—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Water Rights ↔ relates to ↔ Procurement Public Spending

18 Wikipedia bridge articles confirmed in both vertical ledgers. 255 deterministic cross-vertical edges. 6,549 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
255 Cross Edges
6,549 External Sources
292 Wikipedia Articles
19 🌲 Evergreen
180 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Water Rights
× Procurement Public Spending
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
255
External Sources Harvested
6,549
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho Legislature
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (18)
Idaho LegislatureWastewater treatmentSurveyingBoise State UniversityWater supplyTreasure ValleySanitary sewerAdministrative lawPublic utilityCivil engineeringNampa, IdahoBoise, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, IdahoKuna, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationgovernmentpublicadaenvironmentcapitalsystemsmileswatercivilengineeringcollegewestsystemlocalinfrastructurelocallycanyon
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:00:00 UTC
Content Hash
1bcb27a041df5d77
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Idaho Legislature
Q4256974 EXACT TITLE 1.000
QID OVERLAP: Q4256974 in water_rights (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (15): "approximately", "boise", "data", "district", "districts", "either", "even", "government", "idaho", "lower", "population", "representing", "residents", "single", "split". | EXACT TITLE in water_rights: "Idaho Legislature".
approximatelyboisedatadistrictdistrictseitherevengovernmentidaholowerpopulationrepresentingresidentssinglesplit
es, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
Wastewater treatment
Q20127660 EXACT TITLE 1.000
QID OVERLAP: Q20127660 in water_rights (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (18): "agricultural", "another", "environment", "facility", "impact", "industrial", "municipal", "process", "processes", "purpose", "resulting", "separation", "treatment", "types", "uses", "waste", "wastewater", "water". | EXACT TITLE in water_rights: "Wastewater treatment". | EXACT TITLE in procurement_public_spending: "Wastewater treatment".
agriculturalanotherenvironmentfacilityimpactindustrialmunicipalprocessprocessespurposeresultingseparationtreatmenttypesuseswastewastewaterwater
age treatment plant. In the latter case the industry typically performs on-site pretreatment of the waste, before it is sent to the municipal plant. Other types of wastewater treatment plants include agricultural wastewater treatment and leachate treatment plants. The term "wastewater treatment" is often used to mean "sewage treatment". Common processes in wastewater treatment include phase separation, such as sedimentation, various biological and chemical processes, such as oxidation, and polishing. The main by-product from wastewater treatment plants is a type of sludge that is usually treated in the same or another wastewater treatment plant. Biogas can be another by-product if the process uses anaerobic treatment. Treated wastewater can be reused as reclaimed water. The main purpose of wastewater treatment is for the treated wastewater to be able to be disposed or reused safely.
Types of treatment plants Wastewater treatment plants may be distinguished by the type of wastewater to be treated. There are numerous processes that can be used to treat wastewater depending on the type and extent of contamination. The treatment steps include physical, chemical and biological treatment processes. Types of wastewater treatment plants include: Sewage treatment plants Industrial wastewater treatment plants Agricultural wastewater treatment plants Leachate treatment plants Sewage treatment plants Industrial wastewater treatment plants Agricultural wastewater treatment plants Leachate treatment plants Leachate treatment plants are used to treat leachate from landfills.
mentation, various biological and chemical processes, such as oxidation, and polishing. The main by-product from wastewater treatment plants is a type of sludge that is usually treated in the same or another wastewater treatment plant. Biogas can be another by-product if the process uses anaerobic treatment. Treated wastewater can be reused as reclaimed water. The main purpose of wastewater treatment is for the treated wastewater to be able to be disposed or reused safely.
Surveying
Q816425 EXACT TITLE 1.000
QID OVERLAP: Q816425 in water_rights (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (29): "analysis", "civil", "construction", "development", "digital", "engineering", "environment", "equipment", "establish", "forms", "government", "history", "land", "law", "legal", "mapping", "maps", "ownership", "planning", "professional".... | EXACT TITLE in water_rights: "Surveying". | EXACT TITLE in procurement_public_spending: "Surveying".
analysiscivilconstructiondevelopmentdigitalengineeringenvironmentequipmentestablishformsgovernmenthistorylandlawlegalmappingmapsownershipplanningprofessionalpropertyrequiredresearchstructuralsurveyingsurveyorsthemtransportationwork
es required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
daries for ownership, locations, such as the designated positions of structural components for construction or the surface location of subsurface features, or other purposes required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
The main surveying instruments in use around the world are the theodolite, measuring tape, total station, 3D scanners, GPS/GNSS, level and rod. Most instruments screw onto a tripod when in use. Tape measures are often used for measurement of smaller distances. 3D scanners and various forms of aerial imagery are also used. The theodolite is an instrument for the measurement of angles. It uses two separate circles, protractors or alidades to measure angles in the horizontal and the vertical plane. A telescope mounted on trunnions is aligned vertically with the target object. The whole upper section rotates for horizontal alignment. The vertical circle measures the angle that the telescope makes against the vertical, known as the zenith angle. The horizontal circle uses an upper and lower plate. When beginning the survey, the surveyor points the instrument in a known direction (bearing), and clamps the lower plate in place. The instrument can then rotate to measure the bearing to other objects. If no bearing is known or direct angle measurement is wanted, the instrument can be set to zero during the initial sight. It will then read the angle between the initial object, the theodolite itself, and the item that the telescope aligns with. The gyrotheodolite is a form of theodolite that uses a gyroscope to orient itself in the absence of reference marks. It is used in underground applications. The total station is a development of the theodolite with an electronic distance measurement device (EDM). A total station can be used for leveling when set to the horizontal plane. Since their introduction, total stations have shifted from optical-mechanical to fully electronic devices. Modern top-of-the-line total stations no longer need a reflector or prism to return the light pulses used for distance measurements. They are fully robotic, and can even e-mail point data to a remote computer and connect to satellite positioning systems, such as Global Positioning System. Real Time Kinematic GPS systems have significantly increased the speed of surveying, and they are now horizontally accurate to within 1 cm ± 1 ppm in real-time, while vertically it is currently about half of that to within 2 cm ± 2 ppm. GPS surveying differs from other GPS uses in the equipment and methods used. Static GPS uses two receivers placed in position for a considerable length of time. The long span of time lets the receiver compare measurements as the satellites orbit. The changes as the satellites orbit also provide the measurement network with well-conditioned geometry. This produces an accurate baseline that can be over 20 km long. RTK surveying uses one static antenna and one roving antenna. The static antenna tracks changes in the satellite positions and atmospheric conditions. The surveyor uses the roving antenna to measure the points needed for the survey. The two antennas use a radio link that allows the static antenna to send corrections to the roving antenna. The roving antenna then applies those corrections to the GPS signals it is receiving to calculate its own position. RTK surveying covers smaller distances than static methods. This is because divergent conditions further away from the base reduce accuracy. Surveying instruments have characteristics that make them suitable for certain uses. Theodolites and levels are often used by constructors rather than surveyors in first-world countries. The constructor can perform simple survey tasks using a relatively cheap instrument. Total stations are workhorses for many professional surveyors because they are versatile and reliable in all conditions. The productivity improvements from a GPS on large-scale surveys make them popular for major infrastructure or data-gathering projects. One-person robotic-guided total stations allow surveyors to measure without extra workers to aim the telescope or record data. A fast but expensive way to measure large areas is with a helicopter, using a GPS to record the location of the helicopter and a laser scanner to measure the ground. To increase precision, surveyors place beacons on the ground (about 20 km (12 mi) apart). This method reaches precisions between 5–40 cm (depending on flight height). Surveyors use ancillary equipment such as tripods and instrument stands; staves and beacons used for sighting purposes; PPE; vegetation clearing equipment; digging implements for finding survey markers buried over time; hammers for placements of markers in various surfaces and structures; and portable radios for communication over long lines of sight. Software Land surveyors, construction professionals, geomatics engineers and civil engineers using total station, GPS, 3D scanners, and other data collectors use land surveying software to increase efficiency, accuracy, and productivity. Land Surveying Software is a staple of contemporary land surveying. Typically, much if not all of the drafting and some of the designing for plans and plats of the surveyed property is done by the surveyor, and nearly everyone working in the area of drafting today (2021) utilizes CAD software and hardware both on PC, and more and more in newer generation data collectors in the field as well. Other computer platforms and tools commonly used today by surveyors are offered online by the U.S.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in water_rights (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (19): "among", "boise", "business", "college", "division", "education", "engineering", "health", "idaho", "independent", "institution", "million", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in water_rights: "Boise State University". | EXACT TITLE in procurement_public_spending: "Boise State University".
amongboisebusinesscollegedivisioneducationengineeringhealthidahoindependentinstitutionmillionprogramprogramspublicreportedresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Water supply
Q1061108 EXACT TITLE 1.000
QID OVERLAP: Q1061108 in water_rights (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (27): "agriculture", "around", "capital", "commercial", "cost", "costs", "different", "drinking", "institutional", "issues", "large", "larger", "personnel", "policy", "properly", "public", "quality", "responsibility", "rural", "separate".... | EXACT TITLE in water_rights: "Water supply".
agriculturearoundcapitalcommercialcostcostsdifferentdrinkinginstitutionalissueslargelargerpersonnelpolicyproperlypublicqualityresponsibilityruralseparatesupplysurroundingsystemsystemsurbanutilitieswater
harge tariffs to recover part of their costs. Water supply is a separate topic from irrigation, the practice and systems of water supply on a larger scale, for a wider variety of purposes, primarily agriculture. Technical overview Water supply systems get water from a variety of locations after appropriate treatment, including groundwater (aquifers), surface water (lakes and rivers), and the sea through desalination. The water treatment steps include, in most cases, purification, disinfection through chlorination and sometimes fluoridation. Treated water then either flows by gravity or is pumped to reservoirs, which can be elevated such as water towers or on the ground (for indicators related to the efficiency of drinking water distribution see non-revenue water).
vors or by individuals, usually via a system of pumps and pipes. Public water supply systems are crucial to properly functioning societies. These systems are what supply drinking water to populations around the globe. Aspects of service quality include continuity of supply, water quality and water pressure. The institutional responsibility for water supply is arranged differently in different countries and regions (urban versus rural). It usually includes issues surrounding policy and regulation, service provision and standardization. The cost of supplying water consists, to a very large extent, of fixed costs (capital costs and personnel costs) and only to a small extent of variable costs that depend on the amount of water consumed (mainly energy and chemicals).
Water supply policies and regulation are usually defined by one or several ministries, in consultation with the legislative branch. In the United States the United States Environmental Protection Agency, whose administrator reports directly to the President, is responsible for water and sanitation policy and standard setting within the executive branch. In other countries responsibility for sector policy is entrusted to a Ministry of Environment (such as in Mexico and Colombia), to a Ministry of Health (such as in Panama, Honduras and Uruguay), a Ministry of Public Works (such as in Ecuador and Haiti), a Ministry of Economy (such as in German states) or a Ministry of Energy (such as in Iran). A few countries, such as Jordan and Bolivia, even have a Ministry of Water. Often several ministries share responsibilities for water supply. In the European Union, important policy functions have been entrusted to the supranational level. Policy and regulatory functions include the setting of tariff rules and the approval of tariff increases; setting, monitoring and enforcing norms for quality of service and environmental protection; benchmarking the performance of service providers; and reforms in the structure of institutions responsible for service provision. The distinction between policy functions and regulatory functions is not always clear-cut. In some countries they are both entrusted to ministries, but in others regulatory functions are entrusted to agencies that are separate from ministries. Regulatory agencies Dozens of countries around the world have established regulatory agencies for infrastructure services, including often water supply and sanitation, in order to better protect consumers and to improve efficiency. Regulatory agencies can be entrusted with a variety of responsibilities, including in particular the approval of tariff increases and the management of sector information systems, including benchmarking systems. Sometimes they also have a mandate to settle complaints by consumers that have not been dealt with satisfactorily by service providers. These specialized entities are expected to be more competent and objective in regulating service providers than departments of government Ministries. Regulatory agencies are supposed to be autonomous from the executive branch of government, but in many countries have often not been able to exercise a great degree of autonomy. In the United States regulatory agencies for utilities have existed for almost a century at the level of states, and in Canada at the level of provinces. In both countries they cover several infrastructure sectors. In many US states they are called Public Utility Commissions. For England and Wales, a regulatory agency for water (OFWAT) was created as part of the privatization of the water industry in 1989. In many developing countries, water regulatory agencies were created during the 1990s in parallel with efforts at increasing private sector participation. (for more details on regulatory agencies in Latin America, for example, please see Water and sanitation in Latin America and the regional association of water regulatory agencies ADERASA.) Many countries do not have regulatory agencies for water. In these countries service providers are regulated directly by local government, or the national government.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in water_rights (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "lower", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Treasure Valley". | EXACT TITLE in procurement_public_spending: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocallowerregionresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Sanitary sewer
Q1805497 EXACT TITLE 0.960
QID OVERLAP: Q1805497 in water_rights (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (13): "commercial", "directly", "industrial", "infrastructure", "pipe", "separate", "serving", "sewer", "system", "systems", "treatment", "urban", "wastewater". | EXACT TITLE in water_rights: "Sanitary sewer".
commercialdirectlyindustrialinfrastructurepipeseparateservingsewersystemsystemstreatmenturbanwastewater
A sanitary sewer is an underground pipe or tunnel system for transporting sewage from houses and commercial buildings (but not stormwater) to a sewage treatment plant or disposal. Sanitary sewers are a type of gravity sewer and are part of an overall system called a "sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
In the developed world, sewers are pipes from buildings to one or more levels of larger underground trunk mains, which transport the sewage to sewage treatment facilities. Vertical pipes, usually made of precast concrete, called manholes, connect the mains to the surface. Depending upon site application and use, these vertical pipes can be cylindrical, eccentric, or concentric. The manholes are used for access to the sewer pipes for inspection and maintenance, and as a means to vent sewer gases. They also facilitate vertical and horizontal angles in otherwise straight pipelines. Pipes conveying sewage from an individual building to a common gravity sewer line are called laterals. Branch sewers typically run under streets receiving laterals from buildings along that street and discharge by gravity into trunk sewers at manholes. Larger cities may have sewers called interceptors, receiving flow from multiple trunk sewers. Design and sizing of sanitary sewers considers the population to be served over the anticipated life of the sewer, per capita wastewater production, and flow peaking from timing of daily routines. Minimum sewer diameters are often specified to prevent blockage by solid materials flushed down toilets; gradients may be selected to maintain flow velocities generating sufficient turbulence to minimize solids deposition within the sewer. Commercial and industrial wastewater flows are also considered, but diversion of surface runoff to storm drains eliminates wet weather flow peaks of inefficient combined sewers. Force mains A force main or rising main is a pumped sewer that may be necessary where gravity sewers serve areas at lower elevations than the sewage treatment plant, or distant areas at similar elevations. A lift station is a sewer sump that lifts accumulated sewage to a higher elevation. They may also be used to prime an inverted siphon used to cross underneath rivers or other obstructions. The pump may discharge to another gravity sewer or directly to a treatment plant. Force mains are typically constructed of welded steel or HDPE jointed to resist pressures within the pipe.
sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
A
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (30): "administration", "administrative", "agencies", "another", "changes", "civil", "control", "created", "decisions", "division", "economic", "education", "environment", "environmental", "expanded", "generally", "governing", "government", "increase", "itself"....
administrationadministrativeagenciesanotherchangescivilcontrolcreateddecisionsdivisioneconomiceducationenvironmentenvironmentalexpandedgenerallygoverninggovernmentincreaseitselfjudiciallawlegalmodelpublicreviewrulesspecializedstructuresystem
In the last fifty years, administrative law, in many countries of the civil law tradition, has opened itself to the influence of rules posed by supranational legal orders, in which judicial principles have strong importance: it has led, for one, to changes in some traditional concepts of the administrative law model, as has happened with the public procurements or with judicial control of administrative activity and, for another, has built a supranational or international public administration, as in the environmental sector or with reference to education, for which, within the United Nations' system, it has been possible to assist to a further increase of administrative structure devoted to coordinate the States' activity in that sector.
In Brazil, administrative cases are typically heard either by the Federal Courts (in matters concerning the Federal Union) or by the Public Treasury divisions of State Courts (in matters concerning the States). In 1998 a constitutional reform led by the government of President Fernando Henrique Cardoso introduced regulatory agencies as a part of the executive branch. Since 1988, Brazilian administrative law has been strongly influenced by the judicial interpretations of the constitutional principles of public administration (Art. 37 of the Federal Constitution): legality, impersonality, publicity of administrative acts, morality and efficiency. Chile In Chile, the President of the Republic exercises the administrative function, in collaboration with several ministries or other authorities with ministerial rank. Each ministry has one or more under-secretaries that act through public service to meet public needs.
Germany In Germany, administrative law (German: Verwaltungsrecht) includes all law that specifically governs the legal relationships between public authorities and private persons, and that is not more precisely described as constitutional law. It sets out the tasks, aims and powers, as well as the organization and procedure, for all public authorities (German: Behörden). As a field of legal study, administrative law has been differentiated from other branches of public law since the late 19th century in Germany; the precise delimitations of "administration" as a concept, however, are in contention. Administrative law defines all aspects of public administration in the modern German state, whose legal culture emphasizes private persons' subjective rights (also, pursuant to art. 19IV of the current German Constitution of 1949, such rights must be fully justiciable).
Public utility
Q1951366 QID OVERLAP 0.800
QID OVERLAP: Q1951366 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (33): "access", "best", "cannot", "characterized", "competing", "control", "costs", "different", "entity", "federal", "forms", "government", "infrastructure", "institution", "large", "local", "maintains", "market", "operates", "point"....
accessbestcannotcharacterizedcompetingcontrolcostsdifferententityfederalformsgovernmentinfrastructureinstitutionlargelocalmaintainsmarketoperatespointpublicrepresentsspecificstatewidesubjectsupplysystemstransportationtypesutilities+3
or completely) sourced from clean and renewable energy in order to produce sustainable electricity. Of these, wind turbines and solar panels are those used most frequently. Whether broadband internet access should be a public utility is a question that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
ion that was being discussed with the rise of internet usage. This is a question that was being asked due to the telephone service being considered a public utility. Since arguably broadband internet access has taken over telephone service, perhaps it should be a public utility. The Federal Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear.
Communications Commission (FCC) in the United States in 2015 made its stance on this issue clear. Due to the telephone service having been considered a public utility, the FCC made broadband internet access a public utility in the United States. Management Public utilities have historically been considered to be a natural monopoly. This school of thought holds that the most cost-efficient way of doing business is through a single firm because these are capital-intensive businesses with unusually large economies of scale and high fixed costs associated with building and operating the infrastructure, e.g. power plants, telephone lines and water treatment facilities. However, over the past several decades, traditional public utilities' monopoly position has eroded. For instance, wholesale electricity generation markets, electric transmission networks, electricity retailing and customer choice, telecommunications, some types of public transit and postal services have become competitive in some countries and the trend towards liberalization, deregulation and privatization of public utilities is growing.
Civil engineering
Q77590 QID OVERLAP 0.800
QID OVERLAP: Q77590 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (22): "agencies", "civil", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public", "structural"....
agenciescivilconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
Civil engineering is a professional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (14): "according", "boise", "canyon", "college", "home", "idaho", "meridian", "miles", "nampa", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeridianmilesnampapopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "counties", "estimated", "home", "idaho", "locally", "major", "miles", "population", "treasure", "valley".
adaannualboisecapitalcountiesestimatedhomeidaholocallymajormilespopulationtreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in water_rights (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "estimated", "home", "idaho", "jurisdiction", "local", "population", "private".
adaboisecapitaldistrictestimatedhomeidahojurisdictionlocalpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "miles", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymilespopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in water_rights (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "percent", "population".
adaadditionalboiseidahokunapercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in water_rights (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "miles", "population".
adaboiseidahomilespopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
237 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP237 edges
🌲 EVERGREEN1 edges
0.650
adaboiseconstructioncontroldirectlydownstreamengineersfederalformsidahomilesoperatingoperationalpowerprivatepurposeupstreamutilitywestern
SHARED TOKENS (19): "ada", "boise", "construction", "control", "directly", "downstream", "engineers", "federal", "forms", "idaho", "miles", "operating", "operational", "power", "private", "purpose", "upstream", "utility", "western". | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
🌿 BRANCH180 edges
0.500
amongapproximatelyboisedivisionestablishedextensionidaholateroperatesprofessionalpublicresearchruralschoolsstatewideuniversity
SHARED TOKENS (16): "among", "approximately", "boise", "division", "established", "extension", "idaho", "later", "operates", "professional", "public", "research", "rural", "schools", "statewide", "university". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherconstructioncontainscreatecreateddevelopingenvironmentalexcavationhistoricallyleastmethodspipepointpotentialproviderequireresourcesruralsources
SHARED TOKENS (26): "access", "another", "construction", "contains", "create", "created", "developing", "environmental", "excavation", "historically", "least", "methods", "pipe", "point", "potential", "provide", "require", "resources", "rural", "sources".... | EXACT TITLE in water_rights: "Well". | EXACT TITLE in procurement_public_spending: "Well".
0.500
alongsidecontainsdrinkingformindustriallandlargemajorpermanentreportsresultsurroundingtreatmenttypesuseswastewaterwater
SHARED TOKENS (17): "alongside", "contains", "drinking", "form", "industrial", "land", "large", "major", "permanent", "reports", "result", "surrounding", "treatment", "types", "uses", "wastewater", "water". | EXACT TITLE in water_rights: "Surface water".
0.500
billionconditionsdependsdevelopingdirectlydrinkingeitherenvironmentalfoodformhealthissuesmaintainmajorphysicalrequiredwaterwork
SHARED TOKENS (18): "billion", "conditions", "depends", "developing", "directly", "drinking", "either", "environmental", "food", "form", "health", "issues", "maintain", "major", "physical", "required", "water", "work". | EXACT TITLE in water_rights: "Drinking water". | EXACT TITLE in procurement_public_spending: "Drinking water".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanothercategoriescategorychangechangesclassificationconsequencescoverdatadirectlydominantenvironmentenvironmentalhistoricallyimpactlandland-usemajormanagement
SHARED TOKENS (31): "agricultural", "another", "categories", "category", "change", "changes", "classification", "consequences", "cover", "data", "directly", "dominant", "environment", "environmental", "historically", "impact", "land", "land-use", "major", "management".... | EXACT TITLE in water_rights: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyaroundassociatedbestboisecapitalcolumbiacontainsdistincteconomygeographicidahoisolatedlandmethodsmilesmillionnational
SHARED TOKENS (30): "agricultural", "agriculture", "approximately", "around", "associated", "best", "boise", "capital", "columbia", "contains", "distinct", "economy", "geographic", "idaho", "isolated", "land", "methods", "miles", "million", "national".... | EXACT TITLE in water_rights: "Idaho". | EXACT TITLE in procurement_public_spending: "Idaho".
0.500
additionaladequateagriculturalcapacityconditionscostcostsdepartmentdistrictestimatedindustrialpowerprocessesratereduceresourcessourcesupplywater
SHARED TOKENS (19): "additional", "adequate", "agricultural", "capacity", "conditions", "cost", "costs", "department", "district", "estimated", "industrial", "power", "processes", "rate", "reduce", "resources", "source", "supply", "water". | EXACT TITLE in water_rights: "Geothermal energy".
0.500
Inventory ↗ Q815410 EXACT TITLE
businessbusinessescompletiondifferentfacilityinformationinventorymanagementmaterialsnetworkprocessprojectsrequiredshapesupplysystemsystemswork
SHARED TOKENS (18): "business", "businesses", "completion", "different", "facility", "information", "inventory", "management", "materials", "network", "process", "projects", "required", "shape", "supply", "system", "systems", "work". | EXACT TITLE in water_rights: "Inventory". | EXACT TITLE in procurement_public_spending: "Inventory".
0.500
billionbuildingconstructioncontractordevelopersgeneralinformationlaborlargelegallylicensingmanagementprojectprojectsrequirementsresponsiblestaffthroughoutvendorswork
SHARED TOKENS (20): "billion", "building", "construction", "contractor", "developers", "general", "information", "labor", "large", "legally", "licensing", "management", "project", "projects", "requirements", "responsible", "staff", "throughout", "vendors", "work". | EXACT TITLE in procurement_public_spending: "General contractor".
0.500
accordingactualamonganotherapplycomprehensiveconsequencescontroldatadecisionsdesigndevelopmentengineeringevaluatedevaluationevenfinancehealthidentifyingimpact
SHARED TOKENS (47): "according", "actual", "among", "another", "apply", "comprehensive", "consequences", "control", "data", "decisions", "design", "development", "engineering", "evaluated", "evaluation", "even", "finance", "health", "identifying", "impact".... | EXACT TITLE in water_rights: "Risk management". | EXACT TITLE in procurement_public_spending: "Risk management".
0.500
administrativeagenciesassetsboardbusinesscomplianceconsultingcontrolcontrolsdatadepartmentseducationalestablishexaminationfederalgenerallygoverninggovernmentidentifyindependent
SHARED TOKENS (40): "administrative", "agencies", "assets", "board", "business", "compliance", "consulting", "control", "controls", "data", "departments", "educational", "establish", "examination", "federal", "generally", "governing", "government", "identify", "independent".... | EXACT TITLE in procurement_public_spending: "Internal audit".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomebillioncapacitycentralchangeconstructingcontainsdistributiondrinkingenvironmentalformindustrialissueslandmajormunicipaloperatingpercent
SHARED TOKENS (36): "agricultural", "agriculture", "become", "billion", "capacity", "central", "change", "constructing", "contains", "distribution", "drinking", "environmental", "form", "industrial", "issues", "land", "major", "municipal", "operating", "percent".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamendmentsamongassociationauthorityconstructioncontractscreateddepartmentestablishedextendfederallandlaterlawmaintenancemajormeridiannationalprogram
SHARED TOKENS (30): "act", "amendments", "among", "association", "authority", "construction", "contracts", "created", "department", "established", "extend", "federal", "land", "later", "law", "maintenance", "major", "meridian", "national", "program".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
alongsideanalysisappliesbuildingbusinesscapitalcommercialcompletionconstructioncontrolcostdesignfirmsincreasinglyinfrastructuremanagementmanagersobjectivesownerplanning
SHARED TOKENS (27): "alongside", "analysis", "applies", "building", "business", "capital", "commercial", "completion", "construction", "control", "cost", "design", "firms", "increasingly", "infrastructure", "management", "managers", "objectives", "owner", "planning".... | EXACT TITLE in procurement_public_spending: "Construction management".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopmentdifferentexceptionsformgoverngovernmentgrowthindustriallandland-uselocalplanningpolicypropertyrulesshapesingle
SHARED TOKENS (23): "allowing", "building", "determine", "development", "different", "exceptions", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "planning", "policy", "property", "rules", "shape", "single".... | EXACT TITLE in water_rights: "Zoning".
0.500
commercialconditionscontroldocumentformformsitselfplanningpurchasepurchasingrequiredresourcesupplierssystemtypes
SHARED TOKENS (15): "commercial", "conditions", "control", "document", "form", "forms", "itself", "planning", "purchase", "purchasing", "required", "resource", "suppliers", "system", "types". | EXACT TITLE in procurement_public_spending: "Purchase order".
0.500
Architect ↗ Q42973 EXACT TITLE
connectionconstructiondecisionsdesigndevelopmenteducationexperienceinstitutionsjurisdictionlicensemeansplanspracticalprincipalprofessionalprovidepublicpurposerequirementsrole
SHARED TOKENS (24): "connection", "construction", "decisions", "design", "development", "education", "experience", "institutions", "jurisdiction", "license", "means", "plans", "practical", "principal", "professional", "provide", "public", "purpose", "requirements", "role".... | EXACT TITLE in procurement_public_spending: "Architect".
0.500
actagencybecomedeliverydepartmentdevelopmentestablishedfederalgovernmentlawmanagementmillionpotentialpowerprogramprojectsprovisionsresourcesourcesupply
SHARED TOKENS (23): "act", "agency", "become", "delivery", "department", "development", "established", "federal", "government", "law", "management", "million", "potential", "power", "program", "projects", "provisions", "resource", "source", "supply".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
accessagencieschangeconditionscreateddevelopmentdifferentdistincteconomiceconomyeducationalemergencyenvironmentenvironmentalfacilitiesfirmsgeneralhealthindustrialinfrastructure
SHARED TOKENS (41): "access", "agencies", "change", "conditions", "created", "development", "different", "distinct", "economic", "economy", "educational", "emergency", "environment", "environmental", "facilities", "firms", "general", "health", "industrial", "infrastructure".... | EXACT TITLE in water_rights: "Infrastructure". | EXACT TITLE in procurement_public_spending: "Infrastructure".
0.500
Nitrate ↗ Q49916468 EXACT TITLE
agriculturalassociatedconsequencesdirectenvironmenthealthhistoricallymeansmillionpreservationprocessessignificantsourcesourceswater
SHARED TOKENS (15): "agricultural", "associated", "consequences", "direct", "environment", "health", "historically", "means", "million", "preservation", "processes", "significant", "source", "sources", "water". | EXACT TITLE in water_rights: "Nitrate".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundavailabilitybuildingconstructiondesigndownstreamengineeringfunctionsgoverninghealthincreaseindustriallandlargemaintenancemanagementprocessproject
SHARED TOKENS (36): "additional", "application", "around", "availability", "building", "construction", "design", "downstream", "engineering", "functions", "governing", "health", "increase", "industrial", "land", "large", "maintenance", "management", "process", "project".... | EXACT TITLE in water_rights: "Dam". | EXACT TITLE in procurement_public_spending: "Dam".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddirectlyissueslandlargemajorpopulationpotentialreduceresourcetimingtreatmenturbanwater
SHARED TOKENS (16): "become", "create", "demand", "directly", "issues", "land", "large", "major", "population", "potential", "reduce", "resource", "timing", "treatment", "urban", "water". | EXACT TITLE in water_rights: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
agricultureannualavailabilitybecomechangeconditionscostsdevelopingdirectlyeconomiceconomyenvironmentalexperiencefoodhealthhistoryimpactincreaselargelarger
SHARED TOKENS (33): "agriculture", "annual", "availability", "become", "change", "conditions", "costs", "developing", "directly", "economic", "economy", "environmental", "experience", "food", "health", "history", "impact", "increase", "large", "larger".... | EXACT TITLE in water_rights: "Drought".
0.500
Tort ↗ Q158970 EXACT TITLE
actcivilcodecodeseitherestablishedimposedlawlegalobligationsprovisionsratherremediesresultresultingrulesseparatesystems
SHARED TOKENS (18): "act", "civil", "code", "codes", "either", "established", "imposed", "law", "legal", "obligations", "provisions", "rather", "remedies", "result", "resulting", "rules", "separate", "systems". | EXACT TITLE in procurement_public_spending: "Tort".
0.500
additionalappropriateapprovalbudgetcalendarcentralcoverdutieseconomiceducationeitherentityfeesgovernmentindividualinfrastructureinstitutionsitselflawneed
SHARED TOKENS (25): "additional", "appropriate", "approval", "budget", "calendar", "central", "cover", "duties", "economic", "education", "either", "entity", "fees", "government", "individual", "infrastructure", "institutions", "itself", "law", "need".... | EXACT TITLE in procurement_public_spending: "Government budget".
0.500
administrativeapproximatelybecomebillionchangecharacterizedcreatecreatescurrentdescribesdevelopingdevelopmentdrinkingeconomiceducationeitherenvironmentalformedgrowthhealth
SHARED TOKENS (49): "administrative", "approximately", "become", "billion", "change", "characterized", "create", "creates", "current", "describes", "developing", "development", "drinking", "economic", "education", "either", "environmental", "formed", "growth", "health".... | EXACT TITLE in water_rights: "Urbanization".
0.500
Accounting ↗ Q4116214 EXACT TITLE
accountinganalysisboardbusinessbusinessescostcouncileconomicentitiesfirmsformsfunctionsgenerallyhistoryinformationmajormanagementoperationsorganizationsplans
SHARED TOKENS (34): "accounting", "analysis", "board", "business", "businesses", "cost", "council", "economic", "entities", "firms", "forms", "functions", "generally", "history", "information", "major", "management", "operations", "organizations", "plans".... | EXACT TITLE in water_rights: "Accounting". | EXACT TITLE in procurement_public_spending: "Accounting".
0.500
administrationagencyassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalformedgovernmentpersonnelregulatesstandardssurroundingtransportation
SHARED TOKENS (18): "administration", "agency", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "formed", "government", "personnel", "regulates", "standards", "surrounding", "transportation". | EXACT TITLE in procurement_public_spending: "Federal Aviation Administration".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributiondrainageengineeringenvironmentalmanagementmethodsphysicalplanningpolicypreservationqualityresearchresourceswater
SHARED TOKENS (16): "civil", "data", "distribution", "drainage", "engineering", "environmental", "management", "methods", "physical", "planning", "policy", "preservation", "quality", "research", "resources", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
Airport ↗ Q1248784 EXACT TITLE
activechangecommercialcontrolemergencyenvironmentalexperiencefacilitiesfacilitygeneralinfrastructurelandlargelargerleastlocalmaintainmajormakingopen
SHARED TOKENS (31): "active", "change", "commercial", "control", "emergency", "environmental", "experience", "facilities", "facility", "general", "infrastructure", "land", "large", "larger", "least", "local", "maintain", "major", "making", "open".... | EXACT TITLE in procurement_public_spending: "Airport".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotherbestenteritselflandlawlimitedprivatelypropertypublicpurposerightsroadstated
SHARED TOKENS (16): "access", "among", "another", "best", "enter", "itself", "land", "law", "limited", "privately", "property", "public", "purpose", "rights", "road", "stated". | EXACT TITLE in water_rights: "Easement".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordingaddressedanotherchaincivilcostsequipmentfacilityfoodinformationmanagementmaterialsmodeloperationalphysicalplanningpointprofessionalprovidepublic
SHARED TOKENS (27): "according", "addressed", "another", "chain", "civil", "costs", "equipment", "facility", "food", "information", "management", "materials", "model", "operational", "physical", "planning", "point", "professional", "provide", "public".... | EXACT TITLE in procurement_public_spending: "Logistics".
0.500
Procurement ↗ Q829492 EXACT TITLE
accountaccountingacquisitionagencybestbusinessconcerningdecisionsdefinedeliverygovernmentintendedopenpracticesprocessprocessesprocureprocurementprovidepublic
SHARED TOKENS (27): "account", "accounting", "acquisition", "agency", "best", "business", "concerning", "decisions", "define", "delivery", "government", "intended", "open", "practices", "process", "processes", "procure", "procurement", "provide", "public".... | EXACT TITLE in water_rights: "Procurement". | EXACT TITLE in procurement_public_spending: "Procurement".
0.500
budgetcivilconstructioncostsdesigneducationeducationalengineeringengineersfacilitiesinfrastructuremanagementmethodsoperationspersonnelplanningproceduresprofessionalprojectprojects
SHARED TOKENS (25): "budget", "civil", "construction", "costs", "design", "education", "educational", "engineering", "engineers", "facilities", "infrastructure", "management", "methods", "operations", "personnel", "planning", "procedures", "professional", "project", "projects".... | EXACT TITLE in procurement_public_spending: "Construction engineering".
0.500
assetsbroadercapitalcategoryconstructiondirectlydrinkingeconomiceitheremploymentenvironmentalfacilitiesgovernmenthealthinfrastructuremunicipalparksphysicalpreservationprivate
SHARED TOKENS (29): "assets", "broader", "capital", "category", "construction", "directly", "drinking", "economic", "either", "employment", "environmental", "facilities", "government", "health", "infrastructure", "municipal", "parks", "physical", "preservation", "private".... | EXACT TITLE in water_rights: "Public works". | EXACT TITLE in procurement_public_spending: "Public works".
0.500
accordingagriculturalagriculturechangesclassificationdifferentenvironmentalfoodformformshomeimpactindustrialmakingmethodsotherwisephysicalpreservationprocessingrequired
SHARED TOKENS (23): "according", "agricultural", "agriculture", "changes", "classification", "different", "environmental", "food", "form", "forms", "home", "impact", "industrial", "making", "methods", "otherwise", "physical", "preservation", "processing", "required".... | EXACT TITLE in water_rights: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententitygeneralgovernmentintendedlandlawlegalmeansownershipprivatepropertypublicpurposeresourcesstatustools
SHARED TOKENS (22): "acquisition", "business", "commercial", "different", "entity", "general", "government", "intended", "land", "law", "legal", "means", "ownership", "private", "property", "public", "purpose", "resources", "status", "tools".... | EXACT TITLE in water_rights: "Real estate".
0.500
Water treatment ↗ EXACT TITLE
appropriatebecomesdrinkingenvironmentenvironmentalhealthindustrialmaintenancematerialsmethodsprocessprocessesqualityresourcespecificsupplysystemstreatmentuseswater
SHARED TOKENS (20): "appropriate", "becomes", "drinking", "environment", "environmental", "health", "industrial", "maintenance", "materials", "methods", "process", "processes", "quality", "resource", "specific", "supply", "systems", "treatment", "uses", "water". | EXACT TITLE in water_rights: "Water treatment". | EXACT TITLE in procurement_public_spending: "Water treatment".
0.500
assessmentcompliancecontactdeterminesdrinkinggenerallyhealthimpactphysicalqualitysafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (16): "assessment", "compliance", "contact", "determines", "drinking", "generally", "health", "impact", "physical", "quality", "safety", "significant", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.500
analysisassociatedbecomecapabilitycompleteconsequencescreateengineeringenvironmentgeneralgrowthhistoryimagesleastmediamethodsoperationsperiodsplanningpotential
SHARED TOKENS (28): "analysis", "associated", "become", "capability", "complete", "consequences", "create", "engineering", "environment", "general", "growth", "history", "images", "least", "media", "methods", "operations", "periods", "planning", "potential".... | EXACT TITLE in procurement_public_spending: "Artificial intelligence".
0.500
Telemetry ↗ Q209867 EXACT TITLE
controlcostdatadigitalequipmentinstructionsmediamonitoringneednetworkoperatephysicalpowerreceiverequiresystemstransfer
SHARED TOKENS (17): "control", "cost", "data", "digital", "equipment", "instructions", "media", "monitoring", "need", "network", "operate", "physical", "power", "receive", "require", "systems", "transfer". | EXACT TITLE in water_rights: "Telemetry".
0.500
accessallowingassociationcompetingcoordinationcostscoverdevelopmenteconomiceitherformsgeneralgeographicgovernmenthistoricalinfrastructureintegratedintendedlocalmodel
SHARED TOKENS (45): "access", "allowing", "association", "competing", "coordination", "costs", "cover", "development", "economic", "either", "forms", "general", "geographic", "government", "historical", "infrastructure", "integrated", "intended", "local", "model".... | EXACT TITLE in procurement_public_spending: "Public transport".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyoncentralchannelcolumbiacommercialconstructioncontrolcreateddownstreamhistoryidaholargelimitedlowermajormilesnationalpolicyprivate
SHARED TOKENS (33): "agencies", "canyon", "central", "channel", "columbia", "commercial", "construction", "control", "created", "downstream", "history", "idaho", "large", "limited", "lower", "major", "miles", "national", "policy", "private".... | EXACT TITLE in water_rights: "Snake River".
0.500
associatedbeyonddatadescriptionsdevelopmententitiesgraphhistoricallyincreasinglymodelopenoperateprojectsrelationshipsrepresentationresearchsystemsuses
SHARED TOKENS (18): "associated", "beyond", "data", "descriptions", "development", "entities", "graph", "historically", "increasingly", "model", "open", "operate", "projects", "relationships", "representation", "research", "systems", "uses". | EXACT TITLE in procurement_public_spending: "Knowledge graph".
0.500
anotherbusinesscontractorcostsexistinggeneralitselflowerneedobligationsprocurementprojectpublicreceivereduceriskrulesspecificsupport
SHARED TOKENS (19): "another", "business", "contractor", "costs", "existing", "general", "itself", "lower", "need", "obligations", "procurement", "project", "public", "receive", "reduce", "risk", "rules", "specific", "support". | EXACT TITLE in procurement_public_spending: "Subcontractor".
0.500
Contract ↗ Q93288 EXACT TITLE
agreementagreementsapplybusinesscategorycivilcodecommercialcontractsdifferentdistinctdocumentdutieseitherestablishingframeworkgeneralgenerallygovernedindependent
SHARED TOKENS (42): "agreement", "agreements", "apply", "business", "category", "civil", "code", "commercial", "contracts", "different", "distinct", "document", "duties", "either", "establishing", "framework", "general", "generally", "governed", "independent".... | EXACT TITLE in water_rights: "Contract". | EXACT TITLE in procurement_public_spending: "Contract".
0.500
adaboisecommercialdepartmentfacilityfunctionsgeneralidahoincreasemilesmillionnationaloperatedoperatesreceiverequiringrightssupportuseswestern
SHARED TOKENS (20): "ada", "boise", "commercial", "department", "facility", "functions", "general", "idaho", "increase", "miles", "million", "national", "operated", "operates", "receive", "requiring", "rights", "support", "uses", "western". | EXACT TITLE in procurement_public_spending: "Boise Airport".
0.500
actadministeredagencyamendmentschangescontrolcoordinationdirectlydrinkingengineersenvironmentalfederalformgoverninginvolvinglawmaintainmajorphysicalprovisions
SHARED TOKENS (27): "act", "administered", "agency", "amendments", "changes", "control", "coordination", "directly", "drinking", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "major", "physical", "provisions".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
accordinganalysisbuildingclassificationcodescomplianceconstructiondesignenvironmentalhealthinventorylandlandscapemanagementplanplanningpolicyqualitytechnicaltrained
SHARED TOKENS (20): "according", "analysis", "building", "classification", "codes", "compliance", "construction", "design", "environmental", "health", "inventory", "land", "landscape", "management", "plan", "planning", "policy", "quality", "technical", "trained". | EXACT TITLE in procurement_public_spending: "Landscape architect".
0.500
Bridge ↗ Q12280 EXACT TITLE
adequateallowingbeneficialbridgeconnectingconnectionconstructioncreatedesignengineeringengineersenvironmentformsidentityimposedindustrialintendedlocalmajormiles
SHARED TOKENS (31): "adequate", "allowing", "beneficial", "bridge", "connecting", "connection", "construction", "create", "design", "engineering", "engineers", "environment", "forms", "identity", "imposed", "industrial", "intended", "local", "major", "miles".... | EXACT TITLE in water_rights: "Bridge". | EXACT TITLE in procurement_public_spending: "Bridge".
0.500
affordableassociateddemandeconomicemergencyformsgenerallygovernmenthomeindexlocalmarketsnationalownershipresponsesupply
SHARED TOKENS (16): "affordable", "associated", "demand", "economic", "emergency", "forms", "generally", "government", "home", "index", "local", "markets", "national", "ownership", "response", "supply". | EXACT TITLE in procurement_public_spending: "Affordable housing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddirectlydistributesdistributiondownstreamdrainageenvironmentalformgrowthimprovementsinstallation
SHARED TOKENS (42): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "directly", "distributes", "distribution", "downstream", "drainage", "environmental", "form", "growth", "improvements", "installation".... | EXACT TITLE in water_rights: "Irrigation".
0.500
approvalsbusinesscreateddatadelivereddepartmentdistinctdocumentslegalprocessprocessingpurchasereceivedrequiredrequirementsresponsibilityreviewsheetsupplierssupply
SHARED TOKENS (23): "approvals", "business", "created", "data", "delivered", "department", "distinct", "documents", "legal", "process", "processing", "purchase", "received", "required", "requirements", "responsibility", "review", "sheet", "suppliers", "supply".... | EXACT TITLE in procurement_public_spending: "Accounts payable".
0.500
accordingaccountingactadministrationannualapplyassetsauthorizationbusinessbusinessescertificationfewergovernmenthomeinspectionlargelicensemethodsnetoperate
SHARED TOKENS (31): "according", "accounting", "act", "administration", "annual", "apply", "assets", "authorization", "business", "businesses", "certification", "fewer", "government", "home", "inspection", "large", "license", "methods", "net", "operate".... | EXACT TITLE in procurement_public_spending: "Small business".
0.500
agencyagreementapproximatelyauthoritybestbusinessescapableconstructioncontractsdirecteconomiceconomyestimatedgovernmentgroupgrowthlocalorganizationspracticesprivate
SHARED TOKENS (35): "agency", "agreement", "approximately", "authority", "best", "businesses", "capable", "construction", "contracts", "direct", "economic", "economy", "estimated", "government", "group", "growth", "local", "organizations", "practices", "private".... | EXACT TITLE in procurement_public_spending: "Government procurement".
0.500
associationbestcontractorscontroldescribedeitherenvironmentequipmentevaluationmonitoringobjectivesprocessproducingprofileregulatedrequiredresourcesourcesthroughoutwater
SHARED TOKENS (20): "association", "best", "contractors", "control", "described", "either", "environment", "equipment", "evaluation", "monitoring", "objectives", "process", "producing", "profile", "regulated", "required", "resource", "sources", "throughout", "water". | EXACT TITLE in water_rights: "Well drilling".
0.500
actapplicationbecomesenterexpresslygenerallyneedpointqualityrequirementsrisksourcessurroundinguseswater
SHARED TOKENS (15): "act", "application", "becomes", "enter", "expressly", "generally", "need", "point", "quality", "requirements", "risk", "sources", "surrounding", "uses", "water". | EXACT TITLE in water_rights: "Return flow".
0.500
approximatelybillionboardformedgroupheadquarteredmajormediamovenationaloperatingoperationsprivatelyregionservingsouthwest
SHARED TOKENS (16): "approximately", "billion", "board", "formed", "group", "headquartered", "major", "media", "move", "national", "operating", "operations", "privately", "region", "serving", "southwest". | EXACT TITLE in procurement_public_spending: "Cox Enterprises".
0.500
actagricultureapproximatelyboardboisecapacitycompletionconstructiondesignhomeidaholaborlawmaterialsmilesnationaloperatedpowerprojectsprovide
SHARED TOKENS (27): "act", "agriculture", "approximately", "board", "boise", "capacity", "completion", "construction", "design", "home", "idaho", "labor", "law", "materials", "miles", "national", "operated", "power", "projects", "provide".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
adaboardboisecanyoncollegecomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedresidentssouthwest
SHARED TOKENS (27): "ada", "board", "boise", "canyon", "college", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents", "southwest".... | EXACT TITLE in water_rights: "College of Western Idaho". | EXACT TITLE in procurement_public_spending: "College of Western Idaho".
0.500
bestbusinesscontractorscontractscustomerdocumentfinalforminformationpotentialprocessprocurementqualitysubmittedsuppliersvendors
SHARED TOKENS (16): "best", "business", "contractors", "contracts", "customer", "document", "final", "form", "information", "potential", "process", "procurement", "quality", "submitted", "suppliers", "vendors". | EXACT TITLE in procurement_public_spending: "Request for proposal".
0.500
bidbusinessbuyersformgovernmentincreasinglyobtainopenordinarypotentialprivateprocessprocessesprocurementremainsspecific
SHARED TOKENS (16): "bid", "business", "buyers", "form", "government", "increasingly", "obtain", "open", "ordinary", "potential", "private", "process", "processes", "procurement", "remains", "specific". | EXACT TITLE in procurement_public_spending: "Reverse auction".
0.500
accessagenciesbeyonddevelopingeconomicformgenerallygovernmentlocaloperateoperatedoperatesoperatorsorganizationsprivateprovidepublicservingsubjectsupports
SHARED TOKENS (22): "access", "agencies", "beyond", "developing", "economic", "form", "generally", "government", "local", "operate", "operated", "operates", "operators", "organizations", "private", "provide", "public", "serving", "subject", "supports".... | EXACT TITLE in procurement_public_spending: "Paratransit".
0.480
Ditch ↗ Q2048319 EXACT TITLE
alongsidearoundchannelconditionscreateddrainagemajorproviderequiredruralsourcethemwaterwhose
SHARED TOKENS (14): "alongside", "around", "channel", "conditions", "created", "drainage", "major", "provide", "required", "rural", "source", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.480
anotherconnecteddesigndevelopingdistributionengineeringgoverninglocalqualitysolidsuppliessystemsystemswater
SHARED TOKENS (14): "another", "connected", "design", "developing", "distribution", "engineering", "governing", "local", "quality", "solid", "supplies", "system", "systems", "water". | EXACT TITLE in water_rights: "Hydrogeology".
0.480
Wheat ↗ Q15645384 EXACT TITLE
arounddemandfoodgeneralgrouplandlargermajormakingmillionpopulationqualityrecordsource
SHARED TOKENS (14): "around", "demand", "food", "general", "group", "land", "larger", "major", "making", "million", "population", "quality", "record", "source". | EXACT TITLE in water_rights: "Wheat".
0.480
accessanotherbeneficialdescribingevenlegalnamesownerpropertyrightsspecifictitleviewwater
SHARED TOKENS (14): "access", "another", "beneficial", "describing", "even", "legal", "names", "owner", "property", "rights", "specific", "title", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.480
adaboisecanyonchannelcountiesengineersidahomilesoperatedtreasureupstreamvalleywaterwestern
SHARED TOKENS (14): "ada", "boise", "canyon", "channel", "counties", "engineers", "idaho", "miles", "operated", "treasure", "upstream", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.480
certificationcompleteextendlaborlicenseoutsidepermanentpotentialpractitionersprofessionalregulatedsystemtrainingworking
SHARED TOKENS (14): "certification", "complete", "extend", "labor", "license", "outside", "permanent", "potential", "practitioners", "professional", "regulated", "system", "training", "working". | EXACT TITLE in water_rights: "Apprenticeship".
0.480
agricultureboisecivilcountiesengineeringengineersidahonationaloperatedprovidepurposeupstreamwaterwestern
SHARED TOKENS (14): "agriculture", "boise", "civil", "counties", "engineering", "engineers", "idaho", "national", "operated", "provide", "purpose", "upstream", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.480
Highway ↗ Q269949 EXACT TITLE
accessaccordingcodecoversgovernmentlandlegalmaintainsmajorprivatepublicrightsroadsystem
SHARED TOKENS (14): "access", "according", "code", "covers", "government", "land", "legal", "maintains", "major", "private", "public", "rights", "road", "system". | EXACT TITLE in procurement_public_spending: "Highway".
0.480
Arsenic ↗ Q871 EXACT TITLE
agencydetermineenvironmentalformformsgrouphealthlargerproposedresearchriskrolesitestherefore
SHARED TOKENS (14): "agency", "determine", "environmental", "form", "forms", "group", "health", "larger", "proposed", "research", "risk", "role", "sites", "therefore". | EXACT TITLE in water_rights: "Arsenic".
0.460
agriculturalapproximatelychangedrinkingindustrialissuesresourceresourcessourcesourcessupplywastewaterwater
SHARED TOKENS (13): "agricultural", "approximately", "change", "drinking", "industrial", "issues", "resource", "resources", "source", "sources", "supply", "wastewater", "water". | EXACT TITLE in water_rights: "Water resources".
0.460
adaapproximatelyboisecanyoncapacitychannelidahomilessystemtreasurevalleywaterwestern
SHARED TOKENS (13): "ada", "approximately", "boise", "canyon", "capacity", "channel", "idaho", "miles", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.460
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationconditionscoverdifferentdrinkingimpactphysicalprovideresourcewater
SHARED TOKENS (13): "agriculture", "annual", "change", "classification", "conditions", "cover", "different", "drinking", "impact", "physical", "provide", "resource", "water". | EXACT TITLE in water_rights: "Snowpack".
0.460
administrationagencydepartmentdivisionfederalmajorofficeprogramprogramspublicroadroletransportation
SHARED TOKENS (13): "administration", "agency", "department", "division", "federal", "major", "office", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in procurement_public_spending: "Federal Highway Administration".
0.440
MODFLOW ↗ Q6716996 EXACT TITLE
beyondcodecommercialconditionsdefinemodeloperatingprogrampublicsourcesystemstext
SHARED TOKENS (12): "beyond", "code", "commercial", "conditions", "define", "model", "operating", "program", "public", "source", "systems", "text". | EXACT TITLE in water_rights: "MODFLOW".
0.440
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmenthomeindustriallandlayermajormaterialsregionsolidsourcewater
SHARED TOKENS (12): "beyond", "environment", "home", "industrial", "land", "layer", "major", "materials", "region", "solid", "source", "water". | EXACT TITLE in water_rights: "Aquifer".
0.440
administrationagencyassociateddepartmenteconomicfederalmanagesnationalofficepotentialresourcesresponsible
SHARED TOKENS (12): "administration", "agency", "associated", "department", "economic", "federal", "manages", "national", "office", "potential", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.440
adaagencyboisecanyonidahooperatesproviderpublicregionalservingtreasurevalley
SHARED TOKENS (12): "ada", "agency", "boise", "canyon", "idaho", "operates", "provider", "public", "regional", "serving", "treasure", "valley". | EXACT TITLE in procurement_public_spending: "Valley Regional Transit".
0.420
associatedautomateddatainformationplanningprocessesprocurementpurchasepurchasingresourcesystems
SHARED TOKENS (11): "associated", "automated", "data", "information", "planning", "processes", "procurement", "purchase", "purchasing", "resource", "systems". | EXACT TITLE in procurement_public_spending: "E-procurement".
0.420
anotherdrainageengineeringenvironmentallandpermanentpointrathersinglesystemwater
SHARED TOKENS (11): "another", "drainage", "engineering", "environmental", "land", "permanent", "point", "rather", "single", "system", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.400
anotherchaincurrentdifferentevenformsmakingprocessratesingle
SHARED TOKENS (10): "another", "chain", "current", "different", "even", "forms", "making", "process", "rate", "single". | EXACT TITLE in water_rights: "Radionuclide".
0.400
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregionalresponsible
SHARED TOKENS (10): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "responsible". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.400
Invoice ↗ Q190581 EXACT TITLE
capitalcommercialcostsdocumentlargepointpurchasestatedtransactionview
SHARED TOKENS (10): "capital", "commercial", "costs", "document", "large", "point", "purchase", "stated", "transaction", "view". | EXACT TITLE in procurement_public_spending: "Invoice".
0.400
businesscertificationentitygovernmentleastpercentprogramprovideresearchtransportation
SHARED TOKENS (10): "business", "certification", "entity", "government", "least", "percent", "program", "provide", "research", "transportation". | EXACT TITLE in procurement_public_spending: "Disadvantaged business enterprise".
0.400
aroundbusinessdistributiongenerallyidahooperatespowerpurchaseregulatedutility
SHARED TOKENS (10): "around", "business", "distribution", "generally", "idaho", "operates", "power", "purchase", "regulated", "utility". | EXACT TITLE in procurement_public_spending: "Idaho Power".
0.400
agenciesdocumenteddocumentsgenerallygovernmentinformationjurisdictionpublicrecordstransactions
SHARED TOKENS (10): "agencies", "documented", "documents", "generally", "government", "information", "jurisdiction", "public", "records", "transactions". | EXACT TITLE in procurement_public_spending: "Public records".
0.380
determinesevaluatedevidencelegalobligationsprocessprocessesrightsshows
SHARED TOKENS (9): "determines", "evaluated", "evidence", "legal", "obligations", "process", "processes", "rights", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.380
Carahsoft ↗ Q5037630 EXACT TITLE
consultingeducationalfederalheadquarteredinformationinstitutionslocalprivatelyprovider
SHARED TOKENS (9): "consulting", "educational", "federal", "headquartered", "information", "institutions", "local", "privately", "provider". | EXACT TITLE in procurement_public_spending: "Carahsoft".
0.380
differentgenerallylawlegalphysicalsourcesystemsuserswater
SHARED TOKENS (9): "different", "generally", "law", "legal", "physical", "source", "systems", "users", "water". | EXACT TITLE in water_rights: "Water right". | EXACT TITLE in procurement_public_spending: "Water right".
0.380
bankingcapacitydeliveryeitherfeeperiodsrightssignificantwater
SHARED TOKENS (9): "banking", "capacity", "delivery", "either", "fee", "periods", "rights", "significant", "water". | EXACT TITLE in water_rights: "Water banking".
0.380
annualapplicationapproximatelyaroundcapacitycontainsdirectevensource
SHARED TOKENS (9): "annual", "application", "approximately", "around", "capacity", "contains", "direct", "even", "source". | EXACT TITLE in water_rights: "Geothermal heating".
0.380
agriculturallocalmanagementopenprocessesresourcerolesurfaceswater
SHARED TOKENS (9): "agricultural", "local", "management", "open", "processes", "resource", "role", "surfaces", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.360
adaagencydistrictentityestablishedgovernmentidahoindependent
SHARED TOKENS (8): "ada", "agency", "district", "entity", "established", "government", "idaho", "independent". | EXACT TITLE in procurement_public_spending: "Ada County Highway District".
0.360
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahomilessquareurbanwestern
SHARED TOKENS (8): "agricultural", "approximately", "boise", "idaho", "miles", "square", "urban", "western". | EXACT TITLE in water_rights: "Boise River".
0.340
Reservoir ↗ Q131681 EXACT TITLE
buildingcontrollingcreatedexistingformpowerwater
SHARED TOKENS (7): "building", "controlling", "created", "existing", "form", "power", "water". | EXACT TITLE in water_rights: "Reservoir".
0.340
capacitychannelestimatedlandmajorrecordwater
SHARED TOKENS (7): "capacity", "channel", "estimated", "land", "major", "record", "water". | EXACT TITLE in water_rights: "Streamflow".
0.320
agriculturebuildingdevelopmentlandlandscapepurpose
SHARED TOKENS (6): "agriculture", "building", "development", "land", "landscape", "purpose". | EXACT TITLE in water_rights: "Land development". | EXACT TITLE in procurement_public_spending: "Land development".
0.320
agencyassociationbaridahointegratedisb
SHARED TOKENS (6): "agency", "association", "bar", "idaho", "integrated", "isb". | EXACT TITLE in water_rights: "Idaho State Bar". | EXACT TITLE in procurement_public_spending: "Idaho State Bar".
0.320
drainageenvironmentalmethodsprocessprocesseswater
SHARED TOKENS (6): "drainage", "environmental", "methods", "process", "processes", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.300
accountingactiveanothercollegecontinuingdemandeducationevenexaminationexperiencefirmsgenerallygrowthlaborlegallylicenselicensinglicensuremaintainotherwise
SHARED TOKENS (29): "accounting", "active", "another", "college", "continuing", "demand", "education", "even", "examination", "experience", "firms", "generally", "growth", "labor", "legally", "license", "licensing", "licensure", "maintain", "otherwise"....
0.300
amongbuildingbusinessescapitalchaincontrolcostscreatingdelivereddemanddepartmentdesigndistributionexistingfunctionsholdinginformationinfrastructureintegratedinventory
SHARED TOKENS (44): "among", "building", "businesses", "capital", "chain", "control", "costs", "creating", "delivered", "demand", "department", "design", "distribution", "existing", "functions", "holding", "information", "infrastructure", "integrated", "inventory"....
0.300
administrationautomatedbusinessconsequencesdatadecisionseconomiceducationeducationalemploymenthealthimageslawlegalmediaprocessprocessingpublicrequiringsources
SHARED TOKENS (23): "administration", "automated", "business", "consequences", "data", "decisions", "economic", "education", "educational", "employment", "health", "images", "law", "legal", "media", "process", "processing", "public", "requiring", "sources"....
0.300
Open data ↗ Q309901 KW CROSS HIGH
accesscapablecreateddataeducationeducationalestablishedformformsgenerallygovgovernmentgrowthinstitutionsitselflicenselicensedopenpropertypurpose
SHARED TOKENS (24): "access", "capable", "created", "data", "education", "educational", "established", "form", "forms", "generally", "gov", "government", "growth", "institutions", "itself", "license", "licensed", "open", "property", "purpose"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcharacterizedcommercialconsequencesconstitutescorecostsdescribeddevelopmentenvironmentenvironmentalexistingformgeographicgrowthindustrialinfrastructure
SHARED TOKENS (32): "agency", "associated", "become", "building", "characterized", "commercial", "consequences", "constitutes", "core", "costs", "described", "development", "environment", "environmental", "existing", "form", "geographic", "growth", "industrial", "infrastructure"....
0.300
agenciesapplicationbusinesscapabilityclassificationconsolidateddistributioninstitutionslabormanagementmechanismoutsidepermanentprocessesprocureprogramsrisksignificantstaffingsystem
SHARED TOKENS (23): "agencies", "application", "business", "capability", "classification", "consolidated", "distribution", "institutions", "labor", "management", "mechanism", "outside", "permanent", "processes", "procure", "programs", "risk", "significant", "staffing", "system"....
0.300
analysisanotherbroaderbusinessdataengineeringgeographicindexinformationinstitutionalintegratedmanagementmethodsopenoperationsorganizationsphysicalplanningproceduresprocesses
SHARED TOKENS (27): "analysis", "another", "broader", "business", "data", "engineering", "geographic", "index", "information", "institutional", "integrated", "management", "methods", "open", "operations", "organizations", "physical", "planning", "procedures", "processes"....
0.300
Temporary work ↗ Q667944 KW CROSS HIGH
accountingagencyanotherassignmentscharacterizedconsultantscontractsdevelopmentdifferenteconomyemployeeemploymentengineeringhealthincreasinglyindividuallaborlimitedmarketneed
SHARED TOKENS (36): "accounting", "agency", "another", "assignments", "characterized", "consultants", "contracts", "development", "different", "economy", "employee", "employment", "engineering", "health", "increasingly", "individual", "labor", "limited", "market", "need"....
0.300
automatedcentralcontrolcreatecreatedenvironmentequipmentfacilitiesindividualindustrialintegratedlargemaintainmaterialsneedprocessprocessingreceivereduceresearch
SHARED TOKENS (25): "automated", "central", "control", "create", "created", "environment", "equipment", "facilities", "individual", "industrial", "integrated", "large", "maintain", "materials", "need", "process", "processing", "receive", "reduce", "research"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercivileconomiceitherenvironmentalgenerallygoverninggovernsissuesjurisdictionlandlawlegalmajorownershipprivatepropertypublicrelationships
SHARED TOKENS (25): "acquisition", "another", "civil", "economic", "either", "environmental", "generally", "governing", "governs", "issues", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "relationships"....
0.300
administrationagreementsamendmentsamonganalysisbusinesschangescommercialcomplianceconditionsconstructionconsultantscontractsdocumentingimplementationimprovementslargerlegalmanagementoperational
SHARED TOKENS (43): "administration", "agreements", "amendments", "among", "analysis", "business", "changes", "commercial", "compliance", "conditions", "construction", "consultants", "contracts", "documenting", "implementation", "improvements", "larger", "legal", "management", "operational"....
0.300
agriculturalagriculturebusinessescostcostsdirectdistributiondrinkingenvironmentalindustrialmanagementmunicipalprocessreduceregionrequiresourcestandardssupplysystem
SHARED TOKENS (25): "agricultural", "agriculture", "businesses", "cost", "costs", "direct", "distribution", "drinking", "environmental", "industrial", "management", "municipal", "process", "reduce", "region", "require", "source", "standards", "supply", "system"....
0.300
accountingactbusinesscompliancecontrolcontrolsentitiesimprovementsmanagementmeansobjectivesoperationalphysicalpoliciespracticesproceduresprocesspropertyprotectingpublic
SHARED TOKENS (28): "accounting", "act", "business", "compliance", "control", "controls", "entities", "improvements", "management", "means", "objectives", "operational", "physical", "policies", "practices", "procedures", "process", "property", "protecting", "public"....
0.300
actadequateadministeredagenciesauthoritycodecomprehensivedescribeddevelopmentdifferentdirectseconomicfederalgrowthlawmeansnationalpointpreservationprotecting
SHARED TOKENS (26): "act", "adequate", "administered", "agencies", "authority", "code", "comprehensive", "described", "development", "different", "directs", "economic", "federal", "growth", "law", "means", "national", "point", "preservation", "protecting"....
0.300
activeagenciesassociatedbusinessescapacityconsequencesdeterminedistributioneconomicemploymententryexistingfirmsindustrialissueslandlawmarketpowerproposed
SHARED TOKENS (25): "active", "agencies", "associated", "businesses", "capacity", "consequences", "determine", "distribution", "economic", "employment", "entry", "existing", "firms", "industrial", "issues", "land", "law", "market", "power", "proposed"....
0.300
additionalapplicationaroundavailabilitycategorycostdeliverydevelopmentdistinguisheconomyeitherenvironmentfeefeesforminfrastructurelicensemodeloperatingownership
SHARED TOKENS (31): "additional", "application", "around", "availability", "category", "cost", "delivery", "development", "distinguish", "economy", "either", "environment", "fee", "fees", "form", "infrastructure", "license", "model", "operating", "ownership"....
0.300
anotherbecomechainconsolidationdescribeddifferentdirectlyeconomyfinalintegratedlargemakingmanagementmarketmarketplaceneedopenownershiprathersuppliers
SHARED TOKENS (23): "another", "become", "chain", "consolidation", "described", "different", "directly", "economy", "final", "integrated", "large", "making", "management", "market", "marketplace", "need", "open", "ownership", "rather", "suppliers"....
0.300
accountadditionalagricultureannualboisechangechangesdatadescribeddifferentestimatedexperienceextendgeneralgenerallyhistoryidahoincreaseleastmakes
SHARED TOKENS (29): "account", "additional", "agriculture", "annual", "boise", "change", "changes", "data", "described", "different", "estimated", "experience", "extend", "general", "generally", "history", "idaho", "increase", "least", "makes"....
0.300
accountingacquisitionbusinesscapitalchangescreatecurrentdirectlydistributiondutieseconomyeducationemergencyemploymententryestablishesfeesfinalfirmsgovernment
SHARED TOKENS (39): "accounting", "acquisition", "business", "capital", "changes", "create", "current", "directly", "distribution", "duties", "economy", "education", "emergency", "employment", "entry", "establishes", "fees", "final", "firms", "government"....
0.300
compliancecontractscostimprovementslawlegalmanagementobligationsoperationalprocessesreducerenewalrequirementsrisksignificantthroughout
SHARED TOKENS (16): "compliance", "contracts", "cost", "improvements", "law", "legal", "management", "obligations", "operational", "processes", "reduce", "renewal", "requirements", "risk", "significant", "throughout".
0.300
additionalanalysisanotherbecomebestchangeconsultantsconsultingdescriptiondevelopmenteconomicfirmsfunctionsgeneralgeographicimplementationlegalmanagementmarketsmodel
SHARED TOKENS (37): "additional", "analysis", "another", "become", "best", "change", "consultants", "consulting", "description", "development", "economic", "firms", "functions", "general", "geographic", "implementation", "legal", "management", "markets", "model"....
0.300
OpenGov ↗ Q17084399 EXACT TITLE
februarygovernmentheadquarteredownerprivate
SHARED TOKENS (5): "february", "government", "headquartered", "owner", "private". | EXACT TITLE in procurement_public_spending: "OpenGov".
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsdescribingdevelopmentenvironmentenvironmentalgeneralgrowthindustrialpointpoliciesprocessprogramreduceresultresultingsourcesourceswastewaterwater
SHARED TOKENS (20): "agriculture", "controls", "describing", "development", "environment", "environmental", "general", "growth", "industrial", "point", "policies", "process", "program", "reduce", "result", "resulting", "source", "sources", "wastewater", "water".
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecreateddifferentfacilitygovernmentlandlegallocaloperateotherwiseownerownershipphysicalprivateretainrightsroadsimplyspecific
SHARED TOKENS (25): "authority", "capable", "created", "different", "facility", "government", "land", "legal", "local", "operate", "otherwise", "owner", "ownership", "physical", "private", "retain", "rights", "road", "simply", "specific"....
0.300
budgetbuildingconstructioncontractorcontractorscostslawprofessionalprojectprojectsresponsiblesidesurveyorstitlevaluationwork
SHARED TOKENS (16): "budget", "building", "construction", "contractor", "contractors", "costs", "law", "professional", "project", "projects", "responsible", "side", "surveyors", "title", "valuation", "work".
0.300
collegeeconomiceducationeducationalformsgeneralindividualinstitutionmethodsnamespreparesprovideschoolsspecializedspecifictechnicaltraining
SHARED TOKENS (17): "college", "economic", "education", "educational", "forms", "general", "individual", "institution", "methods", "names", "prepares", "provide", "schools", "specialized", "specific", "technical", "training".
0.300
accessamongbestbusinessescapacitychangesdevelopersdevelopmenteconomiceducationevaluatedformformsgovernmenthistoricallyhistoryhomeincreaseissuesleast
SHARED TOKENS (40): "access", "among", "best", "businesses", "capacity", "changes", "developers", "development", "economic", "education", "evaluated", "form", "forms", "government", "historically", "history", "home", "increase", "issues", "least"....
0.300
Data quality ↗ Q1757694 KW CROSS HIGH
becomesbusinessesdataevenformgenerallyinformationintendedmakingoperationsplanningpurposequalityrepresentsrequiredsignificantsourcesstandardsuses
SHARED TOKENS (19): "becomes", "businesses", "data", "even", "form", "generally", "information", "intended", "making", "operations", "planning", "purpose", "quality", "represents", "required", "significant", "sources", "standards", "uses".
0.300
accessanotherassociatedcategoriescostcostsdifferenteconomicexperienceformedidentitymanagementproviderresourcesresultsuppliersvalue
SHARED TOKENS (17): "access", "another", "associated", "categories", "cost", "costs", "different", "economic", "experience", "formed", "identity", "management", "provider", "resources", "result", "suppliers", "value".
0.300
allocationanalysisattributesconsequencesdatadecisionsdesigneliminategenerallyindividualitselflegalmeansprocessesresponsibilityresulting
SHARED TOKENS (16): "allocation", "analysis", "attributes", "consequences", "data", "decisions", "design", "eliminate", "generally", "individual", "itself", "legal", "means", "processes", "responsibility", "resulting".
0.300
agriculturalagriculturebecomebuildingcategorychangesconstructioncontrolcontrollingdifferentdrainagegenerallylandlargelocalmakingmanagementoperationspointprincipal
SHARED TOKENS (34): "agricultural", "agriculture", "become", "building", "category", "changes", "construction", "control", "controlling", "different", "drainage", "generally", "land", "large", "local", "making", "management", "operations", "point", "principal"....
0.300
actadministersassociatedauthorizationdevelopmentdivisionengineersenvironmentalimprovementsindexinfrastructurenationalnetpdfpublicrequirementsresourcesstructuraltextwater
SHARED TOKENS (20): "act", "administers", "associated", "authorization", "development", "division", "engineers", "environmental", "improvements", "index", "infrastructure", "national", "net", "pdf", "public", "requirements", "resources", "structural", "text", "water".
0.300
additionalcommercialdevelopingdistributiondownstreamdrainagedrinkingfacilitiesgenerallyindustrialinstitutionlocallyneednetworkpipepointprivateprovidepublicrather
SHARED TOKENS (28): "additional", "commercial", "developing", "distribution", "downstream", "drainage", "drinking", "facilities", "generally", "industrial", "institution", "locally", "need", "network", "pipe", "point", "private", "provide", "public", "rather"....
0.300
accordingaccountagencybusinessbusinessescentralcertificationcontrolleddevelopmentfederalfirmsleastmillionoperatedreviewwest
SHARED TOKENS (16): "according", "account", "agency", "business", "businesses", "central", "certification", "controlled", "development", "federal", "firms", "least", "million", "operated", "review", "west".
0.300
amongapproximatelyassociationboisecanyoncapacitycontainscountiescreatedcreatesdirectlyedgefebruaryfederalidaholocallowermilesnampanational
SHARED TOKENS (32): "among", "approximately", "association", "boise", "canyon", "capacity", "contains", "counties", "created", "creates", "directly", "edge", "february", "federal", "idaho", "local", "lower", "miles", "nampa", "national"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
applyaroundchangedataengineeringincreaseminutesmodelmonitoringpointresponseresultssimplysystemtestingwater
SHARED TOKENS (16): "apply", "around", "change", "data", "engineering", "increase", "minutes", "model", "monitoring", "point", "response", "results", "simply", "system", "testing", "water".
0.300
analysisassessmentbestbroaderbuildingchangechangescontroldescribingeitherengineeringimpactincreaseindividualinfrastructurelandscapemanagementmethodspotentialpractices
SHARED TOKENS (28): "analysis", "assessment", "best", "broader", "building", "change", "changes", "control", "describing", "either", "engineering", "impact", "increase", "individual", "infrastructure", "landscape", "management", "methods", "potential", "practices"....
0.300
appliesbeneficialcivilconstructioncontrolcreatedesignengineeringengineersenvironmentenvironmentalhealthimpactindustrialissueslawlicensinglocalmaintainmanagement
SHARED TOKENS (37): "applies", "beneficial", "civil", "construction", "control", "create", "design", "engineering", "engineers", "environment", "environmental", "health", "impact", "industrial", "issues", "law", "licensing", "local", "maintain", "management"....
0.300
acquisitionacquisitionsactanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentitiesentityfederalgovernedgovernment
SHARED TOKENS (40): "acquisition", "acquisitions", "act", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entities", "entity", "federal", "governed", "government"....
0.300
claimscostcostscoverscreatedevenexpresslyformedgeneralgroupimposedindividuallegalotherwisepoliciespolicyprotectsratherriskrule
SHARED TOKENS (24): "claims", "cost", "costs", "covers", "created", "even", "expressly", "formed", "general", "group", "imposed", "individual", "legal", "otherwise", "policies", "policy", "protects", "rather", "risk", "rule"....
0.300
Cost estimate ↗ Q795053 KW CROSS HIGH
associationcostcostsdatadefinesdocumentedengineeringestablishedfebruarygovernmentindividualmethodsofficepointpotentialprocessprogramprojectreliablesingle
SHARED TOKENS (21): "association", "cost", "costs", "data", "defines", "documented", "engineering", "established", "february", "government", "individual", "methods", "office", "point", "potential", "process", "program", "project", "reliable", "single"....
0.300
agencyaroundassessmentdepartmenteducationemployeeengineersenvironmentalestablishingfederalgovernmentindependentinformationlegallocalmattersmonitoringnationalpermittingprograms
SHARED TOKENS (28): "agency", "around", "assessment", "department", "education", "employee", "engineers", "environmental", "establishing", "federal", "government", "independent", "information", "legal", "local", "matters", "monitoring", "national", "permitting", "programs"....
0.300
accessaccountingbillionbusinesscapacitycategorycommercialcoredatadepartmentsdevelopingdevelopmentexistingfinancefunctionsgeneralimpactincreasinglyinformationintegrated
SHARED TOKENS (47): "access", "accounting", "billion", "business", "capacity", "category", "commercial", "core", "data", "departments", "developing", "development", "existing", "finance", "functions", "general", "impact", "increasingly", "information", "integrated"....
0.300
agriculturearoundbillioncapacitycentralchangechangesconditionscurrentdemanddevelopmentdifferenteconomicenvironmentalexperienceincreaseinformationinfrastructureleastlocal
SHARED TOKENS (40): "agriculture", "around", "billion", "capacity", "central", "change", "changes", "conditions", "current", "demand", "development", "different", "economic", "environmental", "experience", "increase", "information", "infrastructure", "least", "local"....
0.300
agencyauthorizeddirecteconomicentityfederalformgeneralgovernmentlawlocalorganizationsoutsideprivateprogramsprojectspropertypublicpurposespecific
SHARED TOKENS (21): "agency", "authorized", "direct", "economic", "entity", "federal", "form", "general", "government", "law", "local", "organizations", "outside", "private", "programs", "projects", "property", "public", "purpose", "specific"....
0.300
agenciesamonganotherappropriateavailabilitybestbidbusinessbusinessescategoriescomparecontractorsdeliverydeterminedifferentdocumentationdocumentseitherentireentity
SHARED TOKENS (51): "agencies", "among", "another", "appropriate", "availability", "best", "bid", "business", "businesses", "categories", "compare", "contractors", "delivery", "determine", "different", "documentation", "documents", "either", "entire", "entity"....
0.300
CARES Act ↗ Q88815228 KW CROSS HIGH
actadditionaladministrationapplybillionbudgetbusinessbusinessesclassconsolidateddevelopmentdirecteconomicgenerallyhealthhistoryimpactindividuallargerlater
SHARED TOKENS (30): "act", "additional", "administration", "apply", "billion", "budget", "business", "businesses", "class", "consolidated", "development", "direct", "economic", "generally", "health", "history", "impact", "individual", "larger", "later"....
0.300
chaincostdevelopingdevelopmentdistinctenvironmentfirmsincreaseindividualinfrastructurelabormanagementmarketoperationsplanningprocessprocessesprocurementprofessionalspurchase
SHARED TOKENS (26): "chain", "cost", "developing", "development", "distinct", "environment", "firms", "increase", "individual", "infrastructure", "labor", "management", "market", "operations", "planning", "process", "processes", "procurement", "professionals", "purchase"....
0.300
becomesdatadigitalembeddedexpandedfinancefunctionsinformationinfrastructurenetworkphysicalpowerprocessesprotectingprovidestandardssystemstherefore
SHARED TOKENS (18): "becomes", "data", "digital", "embedded", "expanded", "finance", "functions", "information", "infrastructure", "network", "physical", "power", "processes", "protecting", "provide", "standards", "systems", "therefore".
0.300
agricultureanalysisapplicationdifferentedgehealthlandmakingmanagementmeansmethodsmodelmonitoringpublicqualityrathersuppliessystemsthereforetreatment
SHARED TOKENS (22): "agriculture", "analysis", "application", "different", "edge", "health", "land", "making", "management", "means", "methods", "model", "monitoring", "public", "quality", "rather", "supplies", "systems", "therefore", "treatment"....
0.300
accountingamongcapacityconstructioncreatingdemanddirectenvironmentalfailureimpactissueslandlargemakingminutespopulationpowerprincipallyprovideregion
SHARED TOKENS (30): "accounting", "among", "capacity", "construction", "creating", "demand", "direct", "environmental", "failure", "impact", "issues", "land", "large", "making", "minutes", "population", "power", "principally", "provide", "region"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalappropriatebusinesscatalogcommercialfacilitiesgenerallygrowthhomeimprovementsindependentlargelargermaintainsmaterialsnationalopenplanningpool
SHARED TOKENS (27): "active", "agricultural", "appropriate", "business", "catalog", "commercial", "facilities", "generally", "growth", "home", "improvements", "independent", "large", "larger", "maintains", "materials", "national", "open", "planning", "pool"....
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
capacitychangecompetingcontrolinformationlocalnationalneedreduceroadsignalssquaresystemsystemsusers
SHARED TOKENS (15): "capacity", "change", "competing", "control", "information", "local", "national", "need", "reduce", "road", "signals", "square", "system", "systems", "users".
0.300
actaddressesadequateagenciesagreementagreementschangecomplianceconcerningcontroldevelopmenteconomicenvironmentenvironmentalestablishgrowthimpactinvolvingissuesjudicial
SHARED TOKENS (34): "act", "addresses", "adequate", "agencies", "agreement", "agreements", "change", "compliance", "concerning", "control", "development", "economic", "environment", "environmental", "establish", "growth", "impact", "involving", "issues", "judicial"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcharacterizedcommercialdetermineoutsideprocesspublicregisterrequiredrequirementsstandardssupplysystemtypeswaterworks
SHARED TOKENS (17): "association", "building", "characterized", "commercial", "determine", "outside", "process", "public", "register", "required", "requirements", "standards", "supply", "system", "types", "water", "works".
0.300
agenciesavailabilitybuildingbusinesscategoriesdeliverydevelopingdocumentdocumentseitherentirefilesfinalformgenerallygovernmentinformationlegalonlineopen
SHARED TOKENS (34): "agencies", "availability", "building", "business", "categories", "delivery", "developing", "document", "documents", "either", "entire", "files", "final", "form", "generally", "government", "information", "legal", "online", "open"....
0.300
actbestbeyondbidbusinesscompetingcontractorscontractscostsdecisionsdifferenteconomicevaluationformsgovernmentguidanceincreaseincreasinglylegallymeans
SHARED TOKENS (39): "act", "best", "beyond", "bid", "business", "competing", "contractors", "contracts", "costs", "decisions", "different", "economic", "evaluation", "forms", "government", "guidance", "increase", "increasingly", "legally", "means"....
0.300
accordinganalysisbecomesdefinedesigndocumentationengineerengineeringengineersenvironmentestablishedgeneralgovernmentlegallicenselicensedlicensurelocalmaintenanceplans
SHARED TOKENS (37): "according", "analysis", "becomes", "define", "design", "documentation", "engineer", "engineering", "engineers", "environment", "established", "general", "government", "legal", "license", "licensed", "licensure", "local", "maintenance", "plans"....
0.300
collegedifferenteducationeducationalformgenerallyinstitutioninstitutionsmaintainopenpolicyprogramstransferuniversityworkforce
SHARED TOKENS (15): "college", "different", "education", "educational", "form", "generally", "institution", "institutions", "maintain", "open", "policy", "programs", "transfer", "university", "workforce".
0.300
accountingboardbusinesscentralentitiesframeworkgovernmentlegalmanagementorganizationsprocesspublicresourcesspecializedstandardstransactions
SHARED TOKENS (16): "accounting", "board", "business", "central", "entities", "framework", "government", "legal", "management", "organizations", "process", "public", "resources", "specialized", "standards", "transactions".
0.300
actagenciesagencyapplyaroundauthoritycouncilcreateddecisionsenvironmentenvironmentalestablishedfederalfinalgovernmentimpactlawnationalpoliciespolicy
SHARED TOKENS (32): "act", "agencies", "agency", "apply", "around", "authority", "council", "created", "decisions", "environment", "environmental", "established", "federal", "final", "government", "impact", "law", "national", "policies", "policy"....
0.300
actagriculturalanotherbeneficialchangecommercialcoverscurrentdemanddevelopmenteithergrowthimprovementslocalmakesmanagementmunicipalpoliciespopulationpractices
SHARED TOKENS (29): "act", "agricultural", "another", "beneficial", "change", "commercial", "covers", "current", "demand", "development", "either", "growth", "improvements", "local", "makes", "management", "municipal", "policies", "population", "practices"....
0.300
actactiveadministeredagenciesapproximatelyauthorityauthorizedbillionbudgetbuildingbusinesscapacitycivilconstructioncontroldepartmentdesigndirectdirectlyduties
SHARED TOKENS (59): "act", "active", "administered", "agencies", "approximately", "authority", "authorized", "billion", "budget", "building", "business", "capacity", "civil", "construction", "control", "department", "design", "direct", "directly", "duties"....
0.300
actadministeredadministrationagenciescurrentdepartmentdepartmentsdutiesestablishedfederalfinancegovernmentinstitutionslicenseslimitedmajormanagesmattersnationaloffice
SHARED TOKENS (25): "act", "administered", "administration", "agencies", "current", "department", "departments", "duties", "established", "federal", "finance", "government", "institutions", "licenses", "limited", "major", "manages", "matters", "national", "office"....
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganothercustomerdemanddesigndevelopmentdifferentdrainageenvironmentalequipmentfacilitieshistoricalinfrastructureinstallationlandmanagementmonitoringmoveprocessing
SHARED TOKENS (32): "agricultural", "allowing", "another", "customer", "demand", "design", "development", "different", "drainage", "environmental", "equipment", "facilities", "historical", "infrastructure", "installation", "land", "management", "monitoring", "move", "processing"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedconnectdevelopmenteitherevenexpandedfeefinalfunctionsgovernmentimpactlandlaterlegalobtainownerowners
SHARED TOKENS (36): "acquisition", "another", "application", "authorized", "connect", "development", "either", "even", "expanded", "fee", "final", "functions", "government", "impact", "land", "later", "legal", "obtain", "owner", "owners"....
0.300
agriculturalagriculturecentralchangechangesconcentrateddevelopmentdirectdownstreamdrinkingeconomicenterenvironmentenvironmentalfoodimpactlandlargelocalmajor
SHARED TOKENS (36): "agricultural", "agriculture", "central", "change", "changes", "concentrated", "development", "direct", "downstream", "drinking", "economic", "enter", "environment", "environmental", "food", "impact", "land", "large", "local", "major"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontroldescribeddevelopmenteitherevaluationsfinancefirmsgenerallimitedmanagementoperationalotherwiseownershipprivateprovide
SHARED TOKENS (26): "active", "business", "capital", "category", "changes", "control", "described", "development", "either", "evaluations", "finance", "firms", "general", "limited", "management", "operational", "otherwise", "ownership", "private", "provide"....
0.300
boisecapacitydistrictidaholowernampanationalprogramprojectprovideregistertreasurevalleywaterwestern
SHARED TOKENS (15): "boise", "capacity", "district", "idaho", "lower", "nampa", "national", "program", "project", "provide", "register", "treasure", "valley", "water", "western".
0.300
agencycurrentdatadepartmentfederalgovernmentheadquarteredlandscapemajormakesmapspublicresearchresourcesresponsibilitywhosework
SHARED TOKENS (17): "agency", "current", "data", "department", "federal", "government", "headquartered", "landscape", "major", "makes", "maps", "public", "research", "resources", "responsibility", "whose", "work".
0.300
Law enforcement ↗ KW CROSS HIGH
actassociatedauthoritycodesconsequencesformsgoverninggovernmentindependentlyinstitutionslawlegaloperateorganizationspowerpropertyprotectingpublicrecordrules
SHARED TOKENS (22): "act", "associated", "authority", "codes", "consequences", "forms", "governing", "government", "independently", "institutions", "law", "legal", "operate", "organizations", "power", "property", "protecting", "public", "record", "rules"....
0.300
accessagreementsaloneamongassociatedavailabilitybecomebecomeschangesconditionscontroldescribingeconomicgovernmenthistoryindividualinstitutionslimitedlocalmakes
SHARED TOKENS (39): "access", "agreements", "alone", "among", "associated", "availability", "become", "becomes", "changes", "conditions", "control", "describing", "economic", "government", "history", "individual", "institutions", "limited", "local", "makes"....
0.300
agenciesapplyassessmentbeneficialbusinessescomprehensivedesignevaluationfacilitiesgenerallygovernmentmoveplanningpoliciesprivateprocesspublicsystemtransportation
SHARED TOKENS (19): "agencies", "apply", "assessment", "beneficial", "businesses", "comprehensive", "design", "evaluation", "facilities", "generally", "government", "move", "planning", "policies", "private", "process", "public", "system", "transportation".
0.300
actualaddressescodecompletedatadifferententitiesentryexistingidentifyinginformationmeansprocessprocessingqualityratherrecordsroadsystemtools
SHARED TOKENS (20): "actual", "addresses", "code", "complete", "data", "different", "entities", "entry", "existing", "identifying", "information", "means", "process", "processing", "quality", "rather", "records", "road", "system", "tools".
0.300
Public finance ↗ Q274490 KW CROSS HIGH
allocationamongcentraldirectdistributioneconomiceconomyfailurefinanceframeworkgovernmentmarketpolicypublicresearchresourcesrolespecificsubject
SHARED TOKENS (19): "allocation", "among", "central", "direct", "distribution", "economic", "economy", "failure", "finance", "framework", "government", "market", "policy", "public", "research", "resources", "role", "specific", "subject".
0.300
approximatelybidchangescompleteconstructioncontactcontractorcontractscostsdeliverydesignentityformshistoricalindependentlylegalownerpointprocurementproject
SHARED TOKENS (35): "approximately", "bid", "changes", "complete", "construction", "contact", "contractor", "contracts", "costs", "delivery", "design", "entity", "forms", "historical", "independently", "legal", "owner", "point", "procurement", "project"....
0.300
actapprovalapprovalsbuildingcommercialconstructioncontractorscostscreatesdesigndeterminedevelopersdevelopmentdifferenteconomicengineersenvironmentalexistinggrowthincrease
SHARED TOKENS (42): "act", "approval", "approvals", "building", "commercial", "construction", "contractors", "costs", "creates", "design", "determine", "developers", "development", "different", "economic", "engineers", "environmental", "existing", "growth", "increase"....
0.300
accordingactaffordablealongsideanotherbillionbudgetbusinessbusinessesclassificationconsolidateddirectdistributioneconomiceducationestimatedexpandedextendfebruaryfinal
SHARED TOKENS (34): "according", "act", "affordable", "alongside", "another", "billion", "budget", "business", "businesses", "classification", "consolidated", "direct", "distribution", "economic", "education", "estimated", "expanded", "extend", "february", "final"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscompleteconnectedcurrentestablishedformidahoimprovementsincreasinglylowermakingownerspointseparatevalleywestwestern
SHARED TOKENS (17): "business", "complete", "connected", "current", "established", "form", "idaho", "improvements", "increasingly", "lower", "making", "owners", "point", "separate", "valley", "west", "western".
🫐 BERRY56 edges
0.280
analysisbusinesscompliancecontrolscostsdatadevelopmentinventorymanagementmonitoringplanningprocessprocurementpurpose
SHARED TOKENS (14): "analysis", "business", "compliance", "controls", "costs", "data", "development", "inventory", "management", "monitoring", "planning", "process", "procurement", "purpose".
0.280
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturecreatedformhealthhistoricalmanagementmethodsoperatedregionresourcesystemsthroughoutwater
SHARED TOKENS (14): "agricultural", "agriculture", "created", "form", "health", "historical", "management", "methods", "operated", "region", "resource", "systems", "throughout", "water".
0.280
accordingcontractorsemploymentformholdersindependentlaborlimitedrelationshipstaffingtemporaryworkworkersworkforce
SHARED TOKENS (14): "according", "contractors", "employment", "form", "holders", "independent", "labor", "limited", "relationship", "staffing", "temporary", "work", "workers", "workforce".
0.280
agriculturalappropriationbeneficialindustriallegalmerelyownershippurposerightssourcesummarizedsystemuserswater
SHARED TOKENS (14): "agricultural", "appropriation", "beneficial", "industrial", "legal", "merely", "ownership", "purpose", "rights", "source", "summarized", "system", "users", "water".
0.280
Septic tank ↗ Q386300 KW CROSS HIGH
connectedenvironmentfacilityinvolvingprocessesratereduceruralsystemsystemsthereforetreatmentwastewastewater
SHARED TOKENS (14): "connected", "environment", "facility", "involving", "processes", "rate", "reduce", "rural", "system", "systems", "therefore", "treatment", "waste", "wastewater".
0.280
Sugar beet ↗ Q151964 EXACT TITLE
containsgroupmillionwhose
SHARED TOKENS (4): "contains", "group", "million", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.280
Indemnity ↗ Q708399 KW CROSS HIGH
agencyanothercontractsdifferentexpresslyformitselflawlimitedownerprincipalpurchaserelationshipresponsibilities
SHARED TOKENS (14): "agency", "another", "contracts", "different", "expressly", "form", "itself", "law", "limited", "owner", "principal", "purchase", "relationship", "responsibilities".
0.280
adaboisecentralconnectedcontainsidahoitselfnationalpopulationruralsectionstarvalleywestern
SHARED TOKENS (14): "ada", "boise", "central", "connected", "contains", "idaho", "itself", "national", "population", "rural", "section", "star", "valley", "western".
0.260
differentemergenciesemergencyfederalgenerallylocalmanagementorganizationsprofessionalreducerequiresresponserisk
SHARED TOKENS (13): "different", "emergencies", "emergency", "federal", "generally", "local", "management", "organizations", "professional", "reduce", "requires", "response", "risk".
0.260
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturalcolumbiadivisiondrainageidaholargermajormilesnationalsectionsquarevalleywest
SHARED TOKENS (13): "agricultural", "columbia", "division", "drainage", "idaho", "larger", "major", "miles", "national", "section", "square", "valley", "west".
0.260
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalgovernmenthomepoliciesprogramreportsurban
SHARED TOKENS (13): "administers", "agency", "department", "departments", "development", "directly", "federal", "government", "home", "policies", "program", "reports", "urban".
0.260
Linked data ↗ Q515701 KW CROSS HIGH
associatedautomaticallybecomedatadescribeddesigninformationmakesopenprojectpublicationratherthem
SHARED TOKENS (13): "associated", "automatically", "become", "data", "described", "design", "information", "makes", "open", "project", "publication", "rather", "them".
0.260
Maize ↗ Q11575 KW CROSS HIGH
alongsideannualbecomebecomesbillioncommercialcontainseitherfoodmajorthroughouttreatmentuses
SHARED TOKENS (13): "alongside", "annual", "become", "becomes", "billion", "commercial", "contains", "either", "food", "major", "throughout", "treatment", "uses".
0.260
accessassociatedconstructiondevelopmentdocumentsgoverninggovernmentincreasinglyinformationinstitutionsmaintainsopenpublic
SHARED TOKENS (13): "access", "associated", "construction", "development", "documents", "governing", "government", "increasingly", "information", "institutions", "maintains", "open", "public".
0.240
datadifferententitiesentityfileslinkagenationalrecordrecordsresolutionshapesources
SHARED TOKENS (12): "data", "different", "entities", "entity", "files", "linkage", "national", "record", "records", "resolution", "shape", "sources".
0.240
Prison ↗ Q40357 KW CROSS HIGH
administrationauthoritydetentionfacilityformsfunctionsgoverningholdinglargelawprocesssystem
SHARED TOKENS (12): "administration", "authority", "detention", "facility", "forms", "functions", "governing", "holding", "large", "law", "process", "system".
0.240
appropriationapprovalcontrolledeithergeneralgenerallygovernmentlawproposedspecificsupplysystem
SHARED TOKENS (12): "appropriation", "approval", "controlled", "either", "general", "generally", "government", "law", "proposed", "specific", "supply", "system".
0.240
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturalagriculturedifferenteconomyfoodidaholandmillionprocessingrepresentsrolesignificant
SHARED TOKENS (12): "agricultural", "agriculture", "different", "economy", "food", "idaho", "land", "million", "processing", "represents", "role", "significant".
0.240
affordabledepartmentdevelopmentfederalinfrastructurelocalprogramprogramsspecificstatedsubjecturban
SHARED TOKENS (12): "affordable", "department", "development", "federal", "infrastructure", "local", "program", "programs", "specific", "stated", "subject", "urban".
0.220
administrativeauthoritydescribedgovernmentjudicialpowerprocessreviewseparationstatutesubject
SHARED TOKENS (11): "administrative", "authority", "described", "government", "judicial", "power", "process", "review", "separation", "statute", "subject".
0.220
actchaptercodedevelopmentfederallawpowerprojectspurposetitlewater
SHARED TOKENS (11): "act", "chapter", "code", "development", "federal", "law", "power", "projects", "purpose", "title", "water".
0.220
chaindepartmentmanagementplanningprocessprocurementpurchasepurchasingspecificsupplysystems
SHARED TOKENS (11): "chain", "department", "management", "planning", "process", "procurement", "purchase", "purchasing", "specific", "supply", "systems".
0.210
Alfalfa ↗ Q156106 EXACT TITLE
around
SHARED TOKENS (1): "around". | EXACT TITLE in water_rights: "Alfalfa".
0.200
agencybidconstructioncontractsdeliverydesignentitiesownerprojectseparate
SHARED TOKENS (10): "agency", "bid", "construction", "contracts", "delivery", "design", "entities", "owner", "project", "separate".
0.200
amongdetermineslandlawownershippropertyrightssimplysystemwater
SHARED TOKENS (10): "among", "determines", "land", "law", "ownership", "property", "rights", "simply", "system", "water".
0.200
subdivision
EXACT TITLE in water_rights: "Subdivision". | EXACT TITLE in procurement_public_spending: "Subdivision".
0.200
Abandon ↗ Q397584 EXACT TITLE
abandonabandonedabandonment
EXACT TITLE in water_rights: "Abandon".
0.200
Grant ↗ Q219140 EXACT TITLE
EXACT TITLE in procurement_public_spending: "Grant".
0.200
allowingdirectlyeithernetworkoperatedpotentialsystemsystemstypeswater
SHARED TOKENS (10): "allowing", "directly", "either", "network", "operated", "potential", "system", "systems", "types", "water".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
forfeiture
EXACT TITLE in water_rights: "Forfeit".
0.200
accountingappropriatedetermineevidenceinformationprovidereasonablestandardsstatedverified
SHARED TOKENS (10): "accounting", "appropriate", "determine", "evidence", "information", "provide", "reasonable", "standards", "stated", "verified".
0.200
demanddistributionpipepreventssignificantsourcessuppliessystemsystemswater
SHARED TOKENS (10): "demand", "distribution", "pipe", "prevents", "significant", "sources", "supplies", "system", "systems", "water".
0.200
controldistinctgoverninglawownershippropertyqualityresourceresourceswater
SHARED TOKENS (10): "control", "distinct", "governing", "law", "ownership", "property", "quality", "resource", "resources", "water".
0.200
catalogcodefoodmunicipalpublicroleseparatelysolidsourceswaste
SHARED TOKENS (10): "catalog", "code", "food", "municipal", "public", "role", "separately", "solid", "sources", "waste".
0.200
consultantsdeliveryembeddedgovernmentinformationprivateprocessesrelationshipsupportingworking
SHARED TOKENS (10): "consultants", "delivery", "embedded", "government", "information", "private", "processes", "relationship", "supporting", "working".
0.200
assetsauthoritycapabilitydataformsmanagementprocessesqualityrolevalue
SHARED TOKENS (10): "assets", "authority", "capability", "data", "forms", "management", "processes", "quality", "role", "value".
0.200
aroundbeneficialcreatingequipmentformedlandlargesectionsystemswater
SHARED TOKENS (10): "around", "beneficial", "creating", "equipment", "formed", "land", "large", "section", "systems", "water".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahopopulationschoolsstarwest
SHARED TOKENS (9): "ada", "boise", "canyon", "district", "idaho", "population", "schools", "star", "west".
0.160
distributionformmanagementpracticessignificantthereforethroughoutwater
SHARED TOKENS (8): "distribution", "form", "management", "practices", "significant", "therefore", "throughout", "water".
0.160
adaboisecanyoncountiesidahoregiontreasurevalley
SHARED TOKENS (8): "ada", "boise", "canyon", "counties", "idaho", "region", "treasure", "valley".
0.160
establishedfebruaryfoodidahomakingpopulationregionsource
SHARED TOKENS (8): "established", "february", "food", "idaho", "making", "population", "region", "source".
0.160
accessadministrationdemandformnetworkphysicalpoolresources
SHARED TOKENS (8): "access", "administration", "demand", "form", "network", "physical", "pool", "resources".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahonampapopulationruralwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "nampa", "population", "rural", "western".
0.160
Water table ↗ Q3342272 KW CROSS HIGH
actualdefineexplainedlayerslowermaterialssimplywater
SHARED TOKENS (8): "actual", "define", "explained", "layers", "lower", "materials", "simply", "water".
0.140
accessfederalgovernmentinformationlocalpublicrecords
SHARED TOKENS (7): "access", "federal", "government", "information", "local", "public", "records".
0.140
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahomunicipalpopulationseparate
SHARED TOKENS (7): "ada", "boise", "government", "idaho", "municipal", "population", "separate".
0.140
aroundcontainsexpandedmajorsouthwestwestwestern
SHARED TOKENS (7): "around", "contains", "expanded", "major", "southwest", "west", "western".
0.140
associatedcolumbiaexaminationhistoryidahowestwestern
SHARED TOKENS (7): "associated", "columbia", "examination", "history", "idaho", "west", "western".
0.140
agencycontinuingdepartmentfederalgovernmentmanagementworking
SHARED TOKENS (7): "agency", "continuing", "department", "federal", "government", "management", "working".
0.120
completioncontractorintendedperformanceprojectwork
SHARED TOKENS (6): "completion", "contractor", "intended", "performance", "project", "work".
0.120
Surety ↗ KW CROSS HIGH
failurefinanceprincipalprotectsresponsibilityresulting
SHARED TOKENS (6): "failure", "finance", "principal", "protects", "responsibility", "resulting".
0.120
agencycertificationeducationalprofessionalpublicsimply
SHARED TOKENS (6): "agency", "certification", "educational", "professional", "public", "simply".
0.120
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherconstructingexistingperiodsprovidewater
SHARED TOKENS (6): "another", "constructing", "existing", "periods", "provide", "water".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
ownershipprivatepropertypublicresources
SHARED TOKENS (5): "ownership", "private", "property", "public", "resources".
0.100
demandenvironmentalphysicalsupplieswater
SHARED TOKENS (5): "demand", "environmental", "physical", "supplies", "water".
◈ Frequently Asked Questions
Water Rights × Procurement Public Spending — Treasure Valley
HAIKU · HIGH GATE
How do water rights acquisitions affect public procurement budgets in Ada County?
Ada County allocates procurement funding for water rights purchases through competitive bidding processes managed by the Idaho Legislature's statutory framework. Civil engineering firms contracted by Ada County municipalities conduct surveying work to verify water rights before purchase, which increases overall project costs in the public spending budget.
What role do wastewater treatment systems play in Boise's water rights procurement decisions?
Boise's wastewater treatment infrastructure requires secure water rights to operate the sanitary sewer system, making water rights procurement essential to public utility spending. The city budgets for both water rights acquisition and civil engineering services to maintain compliance with environmental standards across the Treasure Valley region.
How do Nampa and Caldwell coordinate water rights purchases with shared procurement standards?
Nampa and Caldwell both operate under Idaho administrative law requirements for public utility procurement, which standardizes how municipalities bid for water rights across the Treasure Valley. Canyon County coordinates surveying and civil engineering contracts between these cities to minimize duplicate spending on water rights verification.
What procurement processes does Boise State University follow when acquiring water rights for campus operations?
Boise State University, located in Ada County, follows state procurement law when purchasing water rights needed for campus infrastructure and wastewater treatment. The university's civil engineering department conducts internal surveying to document water supply requirements before submitting public spending requests to the Idaho Legislature's budget process.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Water Rights × Procurement Public Spending 18 QID bridges 255 edges 6,549 ext links 2026-07-18 00:00:00 UTC b1d94bf16274a110
Water Rights corridor ↗ Procurement Public Spending corridor ↗ Procurement Public Spending × Water Rights ↗ boisestandard.org/standard ↗
Parent Corridors
Water Rights × All Other Verticals