITLE
vertical-level
franchising
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "franchising". Entity: vertical-level.
1.00
vertical-level
garden city,
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "garden city,". Entity: vertical-level.
1.00
vertical-level
remote work
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "remote work". Entity: vertical-level.
1.00
vertical-level
idaho state
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "idaho state". Entity: vertical-level.
1.00
vertical-level
business cluster
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "business cluster". Entity: vertical-level.
1.00
Innovation ↗ Q174165 EXACT TITLE
vertical-level
innovation
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "innovation". Entity: vertical-level.
1.00
vertical-level
interior design
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "interior design". Entity: vertical-level.
1.00
vertical-level
international workplace group
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "international workplace group". Entity: vertical-level.
1.00
vertical-level
interstate 84
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "interstate 84". Entity: vertical-level.
1.00
vertical-level
knowledge economy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "knowledge economy". Entity: vertical-level.
1.00
vertical-level
knowledge sharing
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "knowledge sharing". Entity: vertical-level.
1.00
vertical-level
land-use planning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "land-use planning". Entity: vertical-level.
1.00
Landlord ↗ Q618532 EXACT TITLE
vertical-level
landlord
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "landlord". Entity: vertical-level.
1.00
Lease ↗ Q716894 EXACT TITLE
vertical-level
lease
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "lease". Entity: vertical-level.
1.00
LinkedIn ↗ Q213660 EXACT TITLE
vertical-level
linkedin
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "linkedin". Entity: vertical-level.
1.00
LoopNet ↗ Q6675775 EXACT TITLE
vertical-level
loopnet
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "loopnet". Entity: vertical-level.
1.00
vertical-level
mixed-use development
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "mixed-use development". Entity: vertical-level.
1.00
vertical-level
northwest nazarene university
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "northwest nazarene university". Entity: vertical-level.
1.00
Occupancy ↗ EXACT TITLE
vertical-level
occupancy
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "occupancy". Entity: vertical-level.
1.00
vertical-level
occupational safety and health act
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "occupational safety and health act". Entity: vertical-level.
1.00
vertical-level
occupational safety and health
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "occupational safety and health". Entity: vertical-level.
1.00
vertical-level
office space
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "office space". Entity: vertical-level.
1.00
Plumber ↗ Q252924 EXACT TITLE
vertical-level
plumber
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "plumber". Entity: vertical-level.
1.00
Podcast ↗ Q20899 EXACT TITLE
vertical-level
podcast
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "podcast". Entity: vertical-level.
1.00
vertical-level
property management
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "property management". Entity: vertical-level.
1.00
vertical-level
property manager
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "property manager". Entity: vertical-level.
1.00
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
Real estate ↗ Q684740 EXACT TITLE
vertical-level
real estate
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "real estate". Entity: vertical-level.
1.00
Retail ↗ Q126793 EXACT TITLE
vertical-level
retail
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "retail". Entity: vertical-level.
1.00
vertical-level
shared space
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "shared space". Entity: vertical-level.
1.00
vertical-level
small business administration
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "small business administration". Entity: vertical-level.
1.00
vertical-level
small business
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "small business". Entity: vertical-level.
1.00
Tenant ↗ Q528278 EXACT TITLE
vertical-level
tenant
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "tenant". Entity: vertical-level.
1.00
vertical-level
treasure valley
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "treasure valley". Entity: vertical-level.
1.00
vertical-level
uninterruptible power
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "uninterruptible power". Entity: vertical-level.
1.00
vertical-level
united states
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "united states". Entity: vertical-level.
1.00
vertical-level
united states
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "united states". Entity: vertical-level.
1.00
vertical-level
united states
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "united states". Entity: vertical-level.
1.00
vertical-level
united states
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "united states". Entity: vertical-level.
1.00
Warehouse ↗ Q181623 EXACT TITLE
vertical-level
warehouse
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "warehouse". Entity: vertical-level.
1.00
Workplace ↗ Q628858 EXACT TITLE
vertical-level
workplace
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "workplace". Entity: vertical-level.
1.00
Zoning ↗ Q702232 EXACT TITLE
vertical-level
zoning
EXACT MATCH: Wikipedia title found verbatim in research markdown. Matched string: "zoning". Entity: vertical-level.
◈ 🌿 BRANCH 79 EDGES
0.8889
vertical-level
adaboisecensusdowntowneagleidahonorthwestpopulation
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "census", "downtown", "eagle", "idaho", "northwest", "population". Score: 0.8889. Entity: vertical-level.
0.7500
vertical-level
accommodateboisecentercompleteddistrictdowntownentityeventexpansionflexiblegreatergroupsidaholargestmeetingoperatingspacesquare
KEYWORD OVERLAP (high): 18 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accommodate", "boise", "center", "completed", "district", "downtown", "entity", "event", "expansion", "flexible", "greater", "groups", "idaho", "largest", "meeting", "operating", "space", "square". Score: 0.7500. Entity: vertical-level.
0.7436
vertical-level
accessadditionalallocatedallowingaroundbrokerbrokeragebuildingbusinessbusinessescentercenterscentralchangecitiescommonlycomponentconventionalcostsdistrictsequipmentexecutivefacilityflexiblefoundgenerallyindividualindustrylargeleasesmanagementnoticeofficeofficesoperationsownerspeopleproviderprovidersprovidingreceptionrentrentalrequireresourcesservicedshareshortsizespacesuitestechnologytenantstermstypevirtualworkplaceworkspace
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "additional", "allocated", "allowing", "around", "broker", "brokerage", "building", "business", "businesses", "center", "centers", "central", "change", "cities", "commonly", "component", "conventional", "costs", "districts", "equipment", "executive", "facility", "flexible", "found", "generally", "individual", "industry", "large", "leases", "management", "notice", "office", "offices", "operations", "owners", "people", "provider", "providers", "providing", "reception", "rent", "rental", "require", "resources", "serviced", "share", "short", "size", "space", "suites", "technology", "tenants", "terms", "type", "virtual", "workplace", "workspace". Score: 0.7436. Entity: vertical-level.
0.7333
vertical-level
boisecaldwellcanyoncensusestimatedidaholargestmakingmetropolitannampapopulation
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "caldwell", "canyon", "census", "estimated", "idaho", "largest", "making", "metropolitan", "nampa", "population". Score: 0.7333. Entity: vertical-level.
0.7143
vertical-level
adaamongboisecapitalcensuscitiesidahomakingmeridianpopulation
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "among", "boise", "capital", "census", "cities", "idaho", "making", "meridian", "population". Score: 0.7143. Entity: vertical-level.
0.7018
vertical-level
announcedannualapproximatelycollierscommercialconsultingcorporatedevelopersdiversifiedemployeesestateexecutivefacilitiesfirmgroupheadquartersindustrialinternationalinvestmentinvestorsjunelandlordmanagementmixed-useofficeofficesorganizationownersplanningprofessionalprojectpropertyrealrepresentationresidentialretailsectorstenanturbanusers
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "announced", "annual", "approximately", "colliers", "commercial", "consulting", "corporate", "developers", "diversified", "employees", "estate", "executive", "facilities", "firm", "group", "headquarters", "industrial", "international", "investment", "investors", "june", "landlord", "management", "mixed-use", "office", "offices", "organization", "owners", "planning", "professional", "project", "property", "real", "representation", "residential", "retail", "sectors", "tenant", "urban", "users". Score: 0.7018. Entity: vertical-level.
0.6829
vertical-level
accountantsaccountingarchitectsartsbusinessbusinessesdevelopmenteducationengineersinvolvelicensesmanagementoccupationspractitionerprofessionalprovidingpublicrequirerequiringsectorsectorsskillsspecialspecificsupportsupportingtaxtraining
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accountants", "accounting", "architects", "arts", "business", "businesses", "development", "education", "engineers", "involve", "licenses", "management", "occupations", "practitioner", "professional", "providing", "public", "require", "requiring", "sector", "sectors", "skills", "special", "specific", "support", "supporting", "tax", "training". Score: 0.6829. Entity: vertical-level.
0.6809
vertical-level
buildingbuildingscleaningcommonlydefineselectricalfacilitiesfacilityfunctionalinternationalmaintenancemanagementmechanicalneededoccupantsoperationsorganizationplanningplumbingrequirementssectorsecuritysitesspacestandardssupportsystemsystemsterminologythemworkplaceworkplaces
KEYWORD OVERLAP (high): 32 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "building", "buildings", "cleaning", "commonly", "defines", "electrical", "facilities", "facility", "functional", "international", "maintenance", "management", "mechanical", "needed", "occupants", "operations", "organization", "planning", "plumbing", "requirements", "sector", "security", "sites", "space", "standards", "support", "system", "systems", "terminology", "them", "workplace", "workplaces". Score: 0.6809. Entity: vertical-level.
0.6667
vertical-level
adaadditionalboisecensusidahokunametropolitannearlypercentpopulation
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "additional", "boise", "census", "idaho", "kuna", "metropolitan", "nearly", "percent", "population". Score: 0.6667. Entity: vertical-level.
0.6338
vertical-level
activitiesallowedbroadcommunitycompatibilitycomprehensivecovercurrentdeterminesdevelopmentdocumententireestablishingfoundationgeneralgrowthhousingindividuallandlargelong-termneighborhoodparcelperiodplanplanningplanspoliciespolicyproductprovidepublicpurposesrecreationregionregionalregulatesserioustermstransportationtypicallyupdatesurbanutilitieszoning
KEYWORD OVERLAP (high): 45 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "allowed", "broad", "community", "compatibility", "comprehensive", "cover", "current", "determines", "development", "document", "entire", "establishing", "foundation", "general", "growth", "housing", "individual", "land", "large", "long-term", "neighborhood", "parcel", "period", "plan", "planning", "plans", "policies", "policy", "product", "provide", "public", "purposes", "recreation", "region", "regional", "regulates", "serious", "terms", "transportation", "typically", "updates", "urban", "utilities", "zoning". Score: 0.6338. Entity: vertical-level.
0.6250
vertical-level
accessbuildingbuildingsbusinesscostsdesignateddevelopmentslandmajornearofficeparksuburbantypestypically
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "building", "buildings", "business", "costs", "designated", "developments", "land", "major", "near", "office", "park", "suburban", "types", "typically". Score: 0.6250. Entity: vertical-level.
0.6222
vertical-level
citiescostdeskdifferentespeciallyestatehighhotmembermotivationmultipleofficeorganizationpersonalprimaryratherrealsavingssharedsharingshiftsspacespecificstaffsystemtableworkworkers
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "cities", "cost", "desk", "different", "especially", "estate", "high", "hot", "member", "motivation", "multiple", "office", "organization", "personal", "primary", "rather", "real", "savings", "shared", "sharing", "shifts", "space", "specific", "staff", "system", "table", "work", "workers". Score: 0.6222. Entity: vertical-level.
0.6176
vertical-level
academicassistanceassociationbusinessbusinessescapitalcombinationcorporatedefinesdevelopmentdiffereconomicentrepreneursfirmsfollowinggovernmentincubatorsindividualinstitutionsmanagementmembersnationalofficeorganizationparksprogramprogramsprojectspropertyprovidingregionalresearchsmallspacestartupstartupstechnologytooltrainingtypesuniversityventure
KEYWORD OVERLAP (high): 42 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "assistance", "association", "business", "businesses", "capital", "combination", "corporate", "defines", "development", "differ", "economic", "entrepreneurs", "firms", "following", "government", "incubators", "individual", "institutions", "management", "members", "national", "office", "organization", "parks", "program", "programs", "projects", "property", "providing", "regional", "research", "small", "space", "startup", "startups", "technology", "tool", "training", "types", "university", "venture". Score: 0.6176. Entity: vertical-level.
0.6154
vertical-level
allowedauthorizesdistrictlandordinancepermituseszoning
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "allowed", "authorizes", "district", "land", "ordinance", "permit", "uses", "zoning". Score: 0.6154. Entity: vertical-level.
0.6111
vertical-level
businessdevelopmentestateindustrialindustryofficeofficesparkplannedratherzoned
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "business", "development", "estate", "industrial", "industry", "office", "offices", "park", "planned", "rather", "zoned". Score: 0.6111. Entity: vertical-level.
0.5962
vertical-level
absorptionacquisitionactactivityanotherassetsbusinesscapitalcentralcombinecombinedcommissioncompetitioncompetitiveconsolidationcontrolcorporatecreatedepartmentdescribeddirecteconomicallyeffectsentitiesentityfederalgovernmentlawlegalmanagementmarketnoticeoccursoperatingoperationsorganizationownershipparticularlypositionpotentialprocessesproposedprovidingregulatoryrequirerequiresresemblereviewsharesinglesizestrategicstrategysubjectsubstantiallytermstradetransactiontransactionstypicallyunifiedunits
KEYWORD OVERLAP (high): 62 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "absorption", "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "combine", "combined", "commission", "competition", "competitive", "consolidation", "control", "corporate", "create", "department", "described", "direct", "economically", "effects", "entities", "entity", "federal", "government", "law", "legal", "management", "market", "notice", "occurs", "operating", "operations", "organization", "ownership", "particularly", "position", "potential", "processes", "proposed", "providing", "regulatory", "require", "requires", "resemble", "review", "share", "single", "size", "strategic", "strategy", "subject", "substantially", "terms", "trade", "transaction", "transactions", "typically", "unified", "units". Score: 0.5962. Entity: vertical-level.
0.5833
vertical-level
builtconstructioncoverenvironmentindustryinfrastructureinvolvedlaborpersonphysicalprojectrolesthoughtypically
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "built", "construction", "cover", "environment", "industry", "infrastructure", "involved", "labor", "person", "physical", "project", "roles", "though", "typically". Score: 0.5833. Entity: vertical-level.
0.5833
vertical-level
boisecensusgemidaholargestmetropolitanpopulation
KEYWORD OVERLAP (high): 7 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "boise", "census", "gem", "idaho", "largest", "metropolitan", "population". Score: 0.5833. Entity: vertical-level.
0.5789
vertical-level
approximatelyboisecaldwellcanyoncensuscollegeidaholocallymetropolitanpopulationwest
KEYWORD OVERLAP (high): 11 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "boise", "caldwell", "canyon", "census", "college", "idaho", "locally", "metropolitan", "population", "west". Score: 0.5789. Entity: vertical-level.
0.5739
vertical-level
adoptedappliedapprovedarchitectsauthoritybecomesbeganbuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndesignersdevelopersdistricteffectselectricalengineersenvironmentalestatefacilitygeneralgenerallyhealthinsuranceintendedinteriorinternationaljurisdictionjurisdictionallawlevellocalmainmanagersmaterialsmechanicalmodelnationalobtainoccupancyplanningplumbingprivateproductsprotectpublicpublishedpurposesrealregulatorsrequireresearchresidentialrulessafetystandardsstructurestenantsusawork
KEYWORD OVERLAP (high): 66 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "adopted", "applied", "approved", "architects", "authority", "becomes", "began", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "designers", "developers", "district", "effects", "electrical", "engineers", "environmental", "estate", "facility", "general", "generally", "health", "insurance", "intended", "interior", "international", "jurisdiction", "jurisdictional", "law", "level", "local", "main", "managers", "materials", "mechanical", "model", "national", "obtain", "occupancy", "planning", "plumbing", "private", "products", "protect", "public", "published", "purposes", "real", "regulators", "require", "research", "residential", "rules", "safety", "standards", "structures", "tenants", "usa", "work". Score: 0.5739. Entity: vertical-level.
0.5634
vertical-level
accordinganotherapprovedauthoritybuildingbuiltcertificatechangescodescommercialcomplianceconditionconstructiondepartmentdocumentevidencegenerallygovernmentindustrialjurisdictionlawlawslocaloccupancyoccupyordinancesownershippermitplansproposedproverequiredrequirementsresidentialspacestructuresubstantiallysuitabletypewhenever
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "another", "approved", "authority", "building", "built", "certificate", "changes", "codes", "commercial", "compliance", "condition", "construction", "department", "document", "evidence", "generally", "government", "industrial", "jurisdiction", "law", "laws", "local", "occupancy", "occupy", "ordinances", "ownership", "permit", "plans", "proposed", "prove", "required", "requirements", "residential", "space", "structure", "substantially", "suitable", "type", "whenever". Score: 0.5634. Entity: vertical-level.
0.5600
vertical-level
airbuildingbuildingsconditioningcontrolcoolingcostsdesigndesignedefficiencyelectricalenergyengineersenvironmentalevaluateheatingimpactmaintenancemechanicaloperatingparticularlyplumbingprojectsprovidequalitysystemstechnologytemperature
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "air", "building", "buildings", "conditioning", "control", "cooling", "costs", "design", "designed", "efficiency", "electrical", "energy", "engineers", "environmental", "evaluate", "heating", "impact", "maintenance", "mechanical", "operating", "particularly", "plumbing", "projects", "provide", "quality", "systems", "technology", "temperature". Score: 0.5600. Entity: vertical-level.
0.5472
vertical-level
arrangementarrangementsbasecommercialcommondependingestateexpensesgrossinsurancelandlordlawleaseleasesmaintenanceownershipparticularlypayingpropertyratherrealreal-estaterelatedrentresponsiblesingletenanttenantstypes
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "arrangement", "arrangements", "base", "commercial", "common", "depending", "estate", "expenses", "gross", "insurance", "landlord", "law", "lease", "leases", "maintenance", "ownership", "particularly", "paying", "property", "rather", "real", "real-estate", "related", "rent", "responsible", "single", "tenant", "tenants", "types". Score: 0.5472. Entity: vertical-level.
0.5400
vertical-level
activitybecomebusinesscenterscentralconcentrationcurrentdevelopeddistrictdistrictsdowntownedgeentertainmentestablishedformgrowthmajornearoutsidepreviouslyrepresentingresidentialsuburbantermstraditionalurbanworldwide
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activity", "become", "business", "centers", "central", "concentration", "current", "developed", "district", "districts", "downtown", "edge", "entertainment", "established", "form", "growth", "major", "near", "outside", "previously", "representing", "residential", "suburban", "terms", "traditional", "urban", "worldwide". Score: 0.5400. Entity: vertical-level.
0.5361
vertical-level
accessaccordingactivitiesadditionaladdressadministrativeaffectamenitiesapplicationsattractivebusinessbusinessescannotcapitalcloudcombinationconferencecostcreatecustomersdeskdigitalemployeeemployeesemployersentrepreneursenvironmentestablishevenexpensesfeeflexiblefreelancersimpactsindustrylargerleaseleasingledlong-termlongermaintainedmanagementmeetingmeetingsmembershipneedofficeofficesownedpartypermanentpersonalpersonnelphysicalplatformpoliciesprimaryprocessesprofessionalprojectproviderprovidersratherrecognizesremoterentalsresearchresourcesroomroomssatelliteservicedsmallsoftwarespacespecificstablesubscriptionsupporttechnologythemthirdtraditionaltrainingtransportationvirtualworkworkspace
KEYWORD OVERLAP (high): 89 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "according", "activities", "additional", "address", "administrative", "affect", "amenities", "applications", "attractive", "business", "businesses", "cannot", "capital", "cloud", "combination", "conference", "cost", "create", "customers", "desk", "digital", "employee", "employees", "employers", "entrepreneurs", "environment", "establish", "even", "expenses", "fee", "flexible", "freelancers", "impacts", "industry", "larger", "lease", "leasing", "led", "long-term", "longer", "maintained", "management", "meeting", "meetings", "membership", "need", "office", "offices", "owned", "party", "permanent", "personal", "personnel", "physical", "platform", "policies", "primary", "processes", "professional", "project", "provider", "providers", "rather", "recognizes", "remote", "rentals", "research", "resources", "room", "rooms", "satellite", "serviced", "small", "software", "space", "specific", "stable", "subscription", "support", "technology", "them", "third", "traditional", "training", "transportation", "virtual", "work", "workspace". Score: 0.5361. Entity: vertical-level.
0.5342
vertical-level
appliedarchitectsbuildingbuildingsbuiltcivilcomplexconceptsconstructioncontractorscreatecreativedesigndesignersdifferentempiricalengineeringengineersequipmentformglossaryinvolvedknowledgelawsmakingmaterialsmedicalphysicalprojectsresponsiblesafetysimplesitestrengthstructuralstructuressystemstraineduses
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "applied", "architects", "building", "buildings", "built", "civil", "complex", "concepts", "construction", "contractors", "create", "creative", "design", "designers", "different", "empirical", "engineering", "engineers", "equipment", "form", "glossary", "involved", "knowledge", "laws", "making", "materials", "medical", "physical", "projects", "responsible", "safety", "simple", "site", "strength", "structural", "structures", "systems", "trained", "uses". Score: 0.5342. Entity: vertical-level.
0.5278
vertical-level
apprenticeshipapproximatelyassociationcomputerconductconstructioncontractorscostdatadeliverelectricalelectriciansemployeesfieldsgovernmentibewindustryinsideinternationaljurisdictionslabormembersnationalnetworksprogramspublicrelatedrepresentstelecommunicationstradetrainedtrainingunionutilitiesvideovoiceworkworkers
KEYWORD OVERLAP (high): 38 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "apprenticeship", "approximately", "association", "computer", "conduct", "construction", "contractors", "cost", "data", "deliver", "electrical", "electricians", "employees", "fields", "government", "ibew", "industry", "inside", "international", "jurisdictions", "labor", "members", "national", "networks", "programs", "public", "related", "represents", "telecommunications", "trade", "trained", "training", "union", "utilities", "video", "voice", "work", "workers". Score: 0.5278. Entity: vertical-level.
0.5263
vertical-level
amongbuildingbuildingsbuiltconstructionconversioncostsdesignedexistingterms
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "among", "building", "buildings", "built", "construction", "conversion", "costs", "designed", "existing", "terms". Score: 0.5263. Entity: vertical-level.
0.5227
vertical-level
adaboisecensuscentercentralconnectedcontainsdespiteeasterngardenhistoricidahoitselfmetropolitannationalnearbypopulationrecreationsectionsouthwesternstarvalleywestern
KEYWORD OVERLAP (high): 23 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "census", "center", "central", "connected", "contains", "despite", "eastern", "garden", "historic", "idaho", "itself", "metropolitan", "national", "nearby", "population", "recreation", "section", "southwestern", "star", "valley", "western". Score: 0.5227. Entity: vertical-level.
0.5185
vertical-level
accessadministrationcloudcommonlydefineddemandforminternationalnetworkorganizationphysicalresourcessharedvirtual
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "administration", "cloud", "commonly", "defined", "demand", "form", "international", "network", "organization", "physical", "resources", "shared", "virtual". Score: 0.5185. Entity: vertical-level.
0.5172
vertical-level
adaboisecanyoncensusdistrictgrowingidahometropolitanneighboringpopulationrapidlyschoolssharedstarwest
KEYWORD OVERLAP (high): 15 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "boise", "canyon", "census", "district", "growing", "idaho", "metropolitan", "neighboring", "population", "rapidly", "schools", "shared", "star", "west". Score: 0.5172. Entity: vertical-level.
0.5143
vertical-level
academicbeganbroadercompletedependingdesigneddifferdirectlyeducationeducationalhighinstitutionjoblearningneededoccupationspreparationprepareprofessionalprovideprovidingratherrequiredschoolsshiftskillsspecificstudentstechnicaltowardtradetradestrainingtypetypicallyworkforce
KEYWORD OVERLAP (high): 36 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "academic", "began", "broader", "complete", "depending", "designed", "differ", "directly", "education", "educational", "high", "institution", "job", "learning", "needed", "occupations", "preparation", "prepare", "professional", "provide", "providing", "rather", "required", "schools", "shift", "skills", "specific", "students", "technical", "toward", "trade", "trades", "training", "type", "typically", "workforce". Score: 0.5143. Entity: vertical-level.
0.5065
vertical-level
activebusinesscapitalcategorychangescontroldescribeddevelopmententerpriseevaluationsexpansionfinancefirmfirmsgeneralinsteadinvestmentinvestmentslimitedlong-termmanagementoperationalownershippartnershipspreferencesprivateprivate-equityproductproductsprovidepublicratherrestructuringroleshiftsspecializedspecificstrategyventure
KEYWORD OVERLAP (high): 39 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "business", "capital", "category", "changes", "control", "described", "development", "enterprise", "evaluations", "expansion", "finance", "firm", "firms", "general", "instead", "investment", "investments", "limited", "long-term", "management", "operational", "ownership", "partnerships", "preferences", "private", "private-equity", "product", "products", "provide", "public", "rather", "restructuring", "role", "shifts", "specialized", "specific", "strategy", "venture". Score: 0.5065. Entity: vertical-level.
0.5000
vertical-level
agreementbuildingestatefeefixedformlandlandlordlawleaselegalletmarketmonthlyoccupyopenownershippartyperiodpersonalpropertypurchasedrealremainrentingresidentialrightssimpletenanttenureterminologytermstitletypestypically
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agreement", "building", "estate", "fee", "fixed", "form", "land", "landlord", "law", "lease", "legal", "let", "market", "monthly", "occupy", "open", "ownership", "party", "period", "personal", "property", "purchased", "real", "remain", "renting", "residential", "rights", "simple", "tenant", "tenure", "terminology", "terms", "title", "types", "typically". Score: 0.5000. Entity: vertical-level.
0.4965
vertical-level
additionaladoptadoptionbecomecommoncommonlycompatibleconsumerconsumerscostcostscustomerdemanddependsdescribedifferentdirectdueeconomicseconomyeffectsevenexistingfeedbackfunctiongroupgroupsgrowthhardwareincreaseincreasesincreasingindirectinformationitselflinkedinloopmarketmarketsmotivationmultiplenetworknetworkingparticipationparticularlypeoplepositivepotentialproductproductionproductsratherreachingrelatedscaleseparatesocialsoftwaresystemstechnologytelecommunicationstelephonetotaltraditionaltypicallyunitsuserusersutilityvalue
KEYWORD OVERLAP (high): 70 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "additional", "adopt", "adoption", "become", "common", "commonly", "compatible", "consumer", "consumers", "cost", "costs", "customer", "demand", "depends", "describe", "different", "direct", "due", "economics", "economy", "effects", "even", "existing", "feedback", "function", "group", "groups", "growth", "hardware", "increase", "increases", "increasing", "indirect", "information", "itself", "linkedin", "loop", "market", "markets", "motivation", "multiple", "network", "networking", "participation", "particularly", "people", "positive", "potential", "product", "production", "products", "rather", "reaching", "related", "scale", "separate", "social", "software", "systems", "technology", "telecommunications", "telephone", "total", "traditional", "typically", "units", "user", "users", "utility", "value". Score: 0.4965. Entity: vertical-level.
0.4861
vertical-level
approvalbuildingcannotcodecodescompletioncomplianceconstructiondevelopmenteconomyemploymentexpansionfurnishingsgenerallygovernmentgovernmentshigh-densityjurisdictionslawlocalmeetnationalneededobtainpermitpermitsplanplanningplansprocessesregionalrequiredsignificantsubjecturban
KEYWORD OVERLAP (high): 35 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approval", "building", "cannot", "code", "codes", "completion", "compliance", "construction", "development", "economy", "employment", "expansion", "furnishings", "generally", "government", "governments", "high-density", "jurisdictions", "law", "local", "meet", "national", "needed", "obtain", "permit", "permits", "plan", "planning", "plans", "processes", "regional", "required", "significant", "subject", "urban". Score: 0.4861. Entity: vertical-level.
0.4819
vertical-level
careercollegecommunitycontextsdefineddependingdesignedeconomiceducationeducationalformalformsgeneralhigherindividualinstitutionknowledgelearninglevelmethodsnamesoccupationspersonplaceprepareprovidepurposesrelatedschoolssectorsskillssocialspecializedspecifictechnicaltechnologytradetrainingtypeunderlying
KEYWORD OVERLAP (high): 40 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "career", "college", "community", "contexts", "defined", "depending", "designed", "economic", "education", "educational", "formal", "forms", "general", "higher", "individual", "institution", "knowledge", "learning", "level", "methods", "names", "occupations", "person", "place", "prepare", "provide", "purposes", "related", "schools", "sectors", "skills", "social", "specialized", "specific", "technical", "technology", "trade", "training", "type", "underlying". Score: 0.4819. Entity: vertical-level.
0.4762
vertical-level
commercialexpensesgrosslandlordleaseoperatingownershiprentaltenanttype
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "commercial", "expenses", "gross", "landlord", "lease", "operating", "ownership", "rental", "tenant", "type". Score: 0.4762. Entity: vertical-level.
0.4737
vertical-level
annualanotherassumeattractivebecomebusinessbuyercapitalcompleteconductconsequentlycontroldebtdecisionsdevelopmentemployeesentityentrepreneurseventeventualexitfacefinancefirmsformgeneratinggrowthhighhistoryinformationinitialinstitutionalinvestmentinvestmentsinvestorslimitedmarketmarketingmarketsmodeloccuroperatingoperationsownedownershippotentialprivateprivate-equityprovidepublicratesreachedreportedresearchreturnrevenueriskscalesellingsignificantsmallsmallerstartupstartupsstrategicsupporttechnologytermstotaltypicallyvalueventure
KEYWORD OVERLAP (high): 72 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "annual", "another", "assume", "attractive", "become", "business", "buyer", "capital", "complete", "conduct", "consequently", "control", "debt", "decisions", "development", "employees", "entity", "entrepreneurs", "event", "eventual", "exit", "face", "finance", "firms", "form", "generating", "growth", "high", "history", "information", "initial", "institutional", "investment", "investments", "investors", "limited", "market", "marketing", "markets", "model", "occur", "operating", "operations", "owned", "ownership", "potential", "private", "private-equity", "provide", "public", "rates", "reached", "reported", "research", "return", "revenue", "risk", "scale", "selling", "significant", "small", "smaller", "startup", "startups", "strategic", "support", "technology", "terms", "total", "typically", "value", "venture". Score: 0.4737. Entity: vertical-level.
0.4722
vertical-level
accordingboisecanyoncensuscollegeidahointerstatemeridianmetropolitannampanazarenenorthwestpopulationprincipaluniversitywestwestern
KEYWORD OVERLAP (high): 17 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "boise", "canyon", "census", "college", "idaho", "interstate", "meridian", "metropolitan", "nampa", "nazarene", "northwest", "population", "principal", "university", "west", "western". Score: 0.4722. Entity: vertical-level.
0.4685
vertical-level
actaddingadjacentallowinganotherauthoritybodyboundariesbuildingchangeclassclubcommercialcommissioncommunitycompatibleconsistentcontrolcouncilcreatingcurrentdistrictdistrictsexceptionsexercisegeneralgovernmenthistoricindustrialinsteadlandlargerlayerlimitedlocalmaintainmunicipalityoccurordinanceownerownersparcelplaceplanpropertyprotectprovidepublicpurposesratherregulatesregulationresidentialrightsruleseparatesizesmallspecialspecificstoresystemthroughouttreatmentuseszonedzoning
KEYWORD OVERLAP (high): 67 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "adding", "adjacent", "allowing", "another", "authority", "body", "boundaries", "building", "change", "class", "club", "commercial", "commission", "community", "compatible", "consistent", "control", "council", "creating", "current", "district", "districts", "exceptions", "exercise", "general", "government", "historic", "industrial", "instead", "land", "larger", "layer", "limited", "local", "maintain", "municipality", "occur", "ordinance", "owner", "owners", "parcel", "place", "plan", "property", "protect", "provide", "public", "purposes", "rather", "regulates", "regulation", "residential", "rights", "rule", "separate", "size", "small", "special", "specific", "store", "system", "throughout", "treatment", "uses", "zoned", "zoning". Score: 0.4685. Entity: vertical-level.
0.4681
vertical-level
allowedarchitectsarchitecturalarchitecturearoundbuildingbuildingsconstructiondesignenvironmentindustrialindustrylabormodernproductionresourcessafetysectorstructurestypeuseswork
KEYWORD OVERLAP (high): 22 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "allowed", "architects", "architectural", "architecture", "around", "building", "buildings", "construction", "design", "environment", "industrial", "industry", "labor", "modern", "production", "resources", "safety", "sector", "structures", "type", "uses", "work". Score: 0.4681. Entity: vertical-level.
0.4679
vertical-level
activitiesactivitybeyondbusinesscollaborationconnectcostcreatecultureday-to-daydesigneddigitalenvironmentsformalframeworkfullimpactsincreasinginteractionslevelmeetingsneedofficeopportunitiesorganizationorganizationalorganizationspeoplepersonpersonalphysicalplatformspotentialrangingrecognizesreducingsavingsspacespacesstrategicstrategysupportsupportedteamteamstechnologythereforetrafficultimateworkworkplace
KEYWORD OVERLAP (high): 51 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "activity", "beyond", "business", "collaboration", "connect", "cost", "create", "culture", "day-to-day", "designed", "digital", "environments", "formal", "framework", "full", "impacts", "increasing", "interactions", "level", "meetings", "need", "office", "opportunities", "organization", "organizational", "organizations", "people", "person", "personal", "physical", "platforms", "potential", "ranging", "recognizes", "reducing", "savings", "space", "spaces", "strategic", "strategy", "support", "supported", "team", "teams", "technology", "therefore", "traffic", "ultimate", "work", "workplace". Score: 0.4679. Entity: vertical-level.
0.4667
vertical-level
adaannualartboisecapitalcensuscountiesdowntownemployersestimatedidaholevellocallymajormetropolitanpopulationsectorssouthwesterntechnologytreasurevalley
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "annual", "art", "boise", "capital", "census", "counties", "downtown", "employers", "estimated", "idaho", "level", "locally", "major", "metropolitan", "population", "sectors", "southwestern", "technology", "treasure", "valley". Score: 0.4667. Entity: vertical-level.
0.4630
vertical-level
accessibilityaccessibleaddressesassociatedbuildingscommoncreatecreatingcurbcutsdesigndifferentenvironmentsknowledgemeasuremechanismsparticipationpeoplepracticalproductspurposesrelevantstrategythemuniversal
KEYWORD OVERLAP (high): 25 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accessibility", "accessible", "addresses", "associated", "buildings", "common", "create", "creating", "curb", "cuts", "design", "different", "environments", "knowledge", "measure", "mechanisms", "participation", "people", "practical", "products", "purposes", "relevant", "strategy", "them", "universal". Score: 0.4630. Entity: vertical-level.
0.4595
vertical-level
agreementamongarrangementcentercommercialcontrolespeciallyestateexpensesfeesfitfootagegrosshigherinsurancelandlordleaseleasesmaintenanceoperationsownerpropertiespropertyrealrentrequiresshortsizesquaretenanttenantstypicallyutilitieswritten
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agreement", "among", "arrangement", "center", "commercial", "control", "especially", "estate", "expenses", "fees", "fit", "footage", "gross", "higher", "insurance", "landlord", "lease", "leases", "maintenance", "operations", "owner", "properties", "property", "real", "rent", "requires", "short", "size", "square", "tenant", "tenants", "typically", "utilities", "written". Score: 0.4595. Entity: vertical-level.
0.4579
vertical-level
accessibilityaccountactivitiesadministrationadoptedairanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescivilcodescommunicationscommunitiescommunitycontextscontributecreatingculturedesigndevelopmentdifferenteconomiceffectsefficiencyengineeringenvironmentenvironmentalenvironmentsexistingfieldsgeographygovernmentsgrowthhealthimplementationimproveindependentinfluencedinfrastructureinvolvelandland-usemaintainmanagementmembersnaturalneighborhoodsnetworksopportunityorderlyparkspeoplephysicalplanplanningplanspolicypractitionersprimaryprocessesprofessionalprojectsprotectionprovidepublicrecommendationsrelatedrenewalrequiresresearchresourcesresponsiblescienceseparatesignificancesocialspacesstandardsstrategicstreetsstructuressuburbanteamstechnicalthoughtooltransportationurbanwasteworkzoning
KEYWORD OVERLAP (high): 98 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accessibility", "account", "activities", "administration", "adopted", "air", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "civil", "codes", "communications", "communities", "community", "contexts", "contribute", "creating", "culture", "design", "development", "different", "economic", "effects", "efficiency", "engineering", "environment", "environmental", "environments", "existing", "fields", "geography", "governments", "growth", "health", "implementation", "improve", "independent", "influenced", "infrastructure", "involve", "land", "land-use", "maintain", "management", "members", "natural", "neighborhoods", "networks", "opportunity", "orderly", "parks", "people", "physical", "plan", "planning", "plans", "policy", "practitioners", "primary", "processes", "professional", "projects", "protection", "provide", "public", "recommendations", "related", "renewal", "requires", "research", "resources", "responsible", "science", "separate", "significance", "social", "spaces", "standards", "strategic", "streets", "structures", "suburban", "teams", "technical", "though", "tool", "transportation", "urban", "waste", "work", "zoning". Score: 0.4579. Entity: vertical-level.
0.4571
vertical-level
businessescloudcommonlyconsumerdevelopmentdigitalenergygloballylargestproductsresearchsoftwaresupporttechnologythemvalley
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "businesses", "cloud", "commonly", "consumer", "development", "digital", "energy", "globally", "largest", "products", "research", "software", "support", "technology", "them", "valley". Score: 0.4571. Entity: vertical-level.
0.4483
vertical-level
additionaladdressanotherauthoritieschangeclasscommonlycustomersdomesticgenerallyhybridinternationalmailmanagementofficeofficesperiodpostalprivateprovidersstandardizedthirdtypicallyunionuniversalvirtual
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "additional", "address", "another", "authorities", "change", "class", "commonly", "customers", "domestic", "generally", "hybrid", "international", "mail", "management", "office", "offices", "period", "postal", "private", "providers", "standardized", "third", "typically", "union", "universal", "virtual". Score: 0.4483. Entity: vertical-level.
0.4472
vertical-level
actuallyarrangingbodybrandbudgetingbuildingbusinesscareerchangingclientcorporatecreativedesigndevelopmentdifferentdueemergencyenvironmenteventeventsformalgroupsidentifyingindustryinvolvedknowledgelabelmanagementmanagermarketmarketingmeetingsorganizationsparkingpermitspersonpersonalplanningplansproductionprojectpublicrapidlyrelationshipsrequiredresponsibilitysecurityselectionsitesmallstrategytechnicalthird-partytransportationtype
KEYWORD OVERLAP (high): 55 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "actually", "arranging", "body", "brand", "budgeting", "building", "business", "career", "changing", "client", "corporate", "creative", "design", "development", "different", "due", "emergency", "environment", "event", "events", "formal", "groups", "identifying", "industry", "involved", "knowledge", "label", "management", "manager", "market", "marketing", "meetings", "organizations", "parking", "permits", "person", "personal", "planning", "plans", "production", "project", "public", "rapidly", "relationships", "required", "responsibility", "security", "selection", "site", "small", "strategy", "technical", "third-party", "transportation", "type". Score: 0.4472. Entity: vertical-level.
0.4468
vertical-level
activitiesawaybusinessdefinesdefinitionsdespiteenvironmentexhibitionsgovernmentlimitedmeetingsorganizationorganizationsoutsidepeopleplacesprimarypurposessimilartravelworkplace
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "away", "business", "defines", "definitions", "despite", "environment", "exhibitions", "government", "limited", "meetings", "organization", "organizations", "outside", "people", "places", "primary", "purposes", "similar", "travel", "workplace". Score: 0.4468. Entity: vertical-level.
0.4444
vertical-level
accountingexpensesfinancefirmincomemeasureoperatingtax
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accounting", "expenses", "finance", "firm", "income", "measure", "operating", "tax". Score: 0.4444. Entity: vertical-level.
0.4444
vertical-level
associatedbehindboisecensuscentercontainshalfidaholargestmetropolitanowyheepopulationrecognizedslightlysouthwesternvalley
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "associated", "behind", "boise", "census", "center", "contains", "half", "idaho", "largest", "metropolitan", "owyhee", "population", "recognized", "slightly", "southwestern", "valley". Score: 0.4444. Entity: vertical-level.
0.4419
vertical-level
activealonebuildingbuildingscommercialconnecteddesignedfiregenerallylargemillionprotectprotectionprovidingsmallsprinklerssystemsystemsworldwide
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "active", "alone", "building", "buildings", "commercial", "connected", "designed", "fire", "generally", "large", "million", "protect", "protection", "providing", "small", "sprinklers", "system", "systems", "worldwide". Score: 0.4419. Entity: vertical-level.
0.4414
vertical-level
additionalavoidbusinesscapacitycapitalchangingcommoncontrolcostcostsdesigndivisiondueeconomicenergyengineeringenterpriseentireequipmentevenexceedingfacilitieshigherincreaseincreasedincreasesindustrialindustrylaborlargelargerlimitlimitslowmarketmaterialmaterialsnearbyobtainobtainedoccurolderoperationorganizationalphysicalproductproductionproductsrateregionalrelatedremainscalesmallerstatisticaltechnicalthereforethoughtotaltransportationtreatedtypicallyunitutilization
KEYWORD OVERLAP (high): 64 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "additional", "avoid", "business", "capacity", "capital", "changing", "common", "control", "cost", "costs", "design", "division", "due", "economic", "energy", "engineering", "enterprise", "entire", "equipment", "even", "exceeding", "facilities", "higher", "increase", "increased", "increases", "industrial", "industry", "labor", "large", "larger", "limit", "limits", "low", "market", "material", "materials", "nearby", "obtain", "obtained", "occur", "older", "operation", "organizational", "physical", "product", "production", "products", "rate", "regional", "related", "remain", "scale", "smaller", "statistical", "technical", "therefore", "though", "total", "transportation", "treated", "typically", "unit", "utilization". Score: 0.4414. Entity: vertical-level.
0.4394
vertical-level
accessaroundbuildingcampuscommonlycomputerconnectedconsumersformgiveshotelsinternetlaboratorylimitedlinkslocalmovenetworknetworksofficeprovideremainshopssmallstandardsthemuserswi-fiwireless
KEYWORD OVERLAP (high): 29 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "around", "building", "campus", "commonly", "computer", "connected", "consumers", "form", "gives", "hotels", "internet", "laboratory", "limited", "links", "local", "move", "network", "networks", "office", "provide", "remain", "shops", "small", "standards", "them", "users", "wi-fi", "wireless". Score: 0.4394. Entity: vertical-level.
0.4314
vertical-level
accordingbroadbudgetsbuildingbuildingscodescommercialcommoncomponentconstructioncostdesigndesigneddirectlydocumentationelectricalengineeringengineersequipmentfacilitiesfunctionalhotimpactsinfluencemechanicaloccupantsoperatingplanningplumbingprojectprovideregulatoryremainresearchresidentialroleselectselectionsimplyspacespecializedsystemsystemsteam
KEYWORD OVERLAP (high): 44 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "broad", "budgets", "building", "buildings", "codes", "commercial", "common", "component", "construction", "cost", "design", "designed", "directly", "documentation", "electrical", "engineering", "engineers", "equipment", "facilities", "functional", "hot", "impacts", "influence", "mechanical", "occupants", "operating", "planning", "plumbing", "project", "provide", "regulatory", "remain", "research", "residential", "role", "select", "selection", "simply", "space", "specialized", "system", "systems", "team". Score: 0.4314. Entity: vertical-level.
0.4304
vertical-level
aroundbuildingbusinesscentercentraldedicateddensedesigneddevelopmentdistanceformgrowthhigh-densityincreaselandmilemixed-usenetworkplanningprivateproblempublicreducingrelationshipresidentialscaleservingsmallerspacesustainabletypetypicallyurbanwalkable
KEYWORD OVERLAP (high): 34 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "around", "building", "business", "center", "central", "dedicated", "dense", "designed", "development", "distance", "form", "growth", "high-density", "increase", "land", "mile", "mixed-use", "network", "planning", "private", "problem", "public", "reducing", "relationship", "residential", "scale", "serving", "smaller", "space", "sustainable", "type", "typically", "urban", "walkable". Score: 0.4304. Entity: vertical-level.
0.4286
vertical-level
accessaccordingadditionalaffectaroundbasecommunitiesconditionscontributecostsdecisionsdeliverdevelopmenteconomiceconomyestablishedfacilitiesfieldsgeneralhealthhealthcarehistoryimprovementincomeinfluencedinformationinsurancelimitationslowmaintenancemeansmechanismmedicalmeetoccupationalorganizationorganizationspeoplepersonalphysicalpoliciespopulationsprimaryprofessionalsprovidersprovidingpublicqualityratesreliablerequiressignificantsocialsystemsystemstermstherapytrainingtransportationtreatmentworkworkforceworldwide
KEYWORD OVERLAP (high): 63 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "access", "according", "additional", "affect", "around", "base", "communities", "conditions", "contribute", "costs", "decisions", "deliver", "development", "economic", "economy", "established", "facilities", "fields", "general", "health", "healthcare", "history", "improvement", "income", "influenced", "information", "insurance", "limitations", "low", "maintenance", "means", "mechanism", "medical", "meet", "occupational", "organization", "organizations", "people", "personal", "physical", "policies", "populations", "primary", "professionals", "providers", "providing", "public", "quality", "rates", "reliable", "requires", "significant", "social", "system", "systems", "terms", "therapy", "training", "transportation", "treatment", "work", "workforce", "worldwide". Score: 0.4286. Entity: vertical-level.
0.4286
vertical-level
actbusinesscompetitivecomponentscorporatecovereducationaleventgenerallyincubatorslargermentorshipopenorganizationprogramsprovidepublicspecificstartupstartupstraditional
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "act", "business", "competitive", "components", "corporate", "cover", "educational", "event", "generally", "incubators", "larger", "mentorship", "open", "organization", "programs", "provide", "public", "specific", "startup", "startups", "traditional". Score: 0.4286. Entity: vertical-level.
0.4231
vertical-level
activitiesaddadvertisingarchitectureartartsbecomecreativedefinitionsdependdesigndevelopmentdifferenteconomiceconomyeducationespeciallyincreasinglyindustryinformationinnovationknowledgeprivateprotectionpublicradioresourcesectorsectorssoftwarethereforeultimatevideo
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "activities", "add", "advertising", "architecture", "art", "arts", "become", "creative", "definitions", "depend", "design", "development", "different", "economic", "economy", "education", "especially", "increasingly", "industry", "information", "innovation", "knowledge", "private", "protection", "public", "radio", "resource", "sector", "sectors", "software", "therefore", "ultimate", "video". Score: 0.4231. Entity: vertical-level.
0.4222
vertical-level
addedadjacentairbeganbuiltcentercenterscommercialcommoncomplexconcentrationcovereddepartmentdifferentdistinctiondowntowneasternentertainmentespeciallyevenexceptionsexperientialfactoryfeaturesformatsgenericgrouphighlargelargerledlifestylemarketplacesmarketsnearneighborhoodopenownersparkingparksplazapowerpropertiespublicratherregionretailroofshopssmallerspacesspecializedstreetstreetstenantstypetypes
KEYWORD OVERLAP (high): 57 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "added", "adjacent", "air", "began", "built", "center", "centers", "commercial", "common", "complex", "concentration", "covered", "department", "different", "distinction", "downtown", "eastern", "entertainment", "especially", "even", "exceptions", "experiential", "factory", "features", "formats", "generic", "group", "high", "large", "larger", "led", "lifestyle", "marketplaces", "markets", "near", "neighborhood", "open", "owners", "parking", "parks", "plaza", "power", "properties", "public", "rather", "region", "retail", "roof", "shops", "smaller", "spaces", "specialized", "street", "streets", "tenants", "type", "types". Score: 0.4222. Entity: vertical-level.
0.4200
vertical-level
accommodatebuildingcentercenterscommonconferencedesignedfloorgroupshotelslargemajormeetingpromoteroomssharesufficientsuitabletradetypicallyvenues
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "accommodate", "building", "center", "centers", "common", "conference", "designed", "floor", "groups", "hotels", "large", "major", "meeting", "promote", "rooms", "share", "sufficient", "suitable", "trade", "typically", "venues". Score: 0.4200. Entity: vertical-level.
0.4127
vertical-level
avoidedbroaderbusinesscompetitivecontextcorecorporateculturedecisionsdifferentiatedistinctemployeeemployeesidentitymanagementmanagersnationalorganizationorganizationalorganizationspeoplerelatedsharedstrategicunitsworkforce
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "avoided", "broader", "business", "competitive", "context", "core", "corporate", "culture", "decisions", "differentiate", "distinct", "employee", "employees", "identity", "management", "managers", "national", "organization", "organizational", "organizations", "people", "related", "shared", "strategic", "units", "workforce". Score: 0.4127. Entity: vertical-level.
0.4118
vertical-level
beyondbusinessbusinessesentrepreneurshipfacegrowinggrowthhighinfluencelargemodelpotentialprivateprojectpublicrapidratessignificantstartupstartupstypically
KEYWORD OVERLAP (high): 21 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "beyond", "business", "businesses", "entrepreneurship", "face", "growing", "growth", "high", "influence", "large", "model", "potential", "private", "project", "public", "rapid", "rates", "significant", "startup", "startups", "typically". Score: 0.4118. Entity: vertical-level.
0.4074
vertical-level
adaairbaseboisecentercombinedcommercialcommissiondepartmentdowntownfacilityfallsfirefunctionsgeneralguardidahoincreaseinternationallandingmillionnationaloperatedoperatesprotectionreceiverequiringrightsservicedsouthsupportuseswestern
KEYWORD OVERLAP (high): 33 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "ada", "air", "base", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "facility", "falls", "fire", "functions", "general", "guard", "idaho", "increase", "international", "landing", "million", "national", "operated", "operates", "protection", "receive", "requiring", "rights", "serviced", "south", "support", "uses", "western". Score: 0.4074. Entity: vertical-level.
0.3946
vertical-level
associatedbecomebuildingcitiescommercialconstitutescorecostsdefineddensedensitydescribeddevelopmentdueenvironmentenvironmentalexistingexpansionformgeneratinggeographicgrowthhigherhousingincreasedindustrialinfrastructurejobslandlargemeasuremodernnearbypeopleplanningpopulationprivatepropertyprotectionrapidratesrequireresidentialrevenuesalessimilarsocialspecialsuburbansupporttaxtransportationtravelunitsurbanuseswallszoning
KEYWORD OVERLAP (high): 58 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "associated", "become", "building", "cities", "commercial", "constitutes", "core", "costs", "defined", "dense", "density", "described", "development", "due", "environment", "environmental", "existing", "expansion", "form", "generating", "geographic", "growth", "higher", "housing", "increased", "industrial", "infrastructure", "jobs", "land", "large", "measure", "modern", "nearby", "people", "planning", "population", "private", "property", "protection", "rapid", "rates", "require", "residential", "revenue", "sales", "similar", "social", "special", "suburban", "support", "tax", "transportation", "travel", "units", "urban", "uses", "walls", "zoning". Score: 0.3946. Entity: vertical-level.
0.3857
vertical-level
backupbuildingcentralcombineddesigneddirectdooremergencyentryexitexitsfirefreemaintainedmeansopenoperationsoutsidepathpathwaypeoplepowerprovidesignagesignsspecialstructure
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "backup", "building", "central", "combined", "designed", "direct", "door", "emergency", "entry", "exit", "exits", "fire", "free", "maintained", "means", "open", "operations", "outside", "path", "pathway", "people", "power", "provide", "signage", "signs", "special", "structure". Score: 0.3857. Entity: vertical-level.
0.3654
vertical-level
anotherdistanceelectricalformhighinformationinternetlocalnetworksplaceproductreachedrecordrequiredtelecommunicationstelephonetypevideovoice
KEYWORD OVERLAP (high): 19 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "another", "distance", "electrical", "form", "high", "information", "internet", "local", "networks", "place", "product", "reached", "record", "required", "telecommunications", "telephone", "type", "video", "voice". Score: 0.3654. Entity: vertical-level.
0.3562
vertical-level
approximatelybanksbuildingcenterclosingcommercialcomplexdiligenceduegenerallyindustrialinsurancejunematuritymeetofficeownerpropertyratereportsreviewschedulesubjecttermsthird-partytypically
KEYWORD OVERLAP (high): 26 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "approximately", "banks", "building", "center", "closing", "commercial", "complex", "diligence", "due", "generally", "industrial", "insurance", "june", "maturity", "meet", "office", "owner", "property", "rate", "reports", "review", "schedule", "subject", "terms", "third-party", "typically". Score: 0.3562. Entity: vertical-level.
0.3554
vertical-level
addressarchitectureassociatedbuildingcommunityconceptscontainingcontemporarycreatingdesigndevelopmentdevelopmentsestatefacilitieshistorichousingincreaseinfluencedinfrastructureintelligentjobjobslandland-usemunicipalneighborhoodopenplanningpopulationrealreduceregionalspacestreetssuburbansupportsustainabletraditionaltraffictypesuntilurbanwalkable
KEYWORD OVERLAP (high): 43 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "address", "architecture", "associated", "building", "community", "concepts", "containing", "contemporary", "creating", "design", "development", "developments", "estate", "facilities", "historic", "housing", "increase", "influenced", "infrastructure", "intelligent", "job", "jobs", "land", "land-use", "municipal", "neighborhood", "open", "planning", "population", "real", "reduce", "regional", "space", "streets", "suburban", "support", "sustainable", "traditional", "traffic", "types", "until", "urban", "walkable". Score: 0.3554. Entity: vertical-level.
0.3333
vertical-level
becomeespeciallyhealthinterfaceintersectionpersonalprivateresearchworkworkers
KEYWORD OVERLAP (high): 10 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "become", "especially", "health", "interface", "intersection", "personal", "private", "research", "work", "workers". Score: 0.3333. Entity: vertical-level.
0.3294
vertical-level
analysiscleaningcommercialcostcostsdefinitiondefinitionsdependingdependsdevelopeddevelopersdevelopmentdifferentincreaseindustriallandmainpolicypreviouslypurposesrequirerequiresrisksitsitesitesspecializedstudy
KEYWORD OVERLAP (high): 28 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "analysis", "cleaning", "commercial", "cost", "costs", "definition", "definitions", "depending", "depends", "developed", "developers", "development", "different", "increase", "industrial", "land", "main", "policy", "previously", "purposes", "require", "requires", "risk", "sit", "site", "sites", "specialized", "study". Score: 0.3294. Entity: vertical-level.
0.2967
vertical-level
apprenticeshipbuildingbuildingscommoncompetenceconstructiondesigndoorexperienceformalfurniturejobmaterialsmillionnaturalplacesprimaryprogramsouthstructuralstructuretesttradetradestraininguntilwork
KEYWORD OVERLAP (high): 27 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "apprenticeship", "building", "buildings", "common", "competence", "construction", "design", "door", "experience", "formal", "furniture", "job", "materials", "million", "natural", "places", "primary", "program", "south", "structural", "structure", "test", "trade", "trades", "training", "until", "work". Score: 0.2967. Entity: vertical-level.
0.2800
vertical-level
civicenvironmentsgreatparksplaceplacespublicseparatesocialspacespacestheatersthirdworkplace
KEYWORD OVERLAP (high): 14 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "civic", "environments", "great", "parks", "place", "places", "public", "separate", "social", "space", "spaces", "theaters", "third", "workplace". Score: 0.2800. Entity: vertical-level.
0.2667
vertical-level
clinicscomprehensivecontinuingfacilitieshealthhealthcareidahonetworkoperatesoperatingoutpatientpeopleseniorsouthsupportsystem
KEYWORD OVERLAP (high): 16 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "clinics", "comprehensive", "continuing", "facilities", "health", "healthcare", "idaho", "network", "operates", "operating", "outpatient", "people", "senior", "south", "support", "system". Score: 0.2667. Entity: vertical-level.
0.2564
vertical-level
accordingappliedappliesartbecomecombinationcommonlyconcernsconnectionscontemporarycultureformshealthinfectionknowledgelevellocalmaintainmedicalmodernoutsideremainresearchsafetysciencetechnologytraditionaltreattreatmenttypically
KEYWORD OVERLAP (high): 30 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "according", "applied", "applies", "art", "become", "combination", "commonly", "concerns", "connections", "contemporary", "culture", "forms", "health", "infection", "knowledge", "level", "local", "maintain", "medical", "modern", "outside", "remain", "research", "safety", "science", "technology", "traditional", "treat", "treatment", "typically". Score: 0.2564. Entity: vertical-level.
0.2500
vertical-level
agriculturalapproximatelyboiseidahosouthwesternsquareurbanwestern
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agricultural", "approximately", "boise", "idaho", "southwestern", "square", "urban", "western". Score: 0.2500. Entity: vertical-level.
0.2424
vertical-level
agriculturalcitiesidaholandlargestmajornorthwestsouthern
KEYWORD OVERLAP (high): 8 significant tokens shared between Wikipedia article and research markdown (corpus-noise filtered). Tokens: "agricultural", "cities", "idaho", "land", "largest", "major", "northwest", "southern". Score: 0.2424. Entity: vertical-level.
Provenance
Coworking Commercial Space refinery-treasurevalley-v1.0.0 86,597 chars · 0 entities · 0 sections 152 articles · 152 edges 55403b845f15381b