—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Transportation Infrastructure ↔ relates to ↔ Government Civic

33 Wikipedia bridge articles confirmed in both vertical ledgers. 215 deterministic cross-vertical edges. 5,688 external source links harvested. Every edge provenance-stamped. Every claim auditable.

33 QID Bridge Articles
215 Cross Edges
5,688 External Sources
258 Wikipedia Articles
38 🌲 Evergreen
136 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Transportation Infrastructure
× Government Civic
QID Bridge Articles
33
confirmed Wikipedia overlap
Total Cross Edges
215
External Sources Harvested
5,688
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Road
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (20)
RoadIdahoSuburbanizationMetropolitan planning organizationTreasure ValleyApprenticeshipFederal Transit AdministrationPublic worksPublic transportBoise State UniversityBoise AirportBridgeCollege of Western IdahoFederal Highway AdministrationTransportation planningMunicipal corporationMeridian, IdahoUrban sprawlNampa, IdahoBus rapid transit
Shared Semantics (20 tokens)
idahoboisepopulationpublicmetropolitanlocaltransportationadamilesgovernmentprimarilyprivateurbancapitalcitiesprogramscanyondesignroadsriver
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:40:49 UTC
Content Hash
25e3300753808dd3
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
33 BRIDGES
Road
Q34442 EXACT TITLE 1.000
QID OVERLAP: Q34442 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (19): "access", "another", "design", "distinction", "highways", "land", "local", "movement", "primarily", "primary", "private", "public", "road", "roads", "sidewalks", "streets", "traffic", "urban", "whose". | EXACT TITLE in transportation_infrastructure: "Road". | EXACT TITLE in government_civic: "Road".
accessanotherdesigndistinctionhighwayslandlocalmovementprimarilyprimaryprivatepublicroadroadssidewalksstreetstrafficurbanwhose
y roads are paved. The words "road" and "street" are commonly considered to be interchangeable, but the distinction is important in urban design. Roads differ from streets, whose primary use is local access. Roads also differ from stroads, which combine the features of streets and roads.
om streets, whose primary use is local access. Roads also differ from stroads, which combine the features of streets and roads.
Part 2, Division 1, clauses 11–13 of the National Transport Commission Regulations 2006 defines a road in Australia as 'an area that is open to or used by the public and is developed for, or has as one of its main uses, the driving or riding of motor vehicles.' Further, it defines a shoulder (typical an area of the road outside the edge line, or the curb) and a road-related area which includes green areas separating roads, areas designated for cyclists and areas generally accessible to the public for driving, riding or parking vehicles. New Zealand In New Zealand, the definition of a road is broad in common law where the statutory definition includes areas the public has access to, by right or not. Beaches, publicly accessible car parks and yards (even if privately owned), river beds, road shoulders (verges), wharves and bridges are included.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (27): "agricultural", "agriculture", "associated", "boise", "capital", "contains", "distinct", "early", "economy", "idaho", "land", "linked", "miles", "national", "official", "population", "restricted", "river", "separate", "significant".... | EXACT TITLE in transportation_infrastructure: "Idaho". | EXACT TITLE in government_civic: "Idaho".
agriculturalagricultureassociatedboisecapitalcontainsdistinctearlyeconomyidaholandlinkedmilesnationalofficialpopulationrestrictedriverseparatesignificantsuppliestechnologyterritoryuseswestwesternzone
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Suburbanization
Q1091971 EXACT TITLE 1.000
QID OVERLAP: Q1091971 in transportation_infrastructure (tier:branch) and government_civic (tier:evergreen). | SHARED TOKENS (23): "built", "businesses", "centers", "central", "cities", "demographic", "development", "drive", "economic", "environmental", "formation", "growing", "growth", "model", "movement", "planned", "population", "process", "residents", "rural".... | EXACT TITLE in government_civic: "Suburbanization".
builtbusinessescenterscentralcitiesdemographicdevelopmentdriveeconomicenvironmentalformationgrowinggrowthmodelmovementplannedpopulationprocessresidentsruralshifturbanzone
Suburbanization (American English), also spelled suburbanisation (British English), is a population shift from historic core cities or rural areas into suburbs. Most suburbs are built in a formation of (sub)urban sprawl. As a consequence of the movement of households and businesses away from city centers, low-density, peripheral urban areas grow. Proponents of curbing suburbanization argue that sprawl leads to urban decay and a concentration of lower-income residents in the inner city, in addition to environmental harm. Suburbanization can be a progressive process in which growing populations, technological innovations, and economic changes drive settlement outward, following the concentric zone model. Suburban growth takes many forms globally including planned satellite towns in Europe, rail-oriented suburbs in East Asia, Canadian high-rises, and the expansion of informal peri-urban areas in the Global South.
Post–World War II economic expansion in the United States included a sudden boom in housing construction as developers raced to address housing shortages across the country. As veterans returned from war, their GI Bill benefits made it especially easy to buy homes in these new, cost-efficient neighborhoods, populating them quickly with young couples and new families. These new neighborhoods were outside the inner city suburbs. This movement away from the inner city to new outer suburbs spawned new "minicites" which have served as smaller centers of economic activity. Racially discriminatory housing policies in many areas prevented people of color from buying homes in the new suburbs, making them largely white-dominated spaces. The nationwide mass migration of white homeowners into the suburbs became known as "white flight". Suburbs are often built around certain industries such as restaurants, shopping, and entertainment, which allows suburban residents to travel less and interact more within the suburban area. For example, Kings County, New York served New York City as farmland in the 18th century, with boats carrying produce across the East River. The steam ferry later made Brooklyn Heights a commuter town for Wall Street. Streetcar suburbs spread through the county, and as elevated railways further extended its reach, the City of Brooklyn grew to fill the county. Areas along the river became industrialized and apartment buildings filled the places where factories did not replace the scattered houses. As a result, much of Brooklyn transformed into a suburban economy and later into an urban economy entirely. The March uptown proceeded similarly on the other side of the East River, and many other suburbs have followed the cycle. Similarly, the rise of modern delivery logistics in postal services, which takes advantage of computerization and the availability of efficient transportation networks, also eliminates some of the advantages that were once to be had from having a business located in the city. Industrial, warehousing, and factory land uses have also moved to suburban areas. This removes the need for company headquarters to be within a quick courier distance of warehouses and ports. Urban areas often suffer from traffic congestion, which creates extra driver costs for the company that may have otherwise been reduced if they were located in a suburban area near a highway instead. Lower property taxes and low land prices encourage selling industrial land for profitable brownfield redevelopment. Suburban areas also offer more land to use as a buffer between industrial areas and residential and retail spaces. This may avoid NIMBY sentiments and gentrification pressure from the local community due to residential and retail areas being adjacent to industrial spaces in an urban area. Suburban municipalities can offer tax breaks, specialized zoning, and regulatory incentives to attract industrial land users to their area, such as City of Industry, California. The overall effect of these developments is that both businesses and individuals now see an advantage to relocating to the suburbs, where the cost of buying land, renting space, and running their operations is cheaper than in the city. This continuing dispersal from a single-city center has led to the advent of edge cities and exurbs, which arise out of clusters of office buildings built in suburban commercial areas, shopping malls, and other high-density developments. With more jobs for suburbanites in these areas rather than in the main city core from which the suburbs grew, traffic patterns have become more complex, with the volume of intra-suburban traffic increasing. Historically, by the year 2000, nearly half of the US population had relocated to suburban areas. In the early 21st century, the spread of communication services, such as broadband, e-mail, and practical home video conferencing, have enabled more people to work from home rather than commuting.
Long-suppressed urbanization and a dramatic housing backlog resulted in extensive peri-urban growth in Tirana (Albania), which during the 1990s doubled the size of the city whereas war refugees put pressure on cities of former Yugoslavia. Elsewhere processes of suburbanization seemed dominant, but their pace differed according to housing shortages, available finances, preferences, and the degree of 'permitted' informality. The process was slow in Prague during the 1990s and more apparent after 2000, when housing affordability improved. Conversely, Slovenian and Romanian suburban developments visibly surrounded cities/towns during the 1990s. Nonetheless, socialist legacies of underdeveloped infrastructure and the affordability crisis of transition differentiate post-socialist suburbs from their Western counterparts. Various degrees of informality characterized suburban housing from illegal occupation of public land (Tirana), illegal construction on agricultural private land (Belgrade) to the unauthorized but later legalized developments in Romania. Suburban housing displayed a chaotic/unplanned character, especially in south-eastern Europe, where the state retains a degree of illegitimacy. Accepting scattered for-profit housing, much of the new detached suburban houses seem self-developed. Allegedly, owner-building has become a household strategy to adapt to recession, high and volatile inflation, to cut construction costs, and to bridge access to housing.
Metropolitan planning organization
Q6825353 EXACT TITLE 1.000
QID OVERLAP: Q6825353 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (32): "access", "act", "authorities", "committees", "continuing", "cooperative", "created", "existing", "federal", "federally", "formation", "funding", "funds", "governed", "government", "highway", "law", "local", "metropolitan", "organization".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization". | EXACT TITLE in government_civic: "Metropolitan planning organization".
accessactauthoritiescommitteescontinuingcooperativecreatedexistingfederalfederallyformationfundingfundsgovernedgovernmenthighwaylawlocalmetropolitanorganizationparticipationplanningplanspopulationprocessprogramsprojectspublicregionalrural+2
e based on a continuing, cooperative, and comprehensive ("3-C") planning process. Statewide and metropolitan transportation planning processes are governed by federal law. Transparency through public access to participation in the planning process and electronic publication of plans now is required by federal law.
establish a setting: establish and manage a fair and impartial setting for effective regional decision-making in the metropolitan planning area (MPA).
tatives from local government and governmental transportation authorities. They were created to ensure regional cooperation in transportation planning. MPOs were introduced by the Federal-Aid Highway Act of 1962, which required the formation of an MPO for any urbanized area (UZA) with a population greater than 50,000. Federal funding for transportation projects and programs are channeled through this planning process. Congress created MPOs in order to ensure that existing and future expenditures of governmental funds for transportation projects and programs are based on a continuing, cooperative, and comprehensive ("3-C") planning process. Statewide and metropolitan transportation planning processes are governed by federal law. Transparency through public access to participation in the planning process and electronic publication of plans now is required by federal law.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (17): "agricultural", "association", "boise", "chambers", "idaho", "land", "local", "metropolitan", "opportunities", "primarily", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in transportation_infrastructure: "Treasure Valley". | EXACT TITLE in government_civic: "Treasure Valley".
agriculturalassociationboisechambersidaholandlocalmetropolitanopportunitiesprimarilyregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (19): "apprenticeship", "boundaries", "certification", "formal", "labor", "level", "license", "master", "period", "permanent", "placement", "potential", "practice", "professional", "reach", "regulated", "study", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship". | EXACT TITLE in government_civic: "Apprenticeship".
apprenticeshipboundariescertificationformallaborlevellicensemasterperiodpermanentplacementpotentialpracticeprofessionalreachregulatedstudysystemtraining
Apprenticeship is a system for training potential new practitioners of a trade or profession with on-the-job training and often some accompanying study. Apprenticeships may also enable practitioners to gain a license to practice in a regulated occupation. Most of their training is done while working for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
ing for an experienced employer who helps the apprentices learn their trade or profession, in exchange for their continued labor for an agreed period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
period after they have achieved measurable competencies. Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
F
Q5440472 EXACT TITLE 1.000
QID OVERLAP: Q5440472 in transportation_infrastructure (tier:evergreen) and government_civic (tier:branch). | SHARED TOKENS (31): "administration", "agencies", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "government", "grants", "local", "office", "operate", "operators", "oversees", "primarily", "programs", "providers".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
administrationagenciesagencyassistancedepartmentdistrictexistingfederalfinancialfunctionsgovernmentgrantslocalofficeoperateoperatorsoverseesprimarilyprogramsprovidersprovidingpublicregionalrequirementsresponsiblestatutorysystemstechnicaltransittransportation+1
The Federal Transit Administration (FTA) is an agency within the United States Department of Transportation (DOT) that provides financial and technical assistance to local public transportation systems. The FTA is one of ten modal administrations within the DOT. Headed by an Administrator who is appointed by the president of the United States, the FTA functions through its Washington, D.C., headquarters office and ten regional offices which assist transit agencies in all states, the District of Columbia, and the territories. Until 1991, it was known as the Urban Mass Transportation Administration (UMTA). Public transportation includes buses, subways, light rail, commuter rail, monorail, passenger ferry boats, trolleys, inclined railways, and people movers. The federal government, through the FTA, provides financial assistance to develop new transit systems and improve, maintain, and operate existing systems. The FTA oversees grants to state and local transit providers, primarily through its ten regional offices.
C., headquarters office and ten regional offices which assist transit agencies in all states, the District of Columbia, and the territories. Until 1991, it was known as the Urban Mass Transportation Administration (UMTA). Public transportation includes buses, subways, light rail, commuter rail, monorail, passenger ferry boats, trolleys, inclined railways, and people movers. The federal government, through the FTA, provides financial assistance to develop new transit systems and improve, maintain, and operate existing systems. The FTA oversees grants to state and local transit providers, primarily through its ten regional offices.
History In 1962, President John F. Kennedy sent a message to the U.S. Congress calling for the creation of a program of federal capital assistance for mass transportation. President Kennedy said, "To conserve and enhance values in existing urban areas is essential. But at least as important are steps to promote economic efficiency and livability in areas of future development. Our national welfare therefore requires the provision of good urban transportation, with the properly balanced use of private vehicles and modern mass transport to help shape as well as serve urban growth." President Lyndon B. Johnson signed the Urban Mass Transportation Act of 1964 into law, which passed the House by a vote of 212–129 and cleared the Senate 52–41, creating the Urban Mass Transportation Administration. The agency was charged with providing federal assistance for mass transit projects, including an initial $375 million in capital assistance over three years as mandated by the act.
Public works
Q627364 EXACT TITLE 1.000
QID OVERLAP: Q627364 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (37): "assets", "body", "bridges", "broad", "canals", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "health", "infrastructure", "municipal".... | EXACT TITLE in transportation_infrastructure: "Public works". | EXACT TITLE in government_civic: "Public works".
assetsbodybridgesbroadcanalscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthealthinfrastructuremunicipaloperatorparksphysicalpipelinesprivateprojectspublicreductionroadssafety+7
and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
Public works are a broad category of infrastructure projects, financed and procured by a government body for employment, health and safety, and recreational uses in the greater community. They include environmental protection (drinking water protection, preservation and restoration of forests and wetlands, soil erosion reduction, wildlife habitat preservation), public buildings (hospitals, municipal buildings, and schools), public services (dams, electrical grid, sewage treatment, and water supply and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
Overview Public works is a multi-dimensional concept in economics and politics, touching on multiple arenas including: recreation (parks, beaches, trails), aesthetics (trees, green space), economy (goods and people movement, energy), law (police and courts), and neighborhood (community centers, social services buildings). It represents any constructed object that augments a nation's physical infrastructure. Municipal infrastructure, urban infrastructure, and rural development usually represent the same concept but imply either large cities or developing nations' concerns respectively. The terms public infrastructure or critical infrastructure are at times used interchangeably.
Public transport
Q178512 EXACT TITLE 1.000
QID OVERLAP: Q178512 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (49): "access", "air", "association", "authorities", "contracting", "costs", "development", "economic", "estate", "financial", "fixed", "funding", "general", "government", "historical", "infrastructure", "integrated", "intended", "international", "investment".... | EXACT TITLE in transportation_infrastructure: "Public transport". | EXACT TITLE in government_civic: "Public transport".
accessairassociationauthoritiescontractingcostsdevelopmenteconomicestatefinancialfixedfundinggeneralgovernmenthistoricalinfrastructureintegratedintendedinternationalinvestmentlocalmodelmunicipalnetworkoperateoperatedoperatingoperationaloperationsoperators+19
t use of infrastructure. High-frequency services often prioritize regular headways over exact departure times. However, many trips involve multimodal travel, such as walking or feeder bus services to access rail stations, highlighting the importance of network coordination and cost-effective planning. In some regions, share taxis and other demand-responsive services provide flexible alternatives to fixed-route transit, either competing with or complementing traditional systems. Paratransit services are typically reserved for low-demand areas or passengers requiring door-to-door transportation, often at higher per-trip costs. Public transport systems vary significantly by region due to historical, geographic, and economic factors. In Japan, many urban transit networks are operated by profit-oriented private companies, often integrated with real estate development, a model frequently cited for its financial sustainability and operational efficiency. In North America, mass transit is most commonly operated by municipal or regional transit authorities, typically funded through a combination of fares, local taxes, and government subsidies. In Europe, both state-owned enterprises and private operators participate in transit provision, often under competitive contracting arrangements. For geographic and economic reasons, levels of public transport use and investment differ widely across countries.
Light rail transit Light rail transit (LRT) is a term coined in 1972 and uses mainly tram technology. Light rail has mostly dedicated right-of-ways and less sections shared with other traffic and usually step-free access. A light rail line is generally traversed with increased speed compared to a tram line. Light rail lines are, thus, essentially modernized interurbans. Unlike trams, light rail trains are often longer and have one to four cars per train.
Personal rapid transit (PRT) is an automated cab service that runs on rails or a guideway. This is an uncommon mode of transportation (excluding elevators) due to the complexity of automation. A fully implemented system might provide most of the convenience of individual automobiles with the efficiency of public transit. The crucial innovation is that the automated vehicles carry just a few passengers, turn off the guideway to pick up passengers (permitting other PRT vehicles to continue at full speed), and drop them off to the location of their choice (rather than at a stop). Conventional transit simulations show that PRT might attract many auto users in problematic medium-density urban areas. A number of experimental systems are in progress. One might compare personal rapid transit to the more labor-intensive taxi or paratransit modes of transportation, or to the (by now automated) elevators common in many publicly accessible areas. Automated people mover (APM) are a special term for grade-separated rail which uses vehicles that are smaller and shorter in size.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (24): "activity", "among", "boise", "business", "college", "division", "economics", "education", "engineering", "fiscal", "founded", "health", "high", "idaho", "independent", "master", "program", "programs", "public", "reported".... | EXACT TITLE in transportation_infrastructure: "Boise State University". | EXACT TITLE in government_civic: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationengineeringfiscalfoundedhealthhighidahoindependentmasterprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in transportation_infrastructure (tier:evergreen) and government_civic (tier:branch). | SHARED TOKENS (24): "ada", "air", "airport", "boise", "commercial", "commission", "department", "downtown", "facility", "functions", "general", "idaho", "increase", "international", "miles", "military", "national", "operated", "operates", "receive".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
adaairairportboisecommercialcommissiondepartmentdowntownfacilityfunctionsgeneralidahoincreaseinternationalmilesmilitarynationaloperatedoperatesreceiverightssupportuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Bridge
Q12280 EXACT TITLE 1.000
QID OVERLAP: Q12280 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (36): "bridges", "built", "community", "complex", "connecting", "connection", "constructed", "construction", "create", "design", "determined", "early", "engineering", "engineers", "industrial", "intended", "local", "major", "method", "miles".... | EXACT TITLE in transportation_infrastructure: "Bridge". | EXACT TITLE in government_civic: "Bridge".
bridgesbuiltcommunitycomplexconnectingconnectionconstructedconstructioncreatedesigndeterminedearlyengineeringengineersindustrialintendedlocalmajormethodmilesnetworkphysicalprimarilyprovideprovidingrequirementsriversatisfyservestructure+6
A bridge is a structure designed to span an obstacle, such as a river or railway, allowing vehicles, pedestrians, and other loads to pass across. Most bridges consist of a flat deck, supported by beams, arches, or cables. These structures rest on a foundation that is carefully designed to transfer the weight of the bridge to the subsoil without settling. Bridges can be constructed in a wide variety of forms, determined by the location, intended purpose, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
l without settling. Bridges can be constructed in a wide variety of forms, determined by the location, intended purpose, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
College of Western Idaho
EXACT TITLE 1.000
QID OVERLAP: Q5146875 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (31): "academic", "ada", "board", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "elected", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in transportation_infrastructure: "College of Western Idaho". | EXACT TITLE in government_civic: "College of Western Idaho".
academicadaboardboisecanyoncollegecommunitycountiescwidevelopmenteducationelectedgovernedidaholargenampapopulationprimaryprogramspublicreportedresidentssouthweststudentstechnicaltransfertreasurevalleyvoterswestern+1
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Federal Highway Administration
Q800112 EXACT TITLE 1.000
QID OVERLAP: Q800112 in transportation_infrastructure (tier:evergreen) and government_civic (tier:branch). | SHARED TOKENS (15): "administration", "agency", "department", "division", "federal", "highway", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
administrationagencydepartmentdivisionfederalhighwaymajorofficeprogramprogramspublicroadroadsroletransportation
The Federal Highway Administration (FHWA) is a division of the United States Department of Transportation that specializes in highway transportation. The agency's major activities are grouped into two programs, the Federal-aid Highway Program and the Federal Lands Highway Program.
Background With the coming of the bicycle in the 1890s, interest grew regarding the improvement of streets and roads in America. The traditional method of putting the burden on maintaining roads on local landowners was increasingly inadequate. In 1893, the federal Office of Road Inquiry (ORI) was founded; in 1905, it was renamed the Office of Public Roads (OPR) and made a division of the United States Department of Agriculture. Demands grew for local and state government to take charge. With the coming of the automobile, urgent efforts were made to upgrade and modernize dirt roads designed for horse-drawn wagon traffic. In 1910, the American Association for Highway Improvement was organized. Funding came from automobile registration, and taxes on motor fuels, as well as state aid. By 1914, there were 2.4 million miles of rural dirt rural roads; 100,000 miles had been improved with grading and gravel, and 3,000 miles were given high-quality surfacing. The rapidly increasing speed of automobiles, and especially trucks, made maintenance and repair high-priority items. In 1915, OPR's name was changed to the Bureau of Public Roads. The following year, federal aid was first made available to improve post roads and promote general commerce: $75 million over five years, issued through the BPR in cooperation with the state highway departments. In 1939, BPR was renamed to the Public Roads Administration (PRA) and shifted to the Federal Works Agency.
Creation The Federal Highway Administration was created on October 15, 1966, along with the Bureau of Motor Carrier Safety and the National Highway Safety Bureau (now known as National Highway Traffic Safety Administration), as part of the new U.S. Department of Transportation. The FHWA took over the functions of the Bureau of Public Roads the following year. Functions The FHWA's role in the Federal-aid Highway Program is to oversee federal funds to build and maintain the National Highway System (primarily Interstate highways, U.S. highways and most state highways). This funding mostly comes from the federal gasoline tax and mostly goes to state departments of transportation. The FHWA oversees projects using these funds to ensure that federal requirements for project eligibility, contract administration and construction standards are adhered to. Under the Federal Lands Highway Program (sometimes called "direct fed"), the FHWA provides highway design and construction services for various federal land-management agencies, such as the Forest Service and the National Park Service. The FLHP also jointly administers the Indian Reservation Roads Program. In addition to these programs, the FHWA performs and sponsors research in the areas of roadway safety, congestion, highway materials and construction methods, and provides funding to local technical assistance program centers to disseminate research results to local highway agencies. The FHWA also publishes the Manual on Uniform Traffic Control Devices (MUTCD), which is used by most highway agencies in the United States.
Transportation planning
Q1034047 EXACT TITLE 1.000
QID OVERLAP: Q1034047 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (20): "agencies", "businesses", "design", "facilities", "government", "highways", "influence", "lines", "movement", "needs", "planners", "planning", "policies", "private", "process", "public", "siting", "streets", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning". | EXACT TITLE in government_civic: "Transportation planning".
agenciesbusinessesdesignfacilitiesgovernmenthighwaysinfluencelinesmovementneedsplannersplanningpoliciesprivateprocesspublicsitingstreetssystemtransportation
s to prepare for future needs to move people and goods to destinations. As practiced today, it is a collaborative process that incorporates the input of many stakeholders including various government agencies, the public and private businesses.
he transportation system to influence beneficial outcomes. Transportation planning is also commonly referred to as transport planning internationally, and is involved with the evaluation, assessment, design, and siting of transport facilities (generally streets, highways, bike lanes, and public transport lines). Models and sustainability Transportation planning, or transport planning, has historically followed the rational planning model of defining goals and objectives, identifying problems, generating alternatives, evaluating alternatives, and developing plans. Other models for planning include rational actor, transit oriented development, satisficing, incremental planning, organizational process, collaborative planning, and political bargaining. Planners are increasingly expected to adopt a multidisciplinary approach, especially due to the rising importance of environmentalism. For example, the use of behavioural psychology to persuade drivers to abandon their automobiles and use public transport instead. The role of the transport planner is shifting from technical analysis to promoting sustainability through integrated transport policies. For example, in Hanoi, the increasing number of motorcycles is responsible for not only environmental damage but also slowing down economic growth. In the long run, the plan is to reduce traffic through a change in urban planning.
United Kingdom In the United Kingdom, transport planning has traditionally been a branch of civil engineering. In the 1950s and the 1960s, it was generally believed that the motor car was an important element in the future of transport as economic growth spurred on car ownership figures. The role of the transport planner was to match motorway and rural road capacity against the demands of economic growth. Urban areas would need to be redesigned for the motor vehicle or impose traffic containment and demand management to mitigate congestion and environmental impacts. The policies were popularised in a 1963 government publication, Traffic in Towns. The contemporary Smeed Report on congestion pricing was initially promoted to manage demand but was deemed politically unacceptable. In more recent times, the approach has been caricatured as "predict and provide" to predict future transport demand and provide the network for it, usually by building more roads. The publication of Planning Policy Guidance 13 in 1994 (revised in 2001), followed by A New Deal for Transport in 1998 and the white paper Transport Ten Year Plan 2000 again indicated an acceptance that unrestrained growth in road traffic was neither desirable nor feasible.
M
Q2097994 EXACT TITLE 0.860
QID OVERLAP: Q2097994 in transportation_infrastructure (tier:branch) and government_civic (tier:evergreen). | SHARED TOKENS (8): "body", "cities", "corporation", "counties", "governing", "legal", "local", "municipal". | EXACT TITLE in government_civic: "Municipal corporation".
bodycitiescorporationcountiesgoverninglegallocalmunicipal
Municipal corporation is the legal term for a local governing body, including (but not necessarily limited to) cities, counties, towns, townships, charter townships, villages, and boroughs. The term can also be used to describe municipally owned corporations. Municipal corporation as local self-government Municipal incorporation occurs when such municipalities become self-governing entities under the laws of the state or province in which they are located. Often, this event is marked by the award or declaration of a municipal charter.
There are 12 city corporations in Bangladesh. Two of them are located in the capital Dhaka and the remaining 10 are located in the most populous cities of the eight divisions. They carry out major works in the cities and perform socio-economic and civic functions. In addition, there are 330 municipalities in the eight divisions of Bangladesh. A city corporation is a much stronger and larger Local governing body than a municipal corporation.
Municipal corporation as local self-government Municipal incorporation occurs when such municipalities become self-governing entities under the laws of the state or province in which they are located. Often, this event is marked by the award or declaration of a municipal charter. A city charter or town charter or municipal charter is a legal document establishing a municipality, such as a city or town. Bangladesh There are 12 city corporations in Bangladesh. Two of them are located in the capital Dhaka and the remaining 10 are located in the most populous cities of the eight divisions. They carry out major works in the cities and perform socio-economic and civic functions. In addition, there are 330 municipalities in the eight divisions of Bangladesh. A city corporation is a much stronger and larger Local governing body than a municipal corporation.
Meridian, Idaho
Q1085274 QID OVERLAP 0.850
QID OVERLAP: Q1085274 in transportation_infrastructure (tier:branch) and government_civic (tier:evergreen). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population", "second". | URL->B (1): https://meridiancity.org/.
adaamongboisecapitalcitiesidahomakingmeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (33): "agency", "associated", "become", "building", "cities", "commercial", "costs", "described", "development", "environmental", "existing", "growth", "housing", "industrial", "infrastructure", "land", "large", "planning", "population", "private"....
agencyassociatedbecomebuildingcitiescommercialcostsdescribeddevelopmentenvironmentalexistinggrowthhousingindustrialinfrastructurelandlargeplanningpopulationprivatepropertyrequireresidentialrevenueroadssalessupporttaxtaxestransportation+3
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (18): "according", "boise", "canyon", "college", "home", "idaho", "interstate", "meaning", "meridian", "metropolitan", "miles", "nampa", "population", "principal", "second", "university", "west", "western".
accordingboisecanyoncollegehomeidahointerstatemeaningmeridianmetropolitanmilesnampapopulationprincipalseconduniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Bus rapid transit
Q2878855 QID OVERLAP 0.800
QID OVERLAP: Q2878855 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (18): "capacity", "capital", "cities", "connecting", "conventional", "cost", "design", "electric", "majority", "network", "public", "quality", "single", "system", "systems", "traffic", "transit", "transportation".
capacitycapitalcitiesconnectingconventionalcostdesignelectricmajoritynetworkpublicqualitysinglesystemsystemstraffictransittransportation
Bus rapid transit (BRT), also referred to as a busway or transitway, is a trolleybus, electric bus, or bus service system designed to have higher capacity, reliability, and other quality features than a conventional bus system. Typically, a BRT system includes roadways that are dedicated to buses, and gives priority to buses at intersections where buses may interact with other traffic, alongside design features to reduce delays caused by passengers boarding or disembarking buses, or paying fares. BRT aims to combine the capacity and speed of a light rail transit (LRT) or mass rapid transit (MRT) system with the flexibility, lower cost and simplicity of a bus system. Although some cities, such as Lima, Liège and Runcorn, pioneered segregated busway systems with some BRT features, the first city to fully integrate every BRT feature into a single system was Curitiba with the Rede Integrada de Transporte in 1974. As of March 2018, a total of 166 cities in six continents have implemented BRT systems, accounting for 4,906 km (3,048 mi) of BRT lanes and about 32.2 million passengers every day. The majority of these are in Latin America, where about 19.6 million passengers ride daily, and which has the most cities with BRT systems, with 54, led by Brazil with 21 cities. The Latin American countries with the most daily ridership are Brazil (10.7 million), Colombia (3.0 million), and Mexico (2.5 million). In the other regions, China (4.3 million) and Iran (2.1 million) stand out.
at intersections where buses may interact with other traffic, alongside design features to reduce delays caused by passengers boarding or disembarking buses, or paying fares. BRT aims to combine the capacity and speed of a light rail transit (LRT) or mass rapid transit (MRT) system with the flexibility, lower cost and simplicity of a bus system. Although some cities, such as Lima, Liège and Runcorn, pioneered segregated busway systems with some BRT features, the first city to fully integrate every BRT feature into a single system was Curitiba with the Rede Integrada de Transporte in 1974. As of March 2018, a total of 166 cities in six continents have implemented BRT systems, accounting for 4,906 km (3,048 mi) of BRT lanes and about 32.2 million passengers every day. The majority of these are in Latin America, where about 19.6 million passengers ride daily, and which has the most cities with BRT systems, with 54, led by Brazil with 21 cities. The Latin American countries with the most daily ridership are Brazil (10.7 million), Colombia (3.0 million), and Mexico (2.5 million). In the other regions, China (4.3 million) and Iran (2.1 million) stand out.
rk in the world, with about 264.6 kilometres (164.4 mi) of corridors connecting the Indonesian capital city. Terminology Bus rapid transit is a mode of mass rapid transit (MRT) and describes a high-capacity urban public-transit system with its own right of way, vehicles at short headways, platform-level boarding, and preticketing. The expression "BRT" is mainly used in the Americas and China; in India, it is called "BRTS" (BRT System); in Europe it is often called a "busway" or a "BHLS" (stands for Bus with a High Level of Service). The term transitway was originated in 1981 with the opening of the OC Transpo transitway in Ottawa, Ontario, Canada. Critics have charged that the term "bus rapid transit" has sometimes been misapplied to systems that lack most or all the essential features which differentiate it from conventional bus services.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (35): "agency", "began", "department", "education", "energy", "enforcement", "engineers", "environmental", "equivalent", "establishing", "executive", "federal", "federally", "financial", "government", "governments", "independent", "information", "laws", "legal"....
agencybegandepartmenteducationenergyenforcementengineersenvironmentalequivalentestablishingexecutivefederalfederallyfinancialgovernmentgovernmentsindependentinformationlawslegallevellocalmattersmeasuresnationalpermittingpowersprogramsproposedpublic+5
The Environmental Protection Agency (EPA) is an independent agency of the United States government tasked with environmental protection matters. President Richard Nixon proposed the establishment of EPA on July 9, 1970; it began operation on December 2, 1970, after Nixon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
r is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
or is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "counties", "downtown", "employers", "estimated", "home", "idaho", "level", "locally", "major", "metropolitan", "miles", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntownemployersestimatedhomeidaholevellocallymajormetropolitanmilespopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Emergency medical services
Q860447 QID OVERLAP 0.800
QID OVERLAP: Q860447 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (35): "additional", "agencies", "ambulance", "authorities", "began", "businesses", "certain", "contact", "department", "dispatch", "drive", "emergency", "facilities", "hospital", "medical", "model", "operate", "personnel", "places", "primary"....
additionalagenciesambulanceauthoritiesbeganbusinessescertaincontactdepartmentdispatchdriveemergencyfacilitieshospitalmedicalmodeloperatepersonnelplacesprimaryprovideprovidingpublicremainsrescueresourcessubstantialsupportsystemstechnical+5
ave personnel who retain at least basic life support (BLS) certifications. In English-speaking countries, they are known as emergency medical technicians (EMTs) and paramedics, with the latter having additional training such as advanced life support (ALS) skills. Physicians and nurses may also provide pre-hospital care to varying degrees in certain countries, a model which is popular in Europe. History Precursors Emergency care in the field has been rendered in different forms since the beginning of recorded history. The New Testament contains the parable of the Good Samaritan, in which a man who has been beaten is cared for by a passing Samaritan. Luke 10:34 (NIV) – "He went to him and bandaged his wounds, pouring on oil and wine.
First aid consists of basic skills that are commonly taught to members of the public, such as cardiopulmonary resuscitation, bandaging wounds and saving someone from choking. Basic Life Support (BLS) is often the lowest level of training that can be held by those who treat patients on an ambulance. Commonly, it includes administering oxygen therapy, some drugs and a few invasive treatments. BLS personnel may either operate a BLS ambulance on their own, or assist a higher qualified crewmate on an ALS ambulance. In English-speaking countries, BLS ambulance crew members are known as emergency medical technicians, emergency care assistants or Primary care paramedics in Canada. Intermediate Life Support (ILS), also known as Limited Advanced Life Support (LALS), is positioned between BLS and ALS but is less common than both. It is commonly a BLS provider with a moderately expanded skill set (such as an AEMT, but where it is present it usually replaces BLS. Advanced Life Support (ALS) has a considerably expanded range of skills such as intravenous therapy, endotracheal intubation, cricothyrotomy and interpretation of electrocardiograms. The scope of this higher tier response varies considerably by country. Paramedics commonly provide ALS, but some countries require it to be a higher level of care and instead employ physicians in this role. Additionally Advanced Life Support includes administering therapeutic doses of electrical shock to those who are in cardiac arrest or using drugs to stimulate the heart, Airway therapy, and so on and so forth. Most ambulances are equipped with advanced Life Support equipment and have paramedics on board. While some fire departments have ambulances, first aid and squads utilize ambulances for emergency medical services. Critical Care Transport (CCT or CCP), also known as medical retrieval or rendez vous MICU protocol in some countries (Australia, NZ, Great Britain, and Francophone Canada) refers to the critical care transport of patients between hospitals (as opposed to pre-hospital). Such services are a key element in regionalized systems of hospital care where intensive care services are centralized to a few specialist hospitals. An example of this is the Emergency Medical Retrieval Service in Scotland.
Emergency medical technicians are usually able to perform a wide range of emergency care skills, such as automated defibrillation, care of spinal injuries and oxygen therapy. In few jurisdictions, some EMTs are able to perform duties as IV and IO cannulation, administration of a limited number of drugs (including but not limited to Epinephrine, Narcan, Oxygen, Aspirin, Nitroglycerin – dependent on country, state, and medical direction), more advanced airway procedures, CPAP, and limited cardiac monitoring. Most advanced procedures and skills are not within the national scope of practice for an EMT. As such most states require additional training and certifications to perform above the national curriculum standards. In the United States, an EMT certification requires intense courses and training in field skills. Certifications are state-specific and last varying durations, though National Registry certification simplifies the reciprocity process in many states.
Complete streets
Q5156515 QID OVERLAP 0.800
QID OVERLAP: Q5156515 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (21): "access", "community", "design", "economic", "engineers", "environmental", "health", "highway", "home", "living", "operated", "planned", "planners", "policy", "public", "requires", "safety", "streets", "traffic", "transportation"....
accesscommunitydesigneconomicengineersenvironmentalhealthhighwayhomelivingoperatedplannedplannerspolicypublicrequiressafetystreetstraffictransportationurban
Complete streets is a transportation policy and design approach that requires streets to be planned, designed, operated and maintained to enable safe, convenient and comfortable travel and access for users of all ages and abilities regardless of their mode of transportation. Complete Streets allow for safe travel by those walking, cycling, driving automobiles, riding public transportation, or delivering goods. The term is often used by transportation advocates, urban planners, traffic and highway engineers, public health practitioners, and community members in the United States and Canada. Complete Streets are promoted as offering improved safety, health, economic, and environmental outcomes.
ity members in the United States and Canada. Complete Streets are promoted as offering improved safety, health, economic, and environmental outcomes. Complete Streets emphasize the importance of safe access for all users, not just automobiles. Related concepts include living streets, Woonerf, and home zones. History After World War II, many communities in the United States were designed to facilitate easy and fast access to destinations via automobile. In rural and suburban communities, people often rely on the automobile as their sole means of transportation and even in areas with public transportation and safe places to walk and bicycle, they live in a state of automobile dependence wherein automobiles are the central focus of transportation, infrastructure and land use policies to the extent that other modes of transportation, such as walking, cycling and mass transit, have become impractical. Oregon enacted the first Complete Streets-like policy in the United States in 1971, requiring that new or rebuilt roads accommodate bicycles and pedestrians, and also calling on state and local governments to fund pedestrian and bicycle facilities in the public right-of-way. Since then, 16 additional state legislatures have adopted Complete Streets laws. In 2003, Barbara McCann, who would later become the Executive Director of the National Complete Streets Coalition, coordinated a search for a replacement for the term "routine accommodation." The term "complete streets" was suggested by David Goldberg, the communications director for Smart Growth America, and it was adopted by a coalition of advocacy groups to refer both to a comprehensive approach to street design and to the coalition itself. The National Complete Streets Coalition was founded in 2005 by a coalition of advocacy and trade groups, including AARP, the American Planning Association and the American Society of Landscape Architects. The American Public Transportation Association, Blue Cross Blue Shield Minnesota, the National Association of Realtors, and the Institute of Transportation Engineers are examples of other current Coalition Steering Committee members. Federal complete streets legislation was proposed in 2008 and 2009, but failed to become law. In 2010, the U.S. Department of Transportation issued a policy statement on bicycle and pedestrian accommodation, declaring its support for their inclusion in federal-aid transportation projects and encouraging community organizations, public transportation agencies, and state and local governments to adopt similar policies. By early 2013, more than 490 jurisdictions in United States had adopted a Complete Streets policy, including twenty-seven states, the District of Columbia, and the Commonwealth of Puerto Rico. Some of these jurisdictions passed legislation enacting their policies into law, while others chose to implemented their policies by executive order or internal policy. Still more jurisdictions have passed non-binding resolutions in support of Complete Streets, or created transportation plans that incorporate Complete Streets principles. A federal Complete Streets Act has been introduced in the U.S.
not just automobiles. Related concepts include living streets, Woonerf, and home zones. History After World War II, many communities in the United States were designed to facilitate easy and fast access to destinations via automobile. In rural and suburban communities, people often rely on the automobile as their sole means of transportation and even in areas with public transportation and safe places to walk and bicycle, they live in a state of automobile dependence wherein automobiles are the central focus of transportation, infrastructure and land use policies to the extent that other modes of transportation, such as walking, cycling and mass transit, have become impractical. Oregon enacted the first Complete Streets-like policy in the United States in 1971, requiring that new or rebuilt roads accommodate bicycles and pedestrians, and also calling on state and local governments to fund pedestrian and bicycle facilities in the public right-of-way. Since then, 16 additional state legislatures have adopted Complete Streets laws. In 2003, Barbara McCann, who would later become the Executive Director of the National Complete Streets Coalition, coordinated a search for a replacement for the term "routine accommodation." The term "complete streets" was suggested by David Goldberg, the communications director for Smart Growth America, and it was adopted by a coalition of advocacy groups to refer both to a comprehensive approach to street design and to the coalition itself. The National Complete Streets Coalition was founded in 2005 by a coalition of advocacy and trade groups, including AARP, the American Planning Association and the American Society of Landscape Architects. The American Public Transportation Association, Blue Cross Blue Shield Minnesota, the National Association of Realtors, and the Institute of Transportation Engineers are examples of other current Coalition Steering Committee members. Federal complete streets legislation was proposed in 2008 and 2009, but failed to become law. In 2010, the U.S. Department of Transportation issued a policy statement on bicycle and pedestrian accommodation, declaring its support for their inclusion in federal-aid transportation projects and encouraging community organizations, public transportation agencies, and state and local governments to adopt similar policies. By early 2013, more than 490 jurisdictions in United States had adopted a Complete Streets policy, including twenty-seven states, the District of Columbia, and the Commonwealth of Puerto Rico. Some of these jurisdictions passed legislation enacting their policies into law, while others chose to implemented their policies by executive order or internal policy. Still more jurisdictions have passed non-binding resolutions in support of Complete Streets, or created transportation plans that incorporate Complete Streets principles. A federal Complete Streets Act has been introduced in the U.S.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "estimated", "highway", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "roads", "second", "streets".
adaboisecapitaldistrictestimatedhighwayhomeidahojurisdictionlocalmetropolitanpopulationprivateroadssecondstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.780
QID OVERLAP: Q1516815 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (14): "ada", "boise", "canyon", "district", "growing", "idaho", "metropolitan", "middleton", "population", "school", "schools", "shared", "star", "west".
adaboisecanyondistrictgrowingidahometropolitanmiddletonpopulationschoolschoolssharedstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.780
QID OVERLAP: Q843258 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (14): "boise", "cities", "downtown", "highway", "home", "idaho", "interstate", "major", "metropolitan", "miles", "primarily", "river", "routes", "serves".
boisecitiesdowntownhighwayhomeidahointerstatemajormetropolitanmilesprimarilyriverroutesserves
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Garden City, Idaho
QID OVERLAP 0.700
QID OVERLAP: Q1516892 in transportation_infrastructure (tier:evergreen) and government_civic (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "second", "separate".
adaboisegardengovernmentidahometropolitanmunicipalpopulationsecondseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (10): "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "miles", "population", "west".
boisecaldwellcanyoncollegeidaholocallymetropolitanmilespopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Middleton, Idaho
Q1517595 QID OVERLAP 0.640
QID OVERLAP: Q1517595 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population".
boisecanyonidahometropolitanmiddletonnampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.640
QID OVERLAP: Q1516870 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (7): "ada", "boise", "downtown", "eagle", "idaho", "miles", "population".
adaboisedowntowneagleidahomilespopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Greenleaf, Idaho
Q1516355 QID OVERLAP 0.620
QID OVERLAP: Q1516355 in transportation_infrastructure (tier:branch) and government_civic (tier:branch). | SHARED TOKENS (6): "canyon", "established", "greenleaf", "idaho", "metropolitan", "population".
canyonestablishedgreenleafidahometropolitanpopulation
Greenleaf is a city in Canyon County, Idaho, United States. The population was 812 at the 2020 census. Greenleaf is part of the Boise-Nampa metropolitan area.
2000 census As of the census of 2000, there were 862 people, 277 households, and 219 families residing in the city. The population density was 1,190.1 inhabitants per square mile (459.5/km2). There were 284 housing units at an average density of 392.1 per square mile (151.4/km2). The racial makeup of the city was 74.59% White, 0.46% African American, 0.81% Native American, 0.81% Asian, 0.23% Pacific Islander, 22.39% from other races, and 0.70% from two or more races. Hispanic or Latino of any race were 23.32% of the population. There were 277 households, out of which 46.9% had children under the age of 18 living with them, 63.9% were married couples living together, 10.8% had a female householder with no husband present, and 20.6% were non-families. 19.1% of all households were made up of individuals, and 10.5% had someone living alone who was 65 years of age or older. The average household size was 3.11 and the average family size was 3.57. In the city, the population was spread out, with 35.7% under the age of 18, 7.9% from 18 to 24, 27.5% from 25 to 44, 20.8% from 45 to 64, and 8.1% who were 65 years of age or older. The median age was 31 years. For every 100 females, there were 94.1 males. For every 100 females age 18 and over, there were 85.9 males. The median income for a household in the city was $37,375, and the median income for a family was $45,313. Males had a median income of $26,538 versus $22,115 for females. The per capita income for the city was $15,406.
Education It is in the Vallivue School District 139. Greenleaf Friends Academy is in Greenleaf. Residents of Canyon County are in the area (and the taxation zone) for College of Western Idaho. See also List of cities in Idaho References External links Official website
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
182 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP182 edges
🌲 EVERGREEN5 edges
0.650
agencydepartmentfederalfundinggrantidahoinfrastructureitdmaintenanceneedsoperationsorganizationplanningprogramsresponsibletransportation
SHARED TOKENS (16): "agency", "department", "federal", "funding", "grant", "idaho", "infrastructure", "itd", "maintenance", "needs", "operations", "organization", "planning", "programs", "responsible", "transportation". | URL->A (1): https://itd.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho Transportation Department". | EXACT TITLE in government_civic: "Idaho Transportation Department".
0.650
acquisitionagencyboardbroadcommissionconstructioncreatedeconomicfederalgovernmentindependentinterstatejurisdictionlinesmatterspipelinespowersrailroadrateregulation
SHARED TOKENS (26): "acquisition", "agency", "board", "broad", "commission", "construction", "created", "economic", "federal", "government", "independent", "interstate", "jurisdiction", "lines", "matters", "pipelines", "powers", "railroad", "rate", "regulation".... | URL->A (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
acquisitionadministrationairportcommercialcostsfederalfiscalfuelfundfundingfundsgeneralgrantgrantsimprovementlandpercentplanningprogramprojects
SHARED TOKENS (25): "acquisition", "administration", "airport", "commercial", "costs", "federal", "fiscal", "fuel", "fund", "funding", "funds", "general", "grant", "grants", "improvement", "land", "percent", "planning", "program", "projects".... | URL->A (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
achdadaadditionalagenciesairamonganotherauthoritiesauthorityboisecanyoncapacitycapitalcitiesconventionalcostcostsdemanddistricteagle
SHARED TOKENS (76): "achd", "ada", "additional", "agencies", "air", "among", "another", "authorities", "authority", "boise", "canyon", "capacity", "capital", "cities", "conventional", "cost", "costs", "demand", "district", "eagle".... | URL->A (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
0.630
agencybegancreatedcreatingdepartmentenforcementidaholawlegislaturemunicipalorganizationpolicepublicstatewide
SHARED TOKENS (14): "agency", "began", "created", "creating", "department", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "police", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
🌿 BRANCH136 edges
0.500
amongboisebranchdivisionestablishedhighidahooperatesparkprimarilyproductionprofessionalpublicresearchruralschoolsstatewidestudentsuniversity
SHARED TOKENS (19): "among", "boise", "branch", "division", "established", "high", "idaho", "operates", "park", "primarily", "production", "professional", "public", "research", "rural", "schools", "statewide", "students", "university". | EXACT TITLE in government_civic: "University of Idaho".
0.500
associatedbuildingbuiltconstructiondesigndevelopmenteconomicequivalentfacilitiesfinancinghazardousindustrialinfrastructuremaintenancepercentplanningprocesswork
SHARED TOKENS (18): "associated", "building", "built", "construction", "design", "development", "economic", "equivalent", "facilities", "financing", "hazardous", "industrial", "infrastructure", "maintenance", "percent", "planning", "process", "work". | EXACT TITLE in transportation_infrastructure: "Construction". | EXACT TITLE in government_civic: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
drainagehighwayhydraulicitselfmaterialneedpedestrianperformancepracticeprocessrequirementsroadroadsroadwayselectionshapestructuretrafficvehiclewater
SHARED TOKENS (20): "drainage", "highway", "hydraulic", "itself", "material", "need", "pedestrian", "performance", "practice", "process", "requirements", "road", "roads", "roadway", "selection", "shape", "structure", "traffic", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
academicadministrationanalysisbusinessescommunitycontextdescribedeconomiceffectivefoundedfunctionsgovernmentinstitutionsmanagementnonprofitorganizationorganizationspartnershipsperformancepolicies
SHARED TOKENS (35): "academic", "administration", "analysis", "businesses", "community", "context", "described", "economic", "effective", "founded", "functions", "government", "institutions", "management", "nonprofit", "organization", "organizations", "partnerships", "performance", "policies".... | EXACT TITLE in government_civic: "Public administration".
0.500
associationcanalcreatedenvironmentalespeciallyindustriallandmobilitymultipleparkparksrightsruralserveservesurbanutility
SHARED TOKENS (17): "association", "canal", "created", "environmental", "especially", "industrial", "land", "mobility", "multiple", "park", "parks", "rights", "rural", "serve", "serves", "urban", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
airairportcanyoncivilconstructionemergencygeneralhomeidahoindustrialintegratedmilitarymissionmunicipalnampanationalplanprivatepublicriver
SHARED TOKENS (22): "air", "airport", "canyon", "civil", "construction", "emergency", "general", "home", "idaho", "industrial", "integrated", "military", "mission", "municipal", "nampa", "national", "plan", "private", "public", "river".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
authoritybecomeboardbodiesbuildingcodecommissioncommissionersconsolidatedcontrolcouncilcountiesdistinctelectedenforcementestablishevenexecutivefiscalgovernment
SHARED TOKENS (40): "authority", "become", "board", "bodies", "building", "code", "commission", "commissioners", "consolidated", "control", "council", "counties", "distinct", "elected", "enforcement", "establish", "even", "executive", "fiscal", "government".... | EXACT TITLE in transportation_infrastructure: "County commission". | EXACT TITLE in government_civic: "County commission".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomecapacitycentralcitiescontainsenvironmentalformationindustrialinfluencelandlevelmajormovementmultiplemunicipaloperatingpercentpipelines
SHARED TOKENS (34): "agricultural", "agriculture", "become", "capacity", "central", "cities", "contains", "environmental", "formation", "industrial", "influence", "land", "level", "major", "movement", "multiple", "municipal", "operating", "percent", "pipelines".... | EXACT TITLE in government_civic: "Groundwater".
0.500
airbuildingcenterscommercialcoordinatedeliverydemanddirectlyequipmentfacilityfirmsfunctionlaborlargelogisticsmarketnetworkoperateoperatesorganizations
SHARED TOKENS (30): "air", "building", "centers", "commercial", "coordinate", "delivery", "demand", "directly", "equipment", "facility", "firms", "function", "labor", "large", "logistics", "market", "network", "operate", "operates", "organizations".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
actadministrationassetsauthorityboardbodiesbodybudgetcentralcitiescommunitycontrolcouncilcountiesdefinesdefinitionsdifferentdistrictselectedentities
SHARED TOKENS (65): "act", "administration", "assets", "authority", "board", "bodies", "body", "budget", "central", "cities", "community", "control", "council", "counties", "defines", "definitions", "different", "districts", "elected", "entities".... | EXACT TITLE in transportation_infrastructure: "Local government". | EXACT TITLE in government_civic: "Local government".
0.500
Zoning ↗ Q702232 EXACT TITLE
buildingcertaindeterminedevelopeddevelopmentdifferentdiffersgoverngovernmentgovernmentsgrowthindustriallandland-uselocalmethodplacesplanningpolicyproperty
SHARED TOKENS (31): "building", "certain", "determine", "developed", "development", "different", "differs", "govern", "government", "governments", "growth", "industrial", "land", "land-use", "local", "method", "places", "planning", "policy", "property".... | EXACT TITLE in transportation_infrastructure: "Zoning". | EXACT TITLE in government_civic: "Zoning".
0.500
ambulanceauthorityboundariescontainsdepartmentdepartmentsdistrictoperatesorganizationorganizationspersonnelprivateprofessionalpublicrescue
SHARED TOKENS (15): "ambulance", "authority", "boundaries", "contains", "department", "departments", "district", "operates", "organization", "organizations", "personnel", "private", "professional", "public", "rescue". | EXACT TITLE in government_civic: "Fire department".
0.500
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalhighintegratedlevelnetworkplannedproviderequirementstechnologytelecommunicationstransferuses
SHARED TOKENS (16): "access", "context", "data", "different", "digital", "high", "integrated", "level", "network", "planned", "provide", "requirements", "technology", "telecommunications", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
authoritybodiesbodycommissioncommissionsdecisionsdevelopmenteconomicfinancialgovernmentjurisdictionland-uselocalplanningplanspolicypubliczoning
SHARED TOKENS (18): "authority", "bodies", "body", "commission", "commissions", "decisions", "development", "economic", "financial", "government", "jurisdiction", "land-use", "local", "planning", "plans", "policy", "public", "zoning". | EXACT TITLE in government_civic: "Planning Commission".
0.500
actagencyappliedbecomebuiltdeliverydepartmentdevelopmentestablishedfarmlandfederalfundinggovernmentirrigationlawmanagementoverseespotentialpowerprogram
SHARED TOKENS (30): "act", "agency", "applied", "become", "built", "delivery", "department", "development", "established", "farmland", "federal", "funding", "government", "irrigation", "law", "management", "oversees", "potential", "power", "program".... | EXACT TITLE in government_civic: "Bureau of Reclamation".
0.500
certaincitiesdevelopmenteconomicenvironmentalfarmlandgrowthindustrialinfrastructurelandland-uselawslevelmanagementmilitarynationalneedsnetworkplacementplanning
SHARED TOKENS (32): "certain", "cities", "development", "economic", "environmental", "farmland", "growth", "industrial", "infrastructure", "land", "land-use", "laws", "level", "management", "military", "national", "needs", "network", "placement", "planning".... | EXACT TITLE in transportation_infrastructure: "Regional planning". | EXACT TITLE in government_civic: "Regional planning".
0.500
accessagenciesbridgescommunityconditionscreateddevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentalespeciallyessentialfacilitiesfirmsfocused
SHARED TOKENS (52): "access", "agencies", "bridges", "community", "conditions", "created", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environmental", "especially", "essential", "facilities", "firms", "focused".... | EXACT TITLE in transportation_infrastructure: "Infrastructure". | EXACT TITLE in government_civic: "Infrastructure".
0.500
agriculturalconcentrateddemographicdevelopeddevelopmentdirectenvironmentalestimatesfocusedgrowinggrowthhighimpactincreaseinternationallivingmedicalpolicypopulationpotential
SHARED TOKENS (30): "agricultural", "concentrated", "demographic", "developed", "development", "direct", "environmental", "estimates", "focused", "growing", "growth", "high", "impact", "increase", "international", "living", "medical", "policy", "population", "potential".... | EXACT TITLE in transportation_infrastructure: "Population growth". | EXACT TITLE in government_civic: "Population growth".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomebodiescitiescreatedemanddevelopeddirectlylandlargemajorpopulationpotentialresourcetermstimingtreatmenturbanwater
SHARED TOKENS (18): "become", "bodies", "cities", "create", "demand", "developed", "directly", "land", "large", "major", "population", "potential", "resource", "terms", "timing", "treatment", "urban", "water". | EXACT TITLE in government_civic: "Stormwater".
0.500
addressingbusinessescitiesconstructioneconomicgovernmentgrowthhousinginfrastructurelandprivateprocessprojectspublicurban
SHARED TOKENS (15): "addressing", "businesses", "cities", "construction", "economic", "government", "growth", "housing", "infrastructure", "land", "private", "process", "projects", "public", "urban". | EXACT TITLE in government_civic: "Urban renewal".
0.500
amongbodycommissioncommissionsdistrictdivisionespeciallylegalmeansoperatepublicpubliclyregulatedregulationregulatoryservesutilitiesutility
SHARED TOKENS (18): "among", "body", "commission", "commissions", "district", "division", "especially", "legal", "means", "operate", "public", "publicly", "regulated", "regulation", "regulatory", "serves", "utilities", "utility". | EXACT TITLE in government_civic: "Public utilities commission".
0.500
actadministrationagencyassistancecommissioncreatedelectionequipmentgovernmentindependentinformationnationalregistrationrequirementsresourceservessystem
SHARED TOKENS (17): "act", "administration", "agency", "assistance", "commission", "created", "election", "equipment", "government", "independent", "information", "national", "registration", "requirements", "resource", "serves", "system". | EXACT TITLE in government_civic: "Election Assistance Commission".
0.500
architecturebecomecitiescreatecreatescurrentdescribesdevelopeddevelopmenteconomiceconomicseducationenvironmentalequivalentessentialforecastgeographygrowthhealthimpact
SHARED TOKENS (55): "architecture", "become", "cities", "create", "creates", "current", "describes", "developed", "development", "economic", "economics", "education", "environmental", "equivalent", "essential", "forecast", "geography", "growth", "health", "impact".... | EXACT TITLE in government_civic: "Urbanization".
0.500
abilityaccessaddressingamongbusinessescapacitycitiescommunitydevelopersdevelopmentdevelopseconomiceducationemployersformalfoundedgovernmenthistoryhomeincrease
SHARED TOKENS (44): "ability", "access", "addressing", "among", "businesses", "capacity", "cities", "community", "developers", "development", "develops", "economic", "education", "employers", "formal", "founded", "government", "history", "home", "increase".... | EXACT TITLE in transportation_infrastructure: "Workforce development". | EXACT TITLE in government_civic: "Workforce development".
0.500
accordingcommunitydescribesdevelopmenteconomiceconomicsespeciallyfocusedgrowthincreasesinfrastructurelocalmarketpoliciespolicyprocessqualityreductionregionterms
SHARED TOKENS (21): "according", "community", "describes", "development", "economic", "economics", "especially", "focused", "growth", "increases", "infrastructure", "local", "market", "policies", "policy", "process", "quality", "reduction", "region", "terms".... | EXACT TITLE in transportation_infrastructure: "Economic development". | EXACT TITLE in government_civic: "Economic development".
0.500
articlechaincomplexconsumercreatingcustomersdirectdirectlyfacilitiesindependentlinkedlogisticsmanagementmaterialsnetworkstructuresupplysystemsystemsthem
SHARED TOKENS (21): "article", "chain", "complex", "consumer", "creating", "customers", "direct", "directly", "facilities", "independent", "linked", "logistics", "management", "materials", "network", "structure", "supply", "system", "systems", "them".... | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyairassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalgovernmentinternationalorganizationpersonnelpowerssettingstandardssurrounding
SHARED TOKENS (22): "administration", "agency", "air", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "government", "international", "organization", "personnel", "powers", "setting", "standards", "surrounding".... | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
Rulemaking ↗ Q2479254 EXACT TITLE
agenciesbranchbroadcreatecreatedcriticalenvironmentalexecutivegeneralgovernmentgrowthindependentlawmeanspolicyprocessprogramssafetystatutes
SHARED TOKENS (19): "agencies", "branch", "broad", "create", "created", "critical", "environmental", "executive", "general", "government", "growth", "independent", "law", "means", "policy", "process", "programs", "safety", "statutes". | EXACT TITLE in government_civic: "Rulemaking".
0.500
acquiredadditionalairextendsformationhistoryindependentinternationallinesmajornetworkoperatesoperatingprincipalregionalstar
SHARED TOKENS (16): "acquired", "additional", "air", "extends", "formation", "history", "independent", "international", "lines", "major", "network", "operates", "operating", "principal", "regional", "star". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
authorityestategoverninggovernmentimprovementsjurisdictionjurisdictionslandlevymultiplenationalpropertyraterealregionrequiressystemtaxtransactiontransfer
SHARED TOKENS (22): "authority", "estate", "governing", "government", "improvements", "jurisdiction", "jurisdictions", "land", "levy", "multiple", "national", "property", "rate", "real", "region", "requires", "system", "tax", "transaction", "transfer".... | EXACT TITLE in transportation_infrastructure: "Property tax". | EXACT TITLE in government_civic: "Property tax".
0.500
administeredadministrationaffectdetermineeffectiveelectionimplementinginstitutionaljurisdictionjurisdictionsprocessqualityrulesshapevoters
SHARED TOKENS (15): "administered", "administration", "affect", "determine", "effective", "election", "implementing", "institutional", "jurisdiction", "jurisdictions", "process", "quality", "rules", "shape", "voters". | EXACT TITLE in government_civic: "Election administration".
0.500
administrationagencyairairportauthoritybudgetcertainconnectingcreateddatadepartmentdevelopsenforcementfacilitiesfederalfiscalgovernmenthighwayslawlocal
SHARED TOKENS (39): "administration", "agency", "air", "airport", "authority", "budget", "certain", "connecting", "created", "data", "department", "develops", "enforcement", "facilities", "federal", "fiscal", "government", "highways", "law", "local".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherchaincivilcollectioncostscustomersequipmentfacilityinformationlineslogisticsmanagementmaterialmaterialsmilitarymodelmovementneedsoperational
SHARED TOKENS (33): "according", "another", "chain", "civil", "collection", "costs", "customers", "equipment", "facility", "information", "lines", "logistics", "management", "material", "materials", "military", "model", "movement", "needs", "operational".... | EXACT TITLE in transportation_infrastructure: "Logistics". | EXACT TITLE in government_civic: "Logistics".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmenteconomicfeefeesfundgovernmentgrowthimpactimprovementsjurisdictionslocalpopulationprojectproposedprovidingpublic
SHARED TOKENS (19): "capital", "construction", "costs", "development", "economic", "fee", "fees", "fund", "government", "growth", "impact", "improvements", "jurisdictions", "local", "population", "project", "proposed", "providing", "public". | EXACT TITLE in transportation_infrastructure: "Impact fee". | EXACT TITLE in government_civic: "Impact fee".
0.500
accordingactamongarticleauthorityboundariescommissionscreateddecisionsdistrictdistrictsearlyelectedelectoralestablishfederalindependentlegislaturelevelpopulation
SHARED TOKENS (25): "according", "act", "among", "article", "authority", "boundaries", "commissions", "created", "decisions", "district", "districts", "early", "elected", "electoral", "establish", "federal", "independent", "legislature", "level", "population".... | EXACT TITLE in government_civic: "Redistricting".
0.500
appliedconstructioncontextcontroldescribedequipmentfunctionshydraulicindustrialinformationlaborlargeoperationspowerprimarysourcestructuresystemsuses
SHARED TOKENS (19): "applied", "construction", "context", "control", "described", "equipment", "functions", "hydraulic", "industrial", "information", "labor", "large", "operations", "power", "primary", "source", "structure", "systems", "uses". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
articlebridgescontrolsdesigndifferentintersectionjurisdictionslanemajorpracticeprimarilyroadroadsseparatespecifiedtrafficuses
SHARED TOKENS (17): "article", "bridges", "controls", "design", "different", "intersection", "jurisdictions", "lane", "major", "practice", "primarily", "road", "roads", "separate", "specified", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)". | EXACT TITLE in government_civic: "Intersection (road)".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
associatedcitiescreatingearlymobilitynetworkpedestrianprofessionalrecordroadsruralsafetysidewalksstreetstrafficurban
SHARED TOKENS (16): "associated", "cities", "creating", "early", "mobility", "network", "pedestrian", "professional", "record", "roads", "rural", "safety", "sidewalks", "streets", "traffic", "urban". | EXACT TITLE in transportation_infrastructure: "Pedestrian". | EXACT TITLE in government_civic: "Pedestrian".
0.500
accessactauthoritiescentersdepartmentsdetermineddriveelectionelectoraleligibilityevenevidencegoverninginformationjurisdictionslawlawslicensenationalplaces
SHARED TOKENS (35): "access", "act", "authorities", "centers", "departments", "determined", "drive", "election", "electoral", "eligibility", "even", "evidence", "governing", "information", "jurisdictions", "law", "laws", "license", "national", "places".... | EXACT TITLE in government_civic: "Voter registration".
0.500
departmentfacilitiesfederalfundshighwayhighwaysidentifiedinterstatelocalmajormetropolitanmilitarynationalnetworkorganizationspipelineplanningroadssafetystrategic
SHARED TOKENS (22): "department", "facilities", "federal", "funds", "highway", "highways", "identified", "interstate", "local", "major", "metropolitan", "military", "national", "network", "organizations", "pipeline", "planning", "roads", "safety", "strategic".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
federalfederallyfundingimprovementlong-rangemetropolitanorganizationsplanplanningplansprogramprojectsregionalrequirementtransportation
SHARED TOKENS (15): "federal", "federally", "funding", "improvement", "long-range", "metropolitan", "organizations", "plan", "planning", "plans", "program", "projects", "regional", "requirement", "transportation". | EXACT TITLE in government_civic: "Transportation improvement program".
0.500
accordingauthoritybeganboundariescertaincitiescivilconcentratedconsolidatedcouncilscountiesdifferentdistrictdistrictsentitiesequivalentexistingfurthergovernmentgovernments
SHARED TOKENS (40): "according", "authority", "began", "boundaries", "certain", "cities", "civil", "concentrated", "consolidated", "councils", "counties", "different", "district", "districts", "entities", "equivalent", "existing", "further", "government", "governments".... | EXACT TITLE in transportation_infrastructure: "County (United States)". | EXACT TITLE in government_civic: "County (United States)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcommunicationsconstructiondevelopmentdigitalengineeringequipmentestablishgeometrygovernmenthistorylandlawlegalmapsownershipplanningpoints
SHARED TOKENS (28): "analysis", "boundaries", "civil", "communications", "construction", "development", "digital", "engineering", "equipment", "establish", "geometry", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "points".... | EXACT TITLE in transportation_infrastructure: "Surveying".
0.500
agenciesconsumercreatedelectedenforcemententitiesgeneralidaholawlawslegallocalofficeownershippropertyproviderepresentation
SHARED TOKENS (17): "agencies", "consumer", "created", "elected", "enforcement", "entities", "general", "idaho", "law", "laws", "legal", "local", "office", "ownership", "property", "provide", "representation". | EXACT TITLE in government_civic: "Idaho Attorney General".
0.500
actadministeradministrationagenciesagencyassistancecivilcreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublic
SHARED TOKENS (26): "act", "administer", "administration", "agencies", "agency", "assistance", "civil", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
actaddressingadministeredagencyassistancecodifiedcontroldirectlyengineersenvironmentalfederalfundinggoverninggovernmentsimplementingimprovementlawlawslegislationmajor
SHARED TOKENS (32): "act", "addressing", "administered", "agency", "assistance", "codified", "control", "directly", "engineers", "environmental", "federal", "funding", "governing", "governments", "implementing", "improvement", "law", "laws", "legislation", "major".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureappliescentralcollectionconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddownstreamdrainageenvironmentalfullgrowthhighimprovementsirrigation
SHARED TOKENS (36): "agricultural", "agriculture", "applies", "central", "collection", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "downstream", "drainage", "environmental", "full", "growth", "high", "improvements", "irrigation".... | EXACT TITLE in transportation_infrastructure: "Irrigation". | EXACT TITLE in government_civic: "Irrigation".
0.500
abilityaffectsagencyauthoritybodybusinessescertainconstructioncontractsdirecteconomiceconomyestimatedgovernmentgovernmentsgrowthinternationalissuelawslocal
SHARED TOKENS (39): "ability", "affects", "agency", "authority", "body", "businesses", "certain", "construction", "contracts", "direct", "economic", "economy", "estimated", "government", "governments", "growth", "international", "issue", "laws", "local".... | EXACT TITLE in government_civic: "Government procurement".
0.500
accessbegancommunicationsdatadevelopersdevelopmentdigitalearlyelectricelectricalfurtherindependentinformationmeansmediaphysicalpowersingletechnologytelecommunications
SHARED TOKENS (20): "access", "began", "communications", "data", "developers", "development", "digital", "early", "electric", "electrical", "further", "independent", "information", "means", "media", "physical", "power", "single", "technology", "telecommunications". | EXACT TITLE in transportation_infrastructure: "Telecommunications". | EXACT TITLE in government_civic: "Telecommunications".
0.500
agenciesbridgesbuiltcanalscivilconstructiondepartmentsdesigndistinguishengineeringfirmsfocusedgovernmentinfrastructurelocallymaintenancemilitarymunicipalnationalphysical
SHARED TOKENS (27): "agencies", "bridges", "built", "canals", "civil", "construction", "departments", "design", "distinguish", "engineering", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "military", "municipal", "national", "physical".... | EXACT TITLE in transportation_infrastructure: "Civil engineering". | EXACT TITLE in government_civic: "Civil engineering".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalboardbusinesscorporationdirectlyexecutivefederalfiscalfoundedlinesmetropolitanmilesnationalnetworkoperateoperatesoperatororganizationrailroadreporting
SHARED TOKENS (26): "additional", "board", "business", "corporation", "directly", "executive", "federal", "fiscal", "founded", "lines", "metropolitan", "miles", "national", "network", "operate", "operates", "operator", "organization", "railroad", "reporting".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
academicadministrationagenciesanalysiscertaincivilcomplexcreateddatadecisiondecisionsdesigndevelopeddirecteconomiceconomicseducationelectedemploymentengineers
SHARED TOKENS (50): "academic", "administration", "agencies", "analysis", "certain", "civil", "complex", "created", "data", "decision", "decisions", "design", "developed", "direct", "economic", "economics", "education", "elected", "employment", "engineers".... | EXACT TITLE in government_civic: "Public policy".
0.500
academicallocationamongauthoritiesbroadcentraldecisiondirecteconomiceconomicseconomyfinanceframeworkgovernmentgovernmentsmarketpolicypublicresearchresources
SHARED TOKENS (24): "academic", "allocation", "among", "authorities", "broad", "central", "decision", "direct", "economic", "economics", "economy", "finance", "framework", "government", "governments", "market", "policy", "public", "research", "resources".... | EXACT TITLE in government_civic: "Public finance".
0.500
accessagenciesbeyondcitiescommunitycustomersdevelopedeconomicextendsfixedformalgovernmentlocalmetropolitanmobilityoperateoperatedoperatesoperatorsorganizations
SHARED TOKENS (30): "access", "agencies", "beyond", "cities", "community", "customers", "developed", "economic", "extends", "fixed", "formal", "government", "local", "metropolitan", "mobility", "operate", "operated", "operates", "operators", "organizations".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.480
districtdistrictsentitiesfiscalfunctionfunctionsgovernmentsindependentlocalmunicipalschoolseparatelysinglesubstantial
SHARED TOKENS (14): "district", "districts", "entities", "fiscal", "function", "functions", "governments", "independent", "local", "municipal", "school", "separately", "single", "substantial". | EXACT TITLE in government_civic: "Special district (United States)".
0.480
differshighwayhighwaysintersectionmovementpermitroadroadsroutesstreetssystemthoughtrafficuses
SHARED TOKENS (14): "differs", "highway", "highways", "intersection", "movement", "permit", "road", "roads", "routes", "streets", "system", "though", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.480
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbusinessescitiesdirectlyfacilityfunctionindustriallargematerialsparksproductionwarehouses
SHARED TOKENS (14): "agriculture", "associated", "building", "businesses", "cities", "directly", "facility", "function", "industrial", "large", "materials", "parks", "production", "warehouses". | EXACT TITLE in transportation_infrastructure: "Warehouse". | EXACT TITLE in government_civic: "Warehouse".
0.480
assistancecannotestablishedfederalfullgovernmentgovernmentslegalofficeprovideprovidingpublicrepresentationrequires
SHARED TOKENS (14): "assistance", "cannot", "established", "federal", "full", "government", "governments", "legal", "office", "provide", "providing", "public", "representation", "requires". | EXACT TITLE in government_civic: "Public defender".
0.460
boisebranchchambersdatadistrictdistrictsevengovernmentidaholegislaturepopulationresidentssingle
SHARED TOKENS (13): "boise", "branch", "chambers", "data", "district", "districts", "even", "government", "idaho", "legislature", "population", "residents", "single". | EXACT TITLE in government_civic: "Idaho Legislature".
0.460
actappealsboisecivildistrictfederalgovernmentidahojurisdictionnationalofficeparkwhose
SHARED TOKENS (13): "act", "appeals", "boise", "civil", "district", "federal", "government", "idaho", "jurisdiction", "national", "office", "park", "whose". | EXACT TITLE in government_civic: "United States District Court for the District of Idaho".
0.440
Utility ↗ Q466707 EXACT TITLE
amongcertaincontextdecisiondevelopeddistincteconomicsfunctionfunctionsrelationshipsourceutility
SHARED TOKENS (12): "among", "certain", "context", "decision", "developed", "distinct", "economics", "function", "functions", "relationship", "source", "utility". | EXACT TITLE in transportation_infrastructure: "Utility". | EXACT TITLE in government_civic: "Utility".
0.440
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbodycontroldevelopedfloodfloodplainhighlandriverurbanvalleywater
SHARED TOKENS (12): "agricultural", "body", "control", "developed", "flood", "floodplain", "high", "land", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain". | EXACT TITLE in government_civic: "Floodplain".
0.400
activityaddressingciviccommunitygovernmentparticipationprocesspublicqualitytogether
SHARED TOKENS (10): "activity", "addressing", "civic", "community", "government", "participation", "process", "public", "quality", "together". | EXACT TITLE in government_civic: "Civic engagement".
0.400
differentespeciallyirrigationlawlegalphysicalriversourcesystemswater
SHARED TOKENS (10): "different", "especially", "irrigation", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in government_civic: "Water right".
0.380
Wastewater ↗ Q336191 EXACT TITLE
agriculturalanothercommercialcommunityindustrialmunicipalsewerwastewater
SHARED TOKENS (9): "agricultural", "another", "commercial", "community", "industrial", "municipal", "sewer", "waste", "water". | EXACT TITLE in government_civic: "Wastewater".
0.380
Sidewalk ↗ Q177749 EXACT TITLE
landmobilitypedestrianprimarilyprivateroadroadwaysidewalksvehicle
SHARED TOKENS (9): "land", "mobility", "pedestrian", "primarily", "private", "road", "roadway", "sidewalks", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk". | EXACT TITLE in government_civic: "Sidewalk".
0.360
electionfinalmanagementofficialproceduresprocessqualityreview
SHARED TOKENS (8): "election", "final", "management", "official", "procedures", "process", "quality", "review". | EXACT TITLE in government_civic: "Election audit".
0.360
containsdirectlydistrictprimarilyprimaryremainsriverwest
SHARED TOKENS (8): "contains", "directly", "district", "primarily", "primary", "remains", "river", "west". | EXACT TITLE in government_civic: "West Nile virus".
0.360
Boise River ↗ Q891080 EXACT TITLE
agriculturalboisedrainsidahomilesriverurbanwestern
SHARED TOKENS (8): "agricultural", "boise", "drains", "idaho", "miles", "river", "urban", "western". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.340
Snowplow ↗ Q14976 EXACT TITLE
especiallyintendedlargereceivestreetstransportationvehicle
SHARED TOKENS (7): "especially", "intended", "large", "receive", "streets", "transportation", "vehicle". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.340
branchcivilengineeringnetworktelecommunicationstraffictransportation
SHARED TOKENS (7): "branch", "civil", "engineering", "network", "telecommunications", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.340
Mitigation ↗ Q6881760 EXACT TITLE
emergencylawmanagementmeasuresmitigationreductionremain
SHARED TOKENS (7): "emergency", "law", "management", "measures", "mitigation", "reduction", "remain". | EXACT TITLE in transportation_infrastructure: "Mitigation". | EXACT TITLE in government_civic: "Mitigation".
0.320
Sheriff ↗ Q578478 EXACT TITLE
developedexistinggovernmenthistoricalofficeofficial
SHARED TOKENS (6): "developed", "existing", "government", "historical", "office", "official". | EXACT TITLE in transportation_infrastructure: "Sheriff". | EXACT TITLE in government_civic: "Sheriff".
0.320
agencybodycivilformalgovernmentlaw
SHARED TOKENS (6): "agency", "body", "civil", "formal", "government", "law". | EXACT TITLE in government_civic: "Hearing (law)".
0.310
branchcurrentelectedexecutivegovernmentidahoofficeposition
SHARED TOKENS (8): "branch", "current", "elected", "executive", "government", "idaho", "office", "position". | URL->B (1): https://sos.idaho.gov/.
0.300
accesschaincostsdirecteconomicsespeciallygeneralhighwayintendedinternationalitselflogisticsmaterialoperatingpracticeregionspecializedtransportation
SHARED TOKENS (18): "access", "chain", "costs", "direct", "economics", "especially", "general", "highway", "intended", "international", "itself", "logistics", "material", "operating", "practice", "region", "specialized", "transportation".
0.300
activityadvocacyagencybecomebodiescomplexelectionestimatedexecutivefederalfirmsgovernancegovernmentgovernmentsindependentinfluencelegislationlevellocalmunicipal
SHARED TOKENS (32): "activity", "advocacy", "agency", "become", "bodies", "complex", "election", "estimated", "executive", "federal", "firms", "governance", "government", "governments", "independent", "influence", "legislation", "level", "local", "municipal"....
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesignengineersfullimprovementincreaseintersectionlinesneedpedestrianrequireresearchroadrulessafetysignificantthemtraffic
SHARED TOKENS (21): "associated", "become", "central", "design", "engineers", "full", "improvement", "increase", "intersection", "lines", "need", "pedestrian", "require", "research", "road", "rules", "safety", "significant", "them", "traffic"....
0.300
actadministeramongassociationauthorityconstructioncontractscoveredcreateddepartmentestablishedfederalfundirrigationlandlawmaintenancemajormeridiannational
SHARED TOKENS (34): "act", "administer", "among", "association", "authority", "construction", "contracts", "covered", "created", "department", "established", "federal", "fund", "irrigation", "land", "law", "maintenance", "major", "meridian", "national"....
0.300
accordingcreatingdemandfixedfunctionsmedicalmovementneedsnetworkolderprivateprogramsprovidepublicratherrelevantroutesruralsharedtechnology
SHARED TOKENS (21): "according", "creating", "demand", "fixed", "functions", "medical", "movement", "needs", "network", "older", "private", "programs", "provide", "public", "rather", "relevant", "routes", "rural", "shared", "technology"....
0.300
agencybusinessbusinessescommunitycurrentdatadecisionsdepartmentdepartmentseconomiceconomyfederalfundsgovernmentinformationinfrastructurelocalmakingmissionplan
SHARED TOKENS (31): "agency", "business", "businesses", "community", "current", "data", "decisions", "department", "departments", "economic", "economy", "federal", "funds", "government", "information", "infrastructure", "local", "making", "mission", "plan"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralchargescitiesconnectingdifferentdistrictselectricinsidelinesmetropolitanmultipleoperateoperatesprimarilyregionalsystemstransiturbanzone
SHARED TOKENS (20): "business", "central", "charges", "cities", "connecting", "different", "districts", "electric", "inside", "lines", "metropolitan", "multiple", "operate", "operates", "primarily", "regional", "systems", "transit", "urban", "zone".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
appliedclassificationscontrolcriticalenforcementeventhealthidentifiedimpactlevelmeasuresoccupationalpedestrianprovidingpublicreductionremainroadroadsrural
SHARED TOKENS (29): "applied", "classifications", "control", "critical", "enforcement", "event", "health", "identified", "impact", "level", "measures", "occupational", "pedestrian", "providing", "public", "reduction", "remain", "road", "roads", "rural"....
0.300
accessactbodiescertaincostdatadecisiondevelopmententitiesestablishgeneralgovernmentgrantinformationinstitutionslawslegallegislationmakingmatters
SHARED TOKENS (29): "access", "act", "bodies", "certain", "cost", "data", "decision", "development", "entities", "establish", "general", "government", "grant", "information", "institutions", "laws", "legal", "legislation", "making", "matters"....
0.300
buildingbusinesscentraldevelopmentgrowthincreaseintegratedlandnetworkplanningprivatepublicrelationshipresidentialscaletransiturban
SHARED TOKENS (17): "building", "business", "central", "development", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "relationship", "residential", "scale", "transit", "urban".
0.300
activityadministrationagenciesanotherbodiesbranchbuiltcivilcontrolcoordinatecreateddecisionsdivisioneconomiceducationenforcementenvironmentalexecutivefurthergoverning
SHARED TOKENS (37): "activity", "administration", "agencies", "another", "bodies", "branch", "built", "civil", "control", "coordinate", "created", "decisions", "division", "economic", "education", "enforcement", "environmental", "executive", "further", "governing"....
0.300
aircreatefuelgasuses
SHARED TOKENS (5): "air", "create", "fuel", "gas", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.300
authorityboundariescooperativecorporationcreateddistrictdistrictsentitygovernmentirrigationlandownerslargelegislaturelocalpowerprojectspublicstatutesubdivisiontax
SHARED TOKENS (22): "authority", "boundaries", "cooperative", "corporation", "created", "district", "districts", "entity", "government", "irrigation", "landowners", "large", "legislature", "local", "power", "projects", "public", "statute", "subdivision", "tax"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
bridgesbusinessconnectedcurrentespeciallyestablishedfurtherhighwaysidahoimprovementsinterstatemakingownerspointsrailroadriverroadsroutesseparateserve
SHARED TOKENS (25): "bridges", "business", "connected", "current", "especially", "established", "further", "highways", "idaho", "improvements", "interstate", "making", "owners", "points", "railroad", "river", "roads", "routes", "separate", "serve"....
0.300
becomedesignengineeringengineersespeciallygrowingmeasuresphysicalplannersresponsibleroadroadsrulesafetytrafficurbanuses
SHARED TOKENS (17): "become", "design", "engineering", "engineers", "especially", "growing", "measures", "physical", "planners", "responsible", "road", "roads", "rule", "safety", "traffic", "urban", "uses".
0.300
accessibleadministrationagencyairanotherbranchbuildingcenterscommercialconstructiondepartmentdivisiondriveeconomyeducationenvironmentalfederalgoverninggovernshealth
SHARED TOKENS (51): "accessible", "administration", "agency", "air", "another", "branch", "building", "centers", "commercial", "construction", "department", "division", "drive", "economy", "education", "environmental", "federal", "governing", "governs", "health"....
0.300
collegecommunityeconomiceducationformalfurthergeneralknowledgelevelprovideschoolschoolsspecializedstudiestechnicaltechnologytraining
SHARED TOKENS (17): "college", "community", "economic", "education", "formal", "further", "general", "knowledge", "level", "provide", "school", "schools", "specialized", "studies", "technical", "technology", "training".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycanalscertaincreateddifferentestatefacilityfullgovernmenthighwayhighwayslandlegallineslocaloperateownershipphysicalprivatereal
SHARED TOKENS (30): "authority", "canals", "certain", "created", "different", "estate", "facility", "full", "government", "highway", "highways", "land", "legal", "lines", "local", "operate", "ownership", "physical", "private", "real"....
0.300
actappliedassociationauthoritycentralcitiescommunityconditionsconflictscostscreatingdependdependsdesigndevelopmentdistrictseconomicenvironmentalessentialexposure
SHARED TOKENS (52): "act", "applied", "association", "authority", "central", "cities", "community", "conditions", "conflicts", "costs", "creating", "depend", "depends", "design", "development", "districts", "economic", "environmental", "essential", "exposure"....
0.300
actadministrationagencycommissioncommissionerscreateddescribeselectionfederalfinancefunctionfundinggovernmentindependentinformationlawlawsoverseesperiodpublic
SHARED TOKENS (22): "act", "administration", "agency", "commission", "commissioners", "created", "describes", "election", "federal", "finance", "function", "funding", "government", "independent", "information", "law", "laws", "oversees", "period", "public"....
0.300
anotherarticlebecomecapacitycongestiondemanddepartmentsfixedhighlanemodeledplanningpublicroadroadstraffictransportationurban
SHARED TOKENS (18): "another", "article", "become", "capacity", "congestion", "demand", "departments", "fixed", "high", "lane", "modeled", "planning", "public", "road", "roads", "traffic", "transportation", "urban".
0.300
adoptedappliedcapacitycollectionconditionscoordinateddifferentemergencyincreaseinformationinfrastructurelawsmanagementmobilityprovideroadroadssafetysystemsystems
SHARED TOKENS (23): "adopted", "applied", "capacity", "collection", "conditions", "coordinated", "different", "emergency", "increase", "information", "infrastructure", "laws", "management", "mobility", "provide", "road", "roads", "safety", "system", "systems"....
0.300
assistancecreatedespeciallyevenfacilitiesgovernintersectionjurisdictionslargelawspedestrianpointsroadroadsrulessafetyschoolseparatetogethertraffic
SHARED TOKENS (21): "assistance", "created", "especially", "even", "facilities", "govern", "intersection", "jurisdictions", "large", "laws", "pedestrian", "points", "road", "roads", "rules", "safety", "school", "separate", "together", "traffic"....
0.300
accordingagenciesauthoritiesboardcenterscertainchaptercitiescivilconsolidatedcouncilcountiescreatedatadistrictdistrictselectedentitiesevenfunctions
SHARED TOKENS (53): "according", "agencies", "authorities", "board", "centers", "certain", "chapter", "cities", "civil", "consolidated", "council", "counties", "create", "data", "district", "districts", "elected", "entities", "even", "functions"....
0.300
Public library ↗ Q28564 KW CROSS HIGH
academicaccessaccessibleamongcivilcollectiondistinctearlyessentialformationgeneralinformationlibrarymaterialsneedsopenoperatedperiodpopulationprovide
SHARED TOKENS (29): "academic", "access", "accessible", "among", "civil", "collection", "distinct", "early", "essential", "formation", "general", "information", "library", "materials", "needs", "open", "operated", "period", "population", "provide"....
0.300
appliedappliesapprovalassociationcontextdecisiondecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactinternationalmajormakingmanagementparticipationplan
SHARED TOKENS (37): "applied", "applies", "approval", "association", "context", "decision", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "international", "major", "making", "management", "participation", "plan"....
0.300
accessbuiltcapacitycentralcitiesclassconflictsconnectconnectedconnectingconstructedevenhighwayhighwaysimpliesnetworkparkingpedestrianplannedplans
SHARED TOKENS (37): "access", "built", "capacity", "central", "cities", "class", "conflicts", "connect", "connected", "connecting", "constructed", "even", "highway", "highways", "implies", "network", "parking", "pedestrian", "planned", "plans"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralhighwayidahointersectioninterstatemajormilesnationalofficialparkplannedriverroadroadsruleswestwestern
SHARED TOKENS (18): "caldwell", "general", "highway", "idaho", "intersection", "interstate", "major", "miles", "national", "official", "park", "planned", "river", "road", "roads", "rules", "west", "western".
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciescanyoncentralcommercialconstructedconstructioncontrolcoveredcreateddevelopeddownstreamdrainsfarmlandfloodfurthergovernmentshighhistoryidahoirrigation
SHARED TOKENS (42): "agencies", "canyon", "central", "commercial", "constructed", "construction", "control", "covered", "created", "developed", "downstream", "drains", "farmland", "flood", "further", "governments", "high", "history", "idaho", "irrigation"....
0.300
boiseidahooperatingservethough
SHARED TOKENS (5): "boise", "idaho", "operating", "serve", "though". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.300
departmentdepartmentsdirectlyeconomyexecutivefederalfiscalgovernmentmissionmovementplanreportsstrategicsystemtransportation
SHARED TOKENS (15): "department", "departments", "directly", "economy", "executive", "federal", "fiscal", "government", "mission", "movement", "plan", "reports", "strategic", "system", "transportation".
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalfinancingfoundedgovernmenthomehousinglawspoliciesprogramreportssocietyurban
SHARED TOKENS (19): "administers", "agency", "department", "departments", "development", "directly", "executive", "federal", "financing", "founded", "government", "home", "housing", "laws", "policies", "program", "reports", "society", "urban".
0.300
academicanalysisassociatedassociationbehavioralbodiesdistinctevidencegovernancehistoricalhistorylawlawsmeanspowerprimarilyresearchrolesignificantspecialists
SHARED TOKENS (26): "academic", "analysis", "associated", "association", "behavioral", "bodies", "distinct", "evidence", "governance", "historical", "history", "law", "laws", "means", "power", "primarily", "research", "role", "significant", "specialists"....
0.300
connectscurrentcustomersdeliverydirectdirectlydistinctelectricelectricalenergyevenincreaselevellineslocalmajormarketmovementnetworkpower
SHARED TOKENS (24): "connects", "current", "customers", "delivery", "direct", "directly", "distinct", "electric", "electrical", "energy", "even", "increase", "level", "lines", "local", "major", "market", "movement", "network", "power"....
0.300
accessibilityactadabroadbusinesscivilcostscouncilcoveredeffectiveemployersfinallawnationalprovidepublicrequirementsrequiresrightssupported
SHARED TOKENS (20): "accessibility", "act", "ada", "broad", "business", "civil", "costs", "council", "covered", "effective", "employers", "final", "law", "national", "provide", "public", "requirements", "requires", "rights", "supported".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
capacitycontrolinformationintersectionlanelawslevellocalnationalneedpedestrianpoliceroadsystemsystemstechnologytraffic
SHARED TOKENS (17): "capacity", "control", "information", "intersection", "lane", "laws", "level", "local", "national", "need", "pedestrian", "police", "road", "system", "systems", "technology", "traffic".
0.300
airbuildingcertainconditionscreatesevengashazardoushealthmaterialspersonnelphysicalpropertypublicriskssafetysystemthemwaste
SHARED TOKENS (19): "air", "building", "certain", "conditions", "creates", "even", "gas", "hazardous", "health", "materials", "personnel", "physical", "property", "public", "risks", "safety", "system", "them", "waste".
0.300
classcorporationcreatefoundeditselfmilesnetworkoperatesoperatingplansprincipalprojectrailroadreachreportingroadroutessystemtransportationwest
SHARED TOKENS (21): "class", "corporation", "create", "founded", "itself", "miles", "network", "operates", "operating", "plans", "principal", "project", "railroad", "reach", "reporting", "road", "routes", "system", "transportation", "west"....
0.300
accessactadditionaladministrationadoptedbeganbranchbuiltcollectionconstructioncontrolledcostcreatingdesigndevelopedequivalentestablishedextendsfederalfuel
SHARED TOKENS (50): "access", "act", "additional", "administration", "adopted", "began", "branch", "built", "collection", "construction", "controlled", "cost", "creating", "design", "developed", "equivalent", "established", "extends", "federal", "fuel"....
0.300
activityaffectaffectinganotherassociatedbecomeconcerningconditionsconflictscontextcreatecreatesdecisiondecisionsdirectespeciallyestablishedevidencefinancialhealth
SHARED TOKENS (43): "activity", "affect", "affecting", "another", "associated", "become", "concerning", "conditions", "conflicts", "context", "create", "creates", "decision", "decisions", "direct", "especially", "established", "evidence", "financial", "health"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationadoptedairanalysisanotherarchitecturebuiltbusinesscapitalcategorycitiescivilcodescommunicationscommunitycreatingdesigndevelopmentdifferent
SHARED TOKENS (71): "accessibility", "administration", "adopted", "air", "analysis", "another", "architecture", "built", "business", "capital", "category", "cities", "civil", "codes", "communications", "community", "creating", "design", "development", "different"....
0.300
accordingactivityanalysisbecomesboundariesdesigndocumentationengineeringengineersestablishedgeneralgovernmentjurisdictionslegallegislationlicenselocalmaintenanceplanspractice
SHARED TOKENS (39): "according", "activity", "analysis", "becomes", "boundaries", "design", "documentation", "engineering", "engineers", "established", "general", "government", "jurisdictions", "legal", "legislation", "license", "local", "maintenance", "plans", "practice"....
0.300
academiccollegecommunitydifferenteducationhighinstitutionsopenpolicyprogramsschoolstudentstransferuniversityworkforce
SHARED TOKENS (15): "academic", "college", "community", "different", "education", "high", "institutions", "open", "policy", "programs", "school", "students", "transfer", "university", "workforce".
0.300
accesscannotcommissioncommunicationscontrolcostsdifferentenergyentityespeciallyessentialfederalgasgovernmentinfrastructureissuelargelineslocalmaintains
SHARED TOKENS (39): "access", "cannot", "commission", "communications", "control", "costs", "different", "energy", "entity", "especially", "essential", "federal", "gas", "government", "infrastructure", "issue", "large", "lines", "local", "maintains"....
0.300
activityannualbuildingcandidatecannotcommunitydistrictelectionelectoralevenfacilitiesfacilityfinalgovernmenthomeindependentinsidelocalofficeopen
SHARED TOKENS (35): "activity", "annual", "building", "candidate", "cannot", "community", "district", "election", "electoral", "even", "facilities", "facility", "final", "government", "home", "independent", "inside", "local", "office", "open"....
0.300
actactiveadministeredagenciesairauthorityauthorizedbranchbridgesbudgetbuildingbusinesscanalscapacitycivilconstructioncontroldepartmentdesigndirect
SHARED TOKENS (68): "act", "active", "administered", "agencies", "air", "authority", "authorized", "branch", "bridges", "budget", "building", "business", "canals", "capacity", "civil", "construction", "control", "department", "design", "direct"....
0.300
adaboisecentralconnectedcontainsgardenidahoitselfmetropolitannationalpopulationrecreationroadsruralsectionstarvalleywestern
SHARED TOKENS (18): "ada", "boise", "central", "connected", "contains", "garden", "idaho", "itself", "metropolitan", "national", "population", "recreation", "roads", "rural", "section", "star", "valley", "western".
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherauthorizedconnectdevelopmenteasementsevenfeefinalfullfunctionsgovernmentimpactjurisdictionslandlegalmunicipalitiesownersownershippower
SHARED TOKENS (34): "acquisition", "another", "authorized", "connect", "development", "easements", "even", "fee", "final", "full", "functions", "government", "impact", "jurisdictions", "land", "legal", "municipalities", "owners", "ownership", "power"....
0.300
bridgescivilconstructiondesignengineeringengineershighwayhighwaysmaintenancematerialsplanningprofessionalroadsstandardsstreetstraffictransportation
SHARED TOKENS (17): "bridges", "civil", "construction", "design", "engineering", "engineers", "highway", "highways", "maintenance", "materials", "planning", "professional", "roads", "standards", "streets", "traffic", "transportation".
0.300
activityagenciescertaincommissiondepartmentsemergencyenforcementfacilitiesfederalinfrastructurelawlevellocalmaintenancemajoroperatespoliceprimarilyprivateproperty
SHARED TOKENS (28): "activity", "agencies", "certain", "commission", "departments", "emergency", "enforcement", "facilities", "federal", "infrastructure", "law", "level", "local", "maintenance", "major", "operates", "police", "primarily", "private", "property"....
0.300
Fort Boise ↗ Q3077782 KW CROSS HIGH
becomeboiseboundarycanyoncapitaldevelopeddifferentdistrictestablishedgovernmentidahomilesmilitaryriversecondterritorywestern
SHARED TOKENS (17): "become", "boise", "boundary", "canyon", "capital", "developed", "different", "district", "established", "government", "idaho", "miles", "military", "river", "second", "territory", "western".
0.300
administrationagenciesamongcompliancecontentcontrolcurrentdefinesdepartmentdesigndevelopeddiffersdocumentfederalhighwayhighwayslawlocalnationalopen
SHARED TOKENS (30): "administration", "agencies", "among", "compliance", "content", "control", "current", "defines", "department", "design", "developed", "differs", "document", "federal", "highway", "highways", "law", "local", "national", "open"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiescannotconnectdesigndrainagedrainsevenhazardoushighwayinfrastructureinsidelargemunicipalparkingparkspropertypublicreceiverequireresidential
SHARED TOKENS (26): "bodies", "cannot", "connect", "design", "drainage", "drains", "even", "hazardous", "highway", "infrastructure", "inside", "large", "municipal", "parking", "parks", "property", "public", "receive", "require", "residential"....
0.300
beyondcontroldevelopeddocumentsentitiesenvironmentalfederalfederallyfinancefloodformationgoverninggrantshealthirrigationjurisdictionslandlawlawslocal
SHARED TOKENS (35): "beyond", "control", "developed", "documents", "entities", "environmental", "federal", "federally", "finance", "flood", "formation", "governing", "grants", "health", "irrigation", "jurisdictions", "land", "law", "laws", "local"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
capacityconditionsdefinitionsdifferentequivalentmeaningmultipleoperateoperatesoperatingoperationsprimarilyrailroadsectionstreetssystemsystemstechnologytogethertraffic
SHARED TOKENS (23): "capacity", "conditions", "definitions", "different", "equivalent", "meaning", "multiple", "operate", "operates", "operating", "operations", "primarily", "railroad", "section", "streets", "system", "systems", "technology", "together", "traffic"....
0.300
agencyboardboisecapitalcodedepartmentdetermineddistrictseducationelectedexecutiveidahoinstructionmattersofficialpublicresponsibleschoolschoolsserves
SHARED TOKENS (23): "agency", "board", "boise", "capital", "code", "department", "determined", "districts", "education", "elected", "executive", "idaho", "instruction", "matters", "official", "public", "responsible", "school", "schools", "serves"....
0.300
authoritiescivilearlyemergencygeneralmanagementmeaningmilitarymitigationnationalplanningprogramsresourcesresponsestructurestermsuses
SHARED TOKENS (17): "authorities", "civil", "early", "emergency", "general", "management", "meaning", "military", "mitigation", "national", "planning", "programs", "resources", "response", "structures", "terms", "uses".
0.300
accessassociatedconstructiondevelopmentdocumentseffectivegoverninggovernmentinformationinstitutionsmaintainsopenoriginspracticepublicpubliclysharingsociety
SHARED TOKENS (18): "access", "associated", "construction", "development", "documents", "effective", "governing", "government", "information", "institutions", "maintains", "open", "origins", "practice", "public", "publicly", "sharing", "society".
0.300
agencyauthoritychargescodecountiesdirectlydistrictelectedenforcementfederalfurthergovernmentgrantindependentjurisdictionjurisdictionslawlegallocalmatters
SHARED TOKENS (25): "agency", "authority", "charges", "code", "counties", "directly", "district", "elected", "enforcement", "federal", "further", "government", "grant", "independent", "jurisdiction", "jurisdictions", "law", "legal", "local", "matters"....
0.300
administrationagenciesbuildingcivilcontainscreateddepartmentdirectlydistrictsenforcementequivalentexecutivefederalfunctionsgeneralgovernmentgrantlawlawsmanagement
SHARED TOKENS (29): "administration", "agencies", "building", "civil", "contains", "created", "department", "directly", "districts", "enforcement", "equivalent", "executive", "federal", "functions", "general", "government", "grant", "law", "laws", "management"....
0.300
adaarchitecturebeganboisebuildingcapitalconstructioncostdepartmentdesigndistrictfederalfinalformationgovernmenthomeidaholegislaturelistingmaterials
SHARED TOKENS (27): "ada", "architecture", "began", "boise", "building", "capital", "construction", "cost", "department", "design", "district", "federal", "final", "formation", "government", "home", "idaho", "legislature", "listing", "materials"....
🫐 BERRY41 edges
0.280
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalconditionscustomersdeterminedigitalindependentinspectionmaintenanceneedsproposedroleshowingvehiclework
SHARED TOKENS (14): "approval", "conditions", "customers", "determine", "digital", "independent", "inspection", "maintenance", "needs", "proposed", "role", "showing", "vehicle", "work".
0.280
activityadvocacycreatedenvironmentalexistinggovernmentsgrowthimpactmeasuresmultiplepopulationpracticeresourcestechnology
SHARED TOKENS (14): "activity", "advocacy", "created", "environmental", "existing", "governments", "growth", "impact", "measures", "multiple", "population", "practice", "resources", "technology".
0.280
Aquifer ↗ Q208791 KW CROSS HIGH
beyondformationhomeindustriallandlayermajormaterialmaterialspressureregionsourcestudywater
SHARED TOKENS (14): "beyond", "formation", "home", "industrial", "land", "layer", "major", "material", "materials", "pressure", "region", "source", "study", "water".
0.280
adoptedbodycitiescouncildirectlyelectedexecutivegovernmentlargelocalmunicipalitiesseparatelysystemvoters
SHARED TOKENS (14): "adopted", "body", "cities", "council", "directly", "elected", "executive", "government", "large", "local", "municipalities", "separately", "system", "voters".
0.260
buildingdecisionsidaho
SHARED TOKENS (3): "building", "decisions", "idaho". | EXACT TITLE in government_civic: "Idaho Supreme Court".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
airconstructionequipmenthighwayindustrialinfrastructurelargelegalordinaryroadspecifiedtransportationwater
SHARED TOKENS (13): "air", "construction", "equipment", "highway", "industrial", "infrastructure", "large", "legal", "ordinary", "road", "specified", "transportation", "water".
0.240
citieselectionfederalgeneralidahomunicipalprimaryregistrationstatewidestudytermsvoters
SHARED TOKENS (12): "cities", "election", "federal", "general", "idaho", "municipal", "primary", "registration", "statewide", "study", "terms", "voters".
0.240
conflictscreatingdepartmentdifferentevenmovementpermitprimaryprovidesharedsidewalksurban
SHARED TOKENS (12): "conflicts", "creating", "department", "different", "even", "movement", "permit", "primary", "provide", "shared", "sidewalks", "urban".
0.240
Park and ride ↗ Q738031 KW CROSS HIGH
citiesconnectionslargemetropolitanparkparkingpublicroadsystemtransfertransitvehicle
SHARED TOKENS (12): "cities", "connections", "large", "metropolitan", "park", "parking", "public", "road", "system", "transfer", "transit", "vehicle".
0.240
accessconnectingjurisdictionslocalmajorprovideresidentialroadroadsservesstreetstraffic
SHARED TOKENS (12): "access", "connecting", "jurisdictions", "local", "major", "provide", "residential", "road", "roads", "serves", "streets", "traffic".
0.240
Bike lane ↗ Q1378400 KW CROSS HIGH
advisorybusinesseseconomicentrylaneresearchrestrictedroadroadwaysafetyshowstraffic
SHARED TOKENS (12): "advisory", "businesses", "economic", "entry", "lane", "research", "restricted", "road", "roadway", "safety", "shows", "traffic".
0.220
Drinking water ↗ Q7892 KW CROSS HIGH
activityaffectedconditionsdependsdirectlyenvironmentalhealthmajorphysicalwaterwork
SHARED TOKENS (11): "activity", "affected", "conditions", "depends", "directly", "environmental", "health", "major", "physical", "water", "work".
0.220
articlecurrentforcesgovernmentidaholawslegislaturemilitaryofficepowerterms
SHARED TOKENS (11): "article", "current", "forces", "government", "idaho", "laws", "legislature", "military", "office", "power", "terms".
0.220
agriculturalfullindustriallegalmerelyownershipperiodrightssourcesystemwater
SHARED TOKENS (11): "agricultural", "full", "industrial", "legal", "merely", "ownership", "period", "rights", "source", "system", "water".
0.220
academicdesignengineeringfacilitiesmanagementmovementoccupationalplanningprovidetechnologytransportation
SHARED TOKENS (11): "academic", "design", "engineering", "facilities", "management", "movement", "occupational", "planning", "provide", "technology", "transportation".
0.200
associatedboisecontainsextendsfederallyidahomajoritymetropolitanpopulationvalley
SHARED TOKENS (10): "associated", "boise", "contains", "extends", "federally", "idaho", "majority", "metropolitan", "population", "valley".
0.200
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitanmiddletonnampapopulationruralwestern
SHARED TOKENS (10): "boise", "caldwell", "canyon", "idaho", "metropolitan", "middleton", "nampa", "population", "rural", "western".
0.180
affectdecisionsdirectdirectlyelectedgovernmentmodelpoliciesrather
SHARED TOKENS (9): "affect", "decisions", "direct", "directly", "elected", "government", "model", "policies", "rather".
0.180
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
highwayhighwaysidahointersectioninterstatemilessystemwestwestern
SHARED TOKENS (9): "highway", "highways", "idaho", "intersection", "interstate", "miles", "system", "west", "western".
0.180
appealsbeganboisebuildingcreatedidaholegislatureoperationsstatute
SHARED TOKENS (9): "appeals", "began", "boise", "building", "created", "idaho", "legislature", "operations", "statute".
0.180
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
0.180
canyonconnectingeaglehighwayidahomeridiannamparivervalley
SHARED TOKENS (9): "canyon", "connecting", "eagle", "highway", "idaho", "meridian", "nampa", "river", "valley".
0.160
boisebuildingdistrictselectedidaholegislatureseparateterms
SHARED TOKENS (8): "boise", "building", "districts", "elected", "idaho", "legislature", "separate", "terms".
0.160
aircommercialinternationallandlogisticsmilitaryphysicalprocess
SHARED TOKENS (8): "air", "commercial", "international", "land", "logistics", "military", "physical", "process".
0.160
decisionelectoralfocusedgeneralgovernmentinfluencemakingprocess
SHARED TOKENS (8): "decision", "electoral", "focused", "general", "government", "influence", "making", "process".
0.160
costsitselfmethodmultipleroadsecuritytransportationvehicle
SHARED TOKENS (8): "costs", "itself", "method", "multiple", "road", "security", "transportation", "vehicle".
0.160
boisecontrolsdominantelectedidaholegislaturenationalstatewide
SHARED TOKENS (8): "boise", "controls", "dominant", "elected", "idaho", "legislature", "national", "statewide".
0.140
commercialhazardouslargelicensematerialsoperatevehicle
SHARED TOKENS (7): "commercial", "hazardous", "large", "license", "materials", "operate", "vehicle".
0.120
controleducationhealthpopulationprogramsrisks
SHARED TOKENS (6): "control", "education", "health", "population", "programs", "risks".
0.120
gardenhighwayidahointerstatetreasurevalley
SHARED TOKENS (6): "garden", "highway", "idaho", "interstate", "treasure", "valley".
0.120
adaconnectingcountieshighwayidahostar
SHARED TOKENS (6): "ada", "connecting", "counties", "highway", "idaho", "star".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationrural
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "rural".
0.120
History of Idaho ↗ KW CROSS HIGH
activityassociatedhistoryidahowestwestern
SHARED TOKENS (6): "activity", "associated", "history", "idaho", "west", "western".
0.120
accordingcurrentelectedidahoofficestatewide
SHARED TOKENS (6): "according", "current", "elected", "idaho", "office", "statewide".
0.120
Idaho Senate ↗ Q1494863 KW CROSS HIGH
boisedistrictelectedidaholegislatureterms
SHARED TOKENS (6): "boise", "district", "elected", "idaho", "legislature", "terms".
0.120
branchexecutivefinancialgovernmentidahooffice
SHARED TOKENS (6): "branch", "executive", "financial", "government", "idaho", "office".
0.120
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.100
boisehomeidahometropolitanpopulation
SHARED TOKENS (5): "boise", "home", "idaho", "metropolitan", "population".
0.100
airboiseidaholinespredecessors
SHARED TOKENS (5): "air", "boise", "idaho", "lines", "predecessors".
0.100
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesignengineeringroadwayvehicle
SHARED TOKENS (5): "connected", "design", "engineering", "roadway", "vehicle".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Transportation Infrastructure × Government Civic — Treasure Valley
HAIKU · HIGH GATE
How does the Treasure Valley metropolitan planning organization oversee road construction and maintenance across Ada County?
The Treasure Valley metropolitan planning organization coordinates transportation planning between local governments, the Federal Highway Administration, and Idaho state agencies to allocate federal and state funding for roads serving Boise, Meridian, and surrounding cities. Public works departments in each municipality implement these plans while adhering to Federal Highway Administration standards for road design and safety across the region's expanding miles of infrastructure.
What role does Boise State University play in training workers for the Treasure Valley's public transportation and infrastructure projects?
Boise State University and College of Western Idaho offer apprenticeship programs that prepare workers for positions in public works, transit operations, and infrastructure maintenance across the Treasure Valley. These institutions coordinate with the Federal Transit Administration and local government agencies to ensure graduates meet employment needs for expanding public transport systems serving Ada County's growing population.
How do Federal Transit Administration regulations shape public transport decisions made by Treasure Valley local governments?
The Federal Transit Administration sets funding eligibility and operational standards that Boise, Meridian, and other Treasure Valley cities must follow when developing public transit routes and services. Local government planning departments use FTA guidelines to design transportation systems that serve the region's increasingly urbanized population while maintaining federal compliance.
What is the relationship between Boise Airport operations and Treasure Valley government planning for regional transportation infrastructure?
Boise Airport operates under federal and Idaho state oversight while coordinating with the Treasure Valley metropolitan planning organization to ensure ground transportation—roads, public transit connections, and bridge infrastructure—adequately serves passengers and cargo movement. Local governments in Ada County plan highway and public works projects to maintain access to the airport as a critical regional transportation hub for the capital metropolitan area.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Transportation Infrastructure × Government Civic 33 QID bridges 215 edges 5,688 ext links 2026-07-17 23:40:49 UTC a9f1cbe8fe78ffcd
Transportation Infrastructure corridor ↗ Government Civic corridor ↗ Government Civic × Transportation Infrastructure ↗ boisestandard.org/standard ↗
Parent Corridors
Transportation Infrastructure × All Other Verticals