—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Water Rights ↔ relates to ↔ Transportation Infrastructure

25 Wikipedia bridge articles confirmed in both vertical ledgers. 241 deterministic cross-vertical edges. 6,343 external source links harvested. Every edge provenance-stamped. Every claim auditable.

25 QID Bridge Articles
241 Cross Edges
6,343 External Sources
284 Wikipedia Articles
29 🌲 Evergreen
168 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Water Rights
× Transportation Infrastructure
QID Bridge Articles
25
confirmed Wikipedia overlap
Total Cross Edges
241
External Sources Harvested
6,343
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  30 shared tokens
QID Bridge Titles (20)
ZoningTreasure ValleyUrbanizationSnake RiverSurveyingBoise State UniversityClean Water ActIrrigationCivil engineeringUrban sprawlNampa, IdahoRight of wayUnited States Environmental Protection AgencyBoise, IdahoUnited States Army Corps of EngineersEminent domainAda County, IdahoStar, IdahoCaldwell, IdahoParma, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanlandgovernmentpubliccanyonenvironmentaleastprivatewestadadevelopmentformlocalplanningnationalmilesparts
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:01:50 UTC
Content Hash
a808eb4ceac507c9
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
25 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (30): "allowing", "building", "determine", "developed", "development", "different", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "municipality", "places", "planning", "policy", "property", "regulations".... | EXACT TITLE in water_rights: "Zoning". | EXACT TITLE in transportation_infrastructure: "Zoning".
allowingbuildingdeterminedevelopeddevelopmentdifferentformgoverngovernmentgrowthindustriallandland-uselocalmunicipalityplacesplanningpolicypropertyregulationsregulatoryresidentialrulesshapesinglesystemsurbanuseszoneszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (18): "agricultural", "association", "boise", "eastern", "historically", "idaho", "land", "local", "lower", "metropolitan", "primarily", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
agriculturalassociationboiseeasternhistoricallyidaholandlocallowermetropolitanprimarilyregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Urbanization
Q161078 EXACT TITLE 1.000
QID OVERLAP: Q161078 in water_rights (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (49): "approximately", "become", "billion", "create", "creates", "current", "describes", "developed", "developing", "development", "economic", "education", "environmental", "essential", "forecast", "growth", "health", "impact", "increase", "increasing".... | EXACT TITLE in water_rights: "Urbanization".
approximatelybecomebillioncreatecreatescurrentdescribesdevelopeddevelopingdevelopmenteconomiceducationenvironmentalessentialforecastgrowthhealthimpactincreaseincreasinginstitutionallandlargerlevelmajormerelynationalnaturalplaceplanning+19
predicted to generate artificial scarcities of land, lack of drinking water, playgrounds and other essential resources for most urban dwellers. The predicted urban population growth is equivalent to approximately 3 billion urbanites by 2050, much of which will occur in Africa and Asia. Notably, the United Nations has also recently projected that nearly all global population growth from 2017 to 2030 will take place in cities, with about 1.1 billion new urbanites over the next 10 years. In the long term, urbanization is expected to significantly impact the quality of life in negative ways. Urbanization is relevant to a range of disciplines, including urban planning, geography, sociology, architecture, economics, education, statistics, and public health. The phenomenon has been closely linked to globalization, modernization, industrialization, marketization, administrative/institutional power, and the sociological process of rationalization. Urbanization can be seen as a specific condition at a set time (e.g. the proportion of total population or area in cities or towns), or as an increase in that condition over time. Therefore, urbanization can be quantified either in terms of the level of urban development relative to the overall population, or as the rate at which the urban proportion of the population is increasing. Urbanization creates enormous social, economic and environmental challenges, which provide an opportunity for sustainability with the "potential to use resources much less or more efficiently, to create more sustainable land use and to protect the biodiversity of natural ecosystems." However, current urbanization trends have shown that massive urbanization has led to unsustainable ways of living. Developing urban resilience and urban sustainability in the face of increased urbanization is at the centre of international policy in Sustainable Development Goal 11 "Sustainable cities and communities." Urbanization is not merely a modern phenomenon, but a rapid and historic transformation of human social roots on a global scale, whereby predominantly rural culture is being rapidly replaced by predominantly urban culture. The first major change in settlement patterns was the accumulation of hunter-gatherers into villages many thousands of years ago. Village culture is characterized by common bloodlines, intimate relationships, and communal behaviour, whereas urban culture is characterized by distant bloodlines, unfamiliar relations, and competitive behaviour. This unprecedented movement of people is forecast to continue and intensify during the next few decades, mushrooming cities to sizes unthinkable only a century ago.
Urbanization (or urbanisation in British English) is the process by which human settlements are formed and become larger as more people live, recreate and work in cities and towns. It describes the population shift from rural to urban areas, the corresponding decrease in the proportion of people living in rural areas, and the ways in which societies and culture adapt to this change. Rather than strictly referring to the absolute number of people living in urban environments, Urbanization refers to the proportion of the total national population living in areas classified as urban. It is predicted that by 2050, about 64% of the developing world and 86% of the developed world will be urbanized. This is predicted to generate artificial scarcities of land, lack of drinking water, playgrounds and other essential resources for most urban dwellers. The predicted urban population growth is equivalent to approximately 3 billion urbanites by 2050, much of which will occur in Africa and Asia. Notably, the United Nations has also recently projected that nearly all global population growth from 2017 to 2030 will take place in cities, with about 1.1 billion new urbanites over the next 10 years. In the long term, urbanization is expected to significantly impact the quality of life in negative ways. Urbanization is relevant to a range of disciplines, including urban planning, geography, sociology, architecture, economics, education, statistics, and public health. The phenomenon has been closely linked to globalization, modernization, industrialization, marketization, administrative/institutional power, and the sociological process of rationalization. Urbanization can be seen as a specific condition at a set time (e.g. the proportion of total population or area in cities or towns), or as an increase in that condition over time. Therefore, urbanization can be quantified either in terms of the level of urban development relative to the overall population, or as the rate at which the urban proportion of the population is increasing. Urbanization creates enormous social, economic and environmental challenges, which provide an opportunity for sustainability with the "potential to use resources much less or more efficiently, to create more sustainable land use and to protect the biodiversity of natural ecosystems." However, current urbanization trends have shown that massive urbanization has led to unsustainable ways of living. Developing urban resilience and urban sustainability in the face of increased urbanization is at the centre of international policy in Sustainable Development Goal 11 "Sustainable cities and communities." Urbanization is not merely a modern phenomenon, but a rapid and historic transformation of human social roots on a global scale, whereby predominantly rural culture is being rapidly replaced by predominantly urban culture. The first major change in settlement patterns was the accumulation of hunter-gatherers into villages many thousands of years ago. Village culture is characterized by common bloodlines, intimate relationships, and communal behaviour, whereas urban culture is characterized by distant bloodlines, unfamiliar relations, and competitive behaviour. This unprecedented movement of people is forecast to continue and intensify during the next few decades, mushrooming cities to sizes unthinkable only a century ago.
Urbanization occurs either organically or planned as a result of individual, collective and state action. Living in a city can be culturally and economically beneficial since it can provide greater opportunities for access to the labour market, better education, housing, and safety conditions, and reduce the time and expense of commuting and transportation. Conditions like density, proximity, diversity, and marketplace competition are elements of an urban environment that are deemed beneficial. However, there are also harmful social phenomena that arise: alienation, stress, increased cost of living, and mass marginalization that are connected to an urban way of living. Suburbanization, which is happening in the cities of the largest developing countries, may be regarded as an attempt to balance these harmful aspects of urban life while still allowing access to a large extent of shared resources. In cities, money, services, wealth and opportunities are centralized. Many rural inhabitants come to the city to seek their fortune and alter their social position. Businesses, which provide jobs and exchange capital, are more concentrated in urban areas. Whether the source is trade or tourism, it is also through the ports or banking systems, commonly located in cities, that foreign money flows into a country. Many people move into cities for economic opportunities, but this does not fully explain the very high recent urbanization rates in places like China and India. Rural flight is a contributing factor to urbanization. In rural areas, often on small family farms or collective farms in villages, it has historically been difficult to access manufactured goods, though the relative overall quality of life is very subjective, and may certainly surpass that of the city. Farm living has always been susceptible to unpredictable environmental conditions, and in times of drought, flood or pestilence, survival may become extremely problematic. In a New York Times article concerning the acute migration away from farming in Thailand, life as a farmer was described as "hot and exhausting". "Everyone says the farmer works the hardest but gets the least amount of money". In an effort to counter this impression, the Agriculture Department of Thailand is seeking to promote the impression that farming is "honorable and secure". However, in Thailand, urbanization has also resulted in massive increases in problems such as obesity. Shifting from a rural environment to an urbanized community also caused a transition from a diet that was mainly carbohydrate-based to a diet higher in fat and sugar, consequently causing a rise in obesity. City life, especially in modern urban slums of the developing world, is not immune to pestilence or climatic disturbances such as floods, yet continues to strongly attract migrants. Examples of this were the 2011 Thailand floods and 2007 Jakarta flood. Urban areas are also far more prone to violence, drugs, and other urban social problems.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in water_rights (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (49): "age", "agencies", "canyon", "central", "commercial", "constructed", "construction", "control", "created", "developed", "downstream", "drains", "east", "eastern", "features", "flood", "flows", "habitat", "history", "idaho".... | EXACT TITLE in water_rights: "Snake River".
ageagenciescanyoncentralcommercialconstructedconstructioncontrolcreateddevelopeddownstreamdrainseasteasternfeaturesfloodflowshabitathistoryidahoirrigationlakelargelimitedlowermajormilesnationalnorthwestpacific+19
reas of the western Snake River watershed, while the Snake River Plain was a product of the Yellowstone volcanic hotspot. The river was further altered by catastrophic flooding in the most recent Ice Age, which created such features as the Snake River Canyon and Shoshone Falls. The Snake River once hosted some of the largest North American runs of salmon and other anadromous fish. For thousands of years, salmon fishing has played a central role in the culture and diet of indigenous peoples. The Shoshone and Nez Perce were the largest of several tribes that lived along the river by the turn of the 19th century. In 1805, while searching for a route from the eastern US to the Pacific, Lewis and Clark became the first non-natives to see the river. Fur trappers explored more of the watershed, and drove beaver to near extinction as the Americans and British vied for control of Oregon Territory. Although travelers on the Oregon Trail initially shunned the dry and rocky Snake River region, a flood of settlers followed gold discoveries in the 1860s, leading to decades of military conflict and the eventual expulsion of tribes to reservations. At the turn of the 20th century, some of the first large irrigation projects in the western US were developed along the Snake River. South-central Idaho earned the nickname "Magic Valley" with the rapid transformation of desert into farmland. Numerous hydroelectric dams were also constructed, and four navigation dams on its lower section created a shipping channel to Lewiston, Idaho – the furthest inland seaport on the West Coast. While dam construction, commercial fishing and other human activities have greatly reduced anadromous fish populations since the late 19th century, the Snake River watershed is still considered important habitat for these fish. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success. The proposed removal of the four lower Snake River dams for fish passage is a significant ongoing policy debate in the Pacific Northwest. Course The Snake River starts to the north of Two Ocean Pass near the southern border of Yellowstone National Park, about 9,200 feet (2,800 m) above sea level in the Rocky Mountains of Wyoming. The river descends west through the high mountains of the Teton Wilderness meeting the Lewis River and continuing south into Jackson Lake in Grand Teton National Park, a natural glacial lake enlarged by Jackson Lake Dam. Joined by Pacific Creek and Buffalo Fork below the dam, it meanders southward through the alpine valley of Jackson Hole situated on the plain in front of the Teton Range to the west and the Gros Ventre Range to the east. Below the town of Jackson it forms the Snake River Canyon of Wyoming, turns west and crosses into Idaho, where the Palisades Dam forms Palisades Reservoir. From there it flows northwest through Swan Valley to join the Henrys Fork on an alluvial plain near Rexburg. The Henrys Fork is sometimes called the "North Fork" of the Snake River, while the section of the main Snake River above their confluence is sometimes called the "South Fork". Turning southwest, the river begins its long journey across the Snake River Plain, passing through Idaho Falls and receiving the Blackfoot River from the left before entering the 20-mile (32 km)-long American Falls Reservoir, formed by American Falls Dam. From American Falls it turns west, flowing through Minidoka Dam and Milner Dam, where large volumes of water are diverted for irrigation. Below Milner Dam it enters the Snake River Canyon of Idaho, where the river narrows, forming rapids and waterfalls. In the 70-mile (110 km) stretch between Milner Dam and the confluence with the Malad River near Hagerman Fossil Beds National Monument, the Snake River descends a total of 1,300 feet (400 m) over a series of cataracts and rapids, chief of which include Caldron Linn, Twin, Shoshone, Pillar, Auger, and Salmon Falls. Idaho Power operates several small hydroelectric plants along this stretch of the river.
Surveying
Q816425 EXACT TITLE 1.000
QID OVERLAP: Q816425 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (33): "analysis", "boundaries", "civil", "communications", "components", "construction", "development", "digital", "engineering", "environment", "equipment", "establish", "features", "government", "history", "land", "law", "legal", "maps", "ownership".... | EXACT TITLE in water_rights: "Surveying". | EXACT TITLE in transportation_infrastructure: "Surveying".
analysisboundariescivilcommunicationscomponentsconstructiondevelopmentdigitalengineeringenvironmentequipmentestablishfeaturesgovernmenthistorylandlawlegalmapsownershipplanningprofessionalpropertyresearchstationsstructuralsurfacesurveyingsurveyorsurveyors+3
es required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
of determining the terrestrial positions of points based on the distances and angles between them. These points are usually on the surface of the Earth, and they are often used to establish maps and boundaries for ownership, locations, such as the designated positions of structural components for construction or the surface location of subsurface features, or other purposes required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
ince the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (18): "among", "boise", "business", "college", "division", "education", "engineering", "health", "idaho", "independent", "million", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in water_rights: "Boise State University". | EXACT TITLE in transportation_infrastructure: "Boise State University".
amongboisebusinesscollegedivisioneducationengineeringhealthidahoindependentmillionprogramprogramspublicreportedresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (36): "act", "addressing", "administered", "agency", "army", "changes", "clean", "control", "coordination", "corps", "directly", "enacted", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "legislation".... | EXACT TITLE in water_rights: "Clean Water Act". | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
actaddressingadministeredagencyarmychangescleancontrolcoordinationcorpsdirectlyenactedengineersenvironmentalfederalformgoverninginvolvinglawlegislationmajorownedpartsphysicalprimarilyprimaryprovidingprovisionsqualityregulations+6
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Irrigation
Q11453 EXACT TITLE 1.000
QID OVERLAP: Q11453 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (52): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distribution", "downstream", "drainage", "environmental", "form", "full", "growth".... | EXACT TITLE in water_rights: "Irrigation". | EXACT TITLE in transportation_infrastructure: "Irrigation".
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributiondownstreamdrainageenvironmentalformfullgrowthimprovementsinstallationirrigationlandlandscapemanagementmethodsminingnaturalnetwork+22
Surface irrigation, also known as gravity irrigation, is the oldest form of irrigation and has been in use for thousands of years. In surface (furrow, flood, or level basin) irrigation systems, water moves across the surface of agricultural lands to wet it and infiltrate into the soil. Water moves by following gravity or the slope of the land. Surface irrigation can be subdivided into furrow, border strip, or basin irrigation. It is often called flood irrigation when irrigation results in flooding or near-flooding of the cultivated land. Historically, surface irrigation has been the most common method for irrigating agricultural land in most parts of the world. The water application efficiency of surface irrigation is typically lower than that of other irrigation methods, due in part to limited control over applied depths. Surface irrigation involves significantly lower capital costs and energy requirements than pressurized irrigation systems. Hence, it is often the irrigation choice for developing nations, for low-value crops, and for large fields. Where water levels from the irrigation source permit, they are controlled by dikes (levees), usually plugged with soil. This is often seen in terraced rice fields (rice paddies), where the method is used to flood or control water levels in each distinct field.
Field Water Efficiency (%) = (Water Transpired by Crop ÷ Water Applied to Field) x 100 Increased irrigation efficiency has several positive outcomes for the farmer, the community, and the wider environment. Low application efficiency indicates that the amount of water applied to the field exceeds the crop or field requirements. Increasing the application efficiency means that the amount of crop produced per unit of water increases. Improved efficiency may be achieved by applying less water to an existing field or by using water more wisely, thereby achieving higher yields in the same area of land. In some parts of the world, farmers are charged for irrigation water; hence, over-application has a direct financial cost to the farmer. Irrigation often requires pumping energy (electricity or fossil fuels) to deliver water to the field or to supply the required operating pressure. Hence, increased efficiency will reduce both water and energy costs per unit of agricultural production. A reduction in water use on one field may allow the farmer to irrigate a larger area of land, increasing total agricultural production. Low efficiency usually means that excess water is lost through seepage or runoff, both of which can result in loss of crop nutrients or pesticides with potential adverse impacts on the surrounding environment. Improving the efficiency of irrigation is usually achieved in one of two ways: either by improving the system design or by optimizing the irrigation management. Improving system design includes converting from one form of irrigation to another (e.g., from furrow to drip irrigation) and making small changes to the current system (e.g., adjusting flow rates and operating pressures).
Archaeological investigations have found evidence of irrigation in areas lacking sufficient natural rainfall to support rainfed agriculture. Some of the earliest known use of the technology dates to the 6th millennium BCE in Khuzistan in the south-west of Iran. The site of Choga Mami, in present-day Iraq on the border with Iran, is believed to be the earliest to show the first canal irrigation in operation at about 6000 BCE. Irrigation was used to manipulate water in the alluvial plains of the Indus Valley Civilization, with its application estimated to have begun around 4500 BCE and to have drastically increased the size and prosperity of their agricultural settlements. The Indus Valley Civilization developed sophisticated irrigation and water-storage systems, including artificial reservoirs at Girnar dated to 3000 BCE, and an early canal irrigation system from c. 2600 BCE. Large-scale agriculture was practiced, with an extensive network of canals used for irrigation. Farmers in the Mesopotamian plain used irrigation from at least the third millennium BCE. They developed perennial irrigation, regularly watering crops throughout the growing season by coaxing water through a matrix of small channels formed in the field. Ancient Egyptians practiced basin irrigation using the flooding of the Nile to inundate land plots which had been surrounded by dikes. The flood water remained until the fertile sediment had settled before the engineers returned the surplus to the watercourse. There is evidence of the ancient Egyptian pharaoh Amenemhet III in the twelfth dynasty (about 1800 BCE) using the natural lake of the Faiyum Oasis as a reservoir to store surpluses of water for use during dry seasons.
Civil engineering
Q77590 EXACT TITLE 1.000
QID OVERLAP: Q77590 in water_rights (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "agencies", "built", "canals", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
agenciesbuiltcanalscivilcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalplaceprivateprofessionalpublicsectorstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
Civil engineering is a professional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Surveying existing conditions of the future work site, including topography, existing buildings and infrastructure, and underground infrastructure when possible; "lay-out" or "setting-out": placing reference points and markers that will guide the construction of new structures such as roads or buildings; Verifying the location of structures during construction; As-Built surveying: a survey conducted at the end of the construction project to verify that the work authorized was completed to the specifications set on plans. Transportation engineering Transportation engineering is concerned with moving people and goods efficiently, safely, and in a manner conducive to a vibrant community. This involves specifying, designing, constructing, and maintaining transportation infrastructure which includes streets, canals, highways, rail systems, airports, ports, and mass transit.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (31): "agency", "associated", "become", "building", "commercial", "costs", "described", "development", "environment", "environmental", "existing", "expansion", "form", "growth", "industrial", "infrastructure", "land", "large", "measure", "planning"....
agencyassociatedbecomebuildingcommercialcostsdescribeddevelopmentenvironmentenvironmentalexistingexpansionformgrowthindustrialinfrastructurelandlargemeasureplanningpopulationprivatepropertyrequireresidentialsupporttimestransportationurbanuses+1
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "according", "boise", "canyon", "college", "foot", "home", "idaho", "meridian", "metropolitan", "miles", "nampa", "northwest", "population", "principal", "student", "university", "west", "western".
accordingboisecanyoncollegefoothomeidahomeridianmetropolitanmilesnampanorthwestpopulationprincipalstudentuniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Right of way
QID OVERLAP 0.800
QID OVERLAP: Q17128254 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (31): "authority", "canals", "capable", "created", "cross", "different", "estate", "facility", "full", "government", "land", "legal", "lines", "local", "operate", "otherwise", "ownership", "parts", "physical", "private"....
authoritycanalscapablecreatedcrossdifferentestatefacilityfullgovernmentlandlegallineslocaloperateotherwiseownershippartsphysicalprivaterealridersright-of-wayrightsrights-of-wayroadsimplyspecificthemtransportation+1
In England and Wales, other than in the 12 Inner London boroughs and the City of London, public rights of way are paths on which the public have a legally protected right to pass and re-pass. The law in England and Wales differs from that in Scotland in that rights of way only exist where they are so designated (or are able to be designated if not already) whereas in Scotland any route that meets certain conditions is defined as a right of way, and in addition there is a general presumption of access to the countryside. Private rights of way or easements also exist. Footpaths, bridleways and other rights of way in most of England and Wales are shown on definitive maps. A definitive map is a record of public rights of way in England and Wales. In law it is the definitive record of where a right of way is located.
Scotland In Scotland, a right of way is a route over which the public has been able to pass unhindered for at least 20 years. The route must link two "public places", such as villages, churches or roads. Unlike in England and Wales there is no obligation on Scottish local authorities to signpost rights of way. However the charity Scotways, formed in 1845 to protect rights of way, records and signs the routes. The Land Reform (Scotland) Act 2003 codified in law traditional, non-motorised, access practices on land and water. Under the 2003 act a plain language explanation of rights is published by Scottish Natural Heritage: the Scottish Outdoor Access Code. Certain categories of land are excluded from this presumption of open access, such as railway land, airfields and private gardens. Section 4 of the access code explains how land managers are permitted to request the public to avoid certain areas for a limited period in order to undertake management tasks, however longer term restrictions must be approved by the local authority. The ability to temporarily restrict public access is commonly exercised without notice by shooting, forestry or wind farm operators, but does not extend to public rights of way. In Scotland the public have a higher degree of freedom on rights of way than on open land. Blocking a right of way in Scotland is a criminal obstruction under the Highways Act, just as in England and Wales, but the lack of publicly accessible rights of way maps in Scotland makes it very difficult to enforce. The unofficial National Catalogue of Rights of Way (CROW), compiled by the Scottish Rights of Way and Access Society (Scotways), in partnership with Scottish Natural Heritage, and the help of local authorities.
ple, animals, vehicles, watercraft, or utility lines travel, or the legal status that gives them the right to do so. Rights-of-way in the physical sense include controlled-access highways, railroads, canals, hiking paths, bridle paths for horses, bicycle paths, the routes taken by high-voltage lines (also known as wayleave), utility tunnels, or simply the paved or unpaved local roads used by different types of traffic. The term highway is often used in legal contexts in the sense of "main way" to mean any public-use road or any public-use road or path. Some are restricted as to mode of use (for example, pedestrians only, pedestrians, horse and cycle riders, vehicles capable of a minimum speed). Rights-of-way in the legal sense (the right to pass through or to operate a transportation facility) can be created in a number of different ways. In some cases, a government, transportation company, or conservation non-profit purchases the full ownership of real estate, including everything above and below the ground. Many rights-of-way are created instead by easement, which is a right to cross that does not include full ownership of the land.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (34): "agency", "approved", "began", "department", "education", "employee", "energy", "enforcement", "engineers", "environmental", "establishing", "federal", "government", "independent", "information", "january", "legal", "level", "local", "matters"....
agencyapprovedbegandepartmenteducationemployeeenergyenforcementengineersenvironmentalestablishingfederalgovernmentindependentinformationjanuarylegallevellocalmattersmeasuresmonitoringnationaloperationpermittingprogramsproposedpublicregionalresearch+4
The Environmental Protection Agency (EPA) is an independent agency of the United States government tasked with environmental protection matters. President Richard Nixon proposed the establishment of EPA on July 9, 1970; it began operation on December 2, 1970, after Nixon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
r is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
or is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "east", "estimated", "home", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "miles", "population", "river", "treasure", "valley".
adaannualboisecapitalcountieseastestimatedhomeidaholevellocallymajormanufacturingmetropolitanmilespopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
United States Army Corps of Engineers
Q1049334 QID OVERLAP 0.800
QID OVERLAP: Q1049334 in water_rights (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (71): "act", "active", "administered", "agencies", "approximately", "army", "authority", "authorized", "billion", "budget", "building", "business", "canals", "capacity", "civil", "clean", "components", "construction", "control", "corps"....
actactiveadministeredagenciesapproximatelyarmyauthorityauthorizedbillionbudgetbuildingbusinesscanalscapacitycivilcleancomponentsconstructioncontrolcorpsdepartmentdesigndirectdirectlyeasteconomyenergyengineerengineeringengineers+41
37,000 civilian and military personnel, making it one of the world's largest public engineering, design, and construction management agencies. The USACE workforce is approximately 97% civilian and 3% active duty military. The civilian workforce is mainly located in the United States, Europe, and in select Middle East office locations. Civilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
proximately 97% civilian and 3% active duty military. The civilian workforce is mainly located in the United States, Europe, and in select Middle East office locations. Civilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
Eminent domain
Q166332 QID OVERLAP 0.800
QID OVERLAP: Q166332 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (35): "acquisition", "another", "application", "authorized", "connect", "development", "easements", "even", "expanded", "fee", "final", "full", "functions", "government", "impact", "land", "later", "legal", "municipalities", "owners"....
acquisitionanotherapplicationauthorizedconnectdevelopmenteasementsevenexpandedfeefinalfullfunctionsgovernmentimpactlandlaterlegalmunicipalitiesownersownershippowerprivatepropertypublicrequirespecifiedsubdivisionssubjectsurrounding+5
Eminent domain, also known as land acquisition, compulsory purchase, resumption, compulsory acquisition, or expropriation, is the compulsory acquisition of private property for public use. It does not include the power to take and transfer ownership of private property from one property owner to another private property owner without a valid public purpose and the payment of just compensation. This power can be legislatively delegated by the state to municipalities, government subdivisions, or even to private persons or corporations, when they are authorized to exercise the functions of a public character. The most common uses of property taken by eminent domain have been for roads, government buildings and public utilities. Many railroads were given the right of eminent domain to obtain land or easements in order to build and connect rail networks. In the mid-20th century, a new application of eminent domain was pioneered, in which the government could take the property and transfer it to a private third party for redevelopment. This was initially done only on properties that had been deemed "blighted" or a "development impediment", on the principle that such properties had a negative impact upon surrounding property owners, but was later expanded to allow the taking of any private property when the new third-party owner could develop the property in such a way as to bring in increased tax revenues. Some jurisdictions require that the taker make an offer to purchase the subject property before resorting to the use of eminent domain.
The Constitution of India originally provided for the Fundamental Right to property under Articles 19 and 31. Article 19 guaranteed to all citizens the right to "acquire, hold and dispose of property". Article 31 provided that "No person shall be deprived of his property save by authority of law." It also provided that compensation would be paid to a person whose property had been "taken possession of or acquired" for public purposes. In addition, both the state government and the Union (federal) government were empowered to enact laws for the "acquisition or requisition of property" (Schedule VII, Entry 42, List III). It is this provision that has been interpreted as being the source of the State's "eminent domain" powers. The provisions relating to the right to property were changed a number of times. The 44th amendment of 1978 deleted the right to property from the list of Fundamental Rights. A new article, Article 300-A, was added to the Constitution to provide, "No person shall be deprived of his property save by authority of law." Thus, if a legislature makes a law depriving a person of his property, it will not be unconstitutional. The aggrieved person shall have no right to move the court under Article 32. Thus, the right to property is no longer a fundamental right, though it is still a constitutional right. If the government acts in violation of the law, the action can be challenged in a court of law by citizens. Land acquisition in India is currently governed by the Right to Fair Compensation and Transparency in Land Acquisition, Rehabilitation and Resettlement Act, 2013, which came into force on 1 January 2014. Until 2013, land acquisition in India was governed by Land Acquisition Act of 1894.
After his victory in 1066, William the Conqueror seized virtually all land in England. Although he maintained absolute power over the land, he granted fiefs to landholders who served as stewards, paying fees and providing military services. During the Hundred Years' War in the 14th century, Edward III used the Crown's right of purveyance for massive expropriations. Chapter 28 of Magna Carta required that immediate cash payment be made for expropriations. As the king's power was broken down in the ensuing centuries, tenants were regarded as holding ownership rights rather than merely possessory rights over their land. In 1427, a statute was passed granting Commission of sewers in Lincolnshire the power to take land without compensation. After the early 16th century, however, Parliamentary takings of land for roads, bridges, and other infrastructure. generally did require compensation. The common practice was to pay 10% more than the assessed value. However, as the voting franchise was expanded to include more non-landowners, the bonus was eliminated. Despite contrary statements found in some American law, in the United Kingdom, compulsory purchase valuation cases were tried by juries well into the 20th century, such as Attorney-General v De Keyser's Royal Hotel Ltd (1919). In England and Wales, and other jurisdictions that follow the principles of English law, the related term compulsory purchase is used. The landowner is compensated with a price agreed or stipulated by an appropriate person; where agreement on price cannot be achieved, the value of the taken land is determined by the Upper Tribunal. The operative law is a patchwork of statues and case law. The principal acts are the Lands Clauses Consolidation Act 1845 (8 & 9 Vict. c. 18), the Land Compensation Act 1961, the Compulsory Purchase Act 1965, the Land Compensation Act 1973, the Acquisition of Land Act 1981, part IX of the Town and Country Planning Act 1990, the Planning and Compensation Act 1991, and the Planning and Compulsory Purchase Act 2004. Scotland In Scotland, eminent domain is known as compulsory purchase. The development of powers of compulsory purchase originated in the railway mania of the Victorian period. Compensation is available to the landowner, with the Lands Tribunal for Scotland dealing with any disputes arising from the value of compensation. As in England and Wales, the law of compulsory purchase in Scotland is complex. The current statutes regulating compulsory purchase include: the Lands Clauses Consolidation (Scotland) Act 1845 (8 & 9 Vict. c. 19); the Acquisition of Land (Authorisation Procedure) (Scotland) Act 1947; and the Land Compensation (Scotland) Act 1963. The Scottish Law Commission considered the current state of the law of compulsory purchase and advocated reforms in its Discussion Paper on Compulsory Purchase.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in water_rights (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private", "streets".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivatestreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.740
QID OVERLAP: Q1516815 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (12): "ada", "boise", "canyon", "district", "east", "idaho", "metropolitan", "parts", "population", "schools", "star", "west".
adaboisecanyondistricteastidahometropolitanpartspopulationschoolsstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Caldwell, Idaho
Q849592 QID OVERLAP 0.740
QID OVERLAP: Q849592 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (12): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "miles", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanmilespopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Parma, Idaho
Q1522393 QID OVERLAP 0.720
QID OVERLAP: Q1522393 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (11): "boise", "caldwell", "canyon", "eastern", "idaho", "metropolitan", "nampa", "parma", "population", "rural", "western".
boisecaldwellcanyoneasternidahometropolitannampaparmapopulationruralwestern
1,983 in 2010. It is the fourth largest city in the county (behind Middleton, Caldwell, and Nampa all in the county's eastern portion) and the largest in the rural western portion.
2000 census As of the census of 2000, there were 1,771 people, 617 households, and 454 families living in the city. The population density was 1,919.5 inhabitants per square mile (741.1/km2). In the 2010 census there were 1,983 There were 676 housing units at an average density of 732.7 per square mile (282.9/km2). The racial makeup of the city was 83.91% White, 0.17% African American, 0.85% Native American, 0.96% Asian, 9.66% from other races, and 4.46% from two or more races. Hispanic or Latino of any race were 27.10% of the population. There were 617 households, out of which 38.2% had children under the age of 18 living with them, 60.3% were married couples living together, 9.2% had a female householder with no husband present, and 26.4% were non-families. 23.0% of all households were made up of individuals, and 14.1% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.41. In the city, the population was spread out, with 31.4% under the age of 18, 7.8% from 18 to 24, 26.9% from 25 to 44, 19.1% from 45 to 64, and 14.9% who were 65 years of age or older. The median age was 33 years. For every 100 females, there were 97.9 males. For every 100 females age 18 and over, there were 94.7 males. The median income for a household in the city was $31,964, and the median income for a family was $36,336. Males had a median income of $26,167 versus $18,636 for females. The per capita income for the city was $11,861. About 11.7% of families and 15.0% of the population were below the poverty line, including 13.9% of those under age 18 and 28.9% of those age 65 or over. Education It is in the Parma School District 137. Residents of Canyon County are in the area (and the taxation zone) for College of Western Idaho. Notable people Edgar Rice Burroughs, creator of Tarzan and John Carter of Mars. Served as a city councilman for Parma. Jimmy Johnston, American football player, born in Parma Jerry Kramer, American football player; elected to the Pro Football Hall of Fame in 2018 Jordan Kramer, American football player, born in Parma. C.
Notable people Edgar Rice Burroughs, creator of Tarzan and John Carter of Mars. Served as a city councilman for Parma. Jimmy Johnston, American football player, born in Parma Jerry Kramer, American football player; elected to the Pro Football Hall of Fame in 2018 Jordan Kramer, American football player, born in Parma. C.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Middleton, Idaho
Q1517595 QID OVERLAP 0.620
QID OVERLAP: Q1517595 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
boisecanyonidahometropolitannampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in water_rights (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (6): "ada", "boise", "idaho", "miles", "northwest", "population".
adaboiseidahomilesnorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
216 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP216 edges
🌲 EVERGREEN4 edges
0.650
acquisitionagencyboardbroadconstructioncreatedeconomicfederalgovernmentindependentjurisdictionlinesmatterspreviouslyrateregulationregulatoryservedservessubject
SHARED TOKENS (23): "acquisition", "agency", "board", "broad", "construction", "created", "economic", "federal", "government", "independent", "jurisdiction", "lines", "matters", "previously", "rate", "regulation", "regulatory", "served", "serves", "subject".... | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
adaarmybeganboisebuiltcompletedconstructioncontrolcorpsdirectlydownstreamearlyeastengineersfederalfloodfullidahoirrigationlake
SHARED TOKENS (31): "ada", "army", "began", "boise", "built", "completed", "construction", "control", "corps", "directly", "downstream", "early", "east", "engineers", "federal", "flood", "full", "idaho", "irrigation", "lake".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
0.650
acquisitionadministrationcommercialcostsfederalfundgenerallandpercentplanningprogramprojectspublicsafetysoldstations
SHARED TOKENS (16): "acquisition", "administration", "commercial", "costs", "federal", "fund", "general", "land", "percent", "planning", "program", "projects", "public", "safety", "sold", "stations". | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
adaadditionalagenciesamonganotherauthoritybestboisecanyoncapacitycapitalconventionalcostcostscrossdemanddistrictearlyenvironmentalfederal
SHARED TOKENS (64): "ada", "additional", "agencies", "among", "another", "authority", "best", "boise", "canyon", "capacity", "capital", "conventional", "cost", "costs", "cross", "demand", "district", "early", "environmental", "federal".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH168 edges
0.590
agencybegancreatedcreatingdepartmentenforcementidaholawlegislaturemunicipalpublicstatewide
SHARED TOKENS (12): "agency", "began", "created", "creating", "department", "enforcement", "idaho", "law", "legislature", "municipal", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
amongapproximatelyboisedivisionestablishedextensionidaholateroperatesprimarilyproductionprofessionalpublicresearchruralschoolsstatewideuniversityuntil
SHARED TOKENS (19): "among", "approximately", "boise", "division", "established", "extension", "idaho", "later", "operates", "primarily", "production", "professional", "public", "research", "rural", "schools", "statewide", "university", "until". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessageanotherbroadcompletedconstructedconstructioncontainscreatecreateddatedevelopingenvironmentalexcavationhistoricallylakemethodspotentialproviderequire
SHARED TOKENS (31): "access", "age", "another", "broad", "completed", "constructed", "construction", "contains", "create", "created", "date", "developing", "environmental", "excavation", "historically", "lake", "methods", "potential", "provide", "require".... | EXACT TITLE in water_rights: "Well". | EXACT TITLE in transportation_infrastructure: "Well".
0.500
alongsidecanalsclimatecontainscontinuedenergyformindustrialirrigationlandlargemajormovingpermanentrecreationreportssurfacesurroundingtimestreatment
SHARED TOKENS (22): "alongside", "canals", "climate", "contains", "continued", "energy", "form", "industrial", "irrigation", "land", "large", "major", "moving", "permanent", "recreation", "reports", "surface", "surrounding", "times", "treatment".... | EXACT TITLE in water_rights: "Surface water".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesignfeatureslandlocalplaceprimarilyprimaryprivatepublicroadstreetstreetsurbanwhose
SHARED TOKENS (16): "access", "another", "design", "features", "land", "local", "place", "primarily", "primary", "private", "public", "road", "street", "streets", "urban", "whose". | EXACT TITLE in water_rights: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.500
ageanotherchaincurrentdifferentenergyevenlevelmakingnaturalprocessratesinglethoughtimestreated
SHARED TOKENS (16): "age", "another", "chain", "current", "different", "energy", "even", "level", "making", "natural", "process", "rate", "single", "though", "times", "treated". | EXACT TITLE in water_rights: "Radionuclide".
0.500
assetassociatedbuildingbuiltconstructiondesigndevelopmenteconomicextendfacilitiesfinancingindustrialinfrastructuremaintenancepercentplanningprocessuntilwork
SHARED TOKENS (19): "asset", "associated", "building", "built", "construction", "design", "development", "economic", "extend", "facilities", "financing", "industrial", "infrastructure", "maintenance", "percent", "planning", "process", "until", "work". | EXACT TITLE in water_rights: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
agebillionclimateconditionsdependsdevelopingdirectlyenvironmentalfoodformhealthmajorphysicalsuppliedwaterwork
SHARED TOKENS (16): "age", "billion", "climate", "conditions", "depends", "developing", "directly", "environmental", "food", "form", "health", "major", "physical", "supplied", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanotherbuiltcategorychangesclassificationdatadirectlydominantenvironmentenvironmentalhistoricallyimpactimpactslandland-usemajormanagementmethodsmodeling
SHARED TOKENS (34): "agricultural", "another", "built", "category", "changes", "classification", "data", "directly", "dominant", "environment", "environmental", "historically", "impact", "impacts", "land", "land-use", "major", "management", "methods", "modeling".... | EXACT TITLE in water_rights: "Land use". | EXACT TITLE in transportation_infrastructure: "Land use".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingcrossdesigneddrainageembeddedfrequentlyhydraulicitselfnaturalneedperformancepracticeprocessrequirementsroadshapestructuresurfacewater
SHARED TOKENS (19): "allowing", "cross", "designed", "drainage", "embedded", "frequently", "hydraulic", "itself", "natural", "need", "performance", "practice", "process", "requirements", "road", "shape", "structure", "surface", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedbestboisecapitalcontainsdistinctdividedearlyeasteasterneconomyidaholandmanufacturingmethodsmilesmillion
SHARED TOKENS (40): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "early", "east", "eastern", "economy", "idaho", "land", "manufacturing", "methods", "miles", "million".... | EXACT TITLE in water_rights: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
0.500
anotherbodyboundariesdrainageengineeringenvironmentalfeaturesflowshydrologiclakelandpermanentplacesratherriversinglesurfacesystemthoughwater
SHARED TOKENS (20): "another", "body", "boundaries", "drainage", "engineering", "environmental", "features", "flows", "hydrologic", "lake", "land", "permanent", "places", "rather", "river", "single", "surface", "system", "though", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.500
additionalagriculturalapplicationsboundariesbuiltcapacityconditionscontinuedcostcostsdepartmentdistrictenergyestimatedformationindustrialpowerratereduceresources
SHARED TOKENS (25): "additional", "agricultural", "applications", "boundaries", "built", "capacity", "conditions", "continued", "cost", "costs", "department", "district", "energy", "estimated", "formation", "industrial", "power", "rate", "reduce", "resources".... | EXACT TITLE in water_rights: "Geothermal energy".
0.500
anotherconnectedconstructeddesigndesigneddevelopeddevelopingdistributiondrainsenergyengineeringgoverningimpactsinteractionlocalplacesqualitystudysuppliessurface
SHARED TOKENS (24): "another", "connected", "constructed", "design", "designed", "developed", "developing", "distribution", "drains", "energy", "engineering", "governing", "impacts", "interaction", "local", "places", "quality", "study", "supplies", "surface".... | EXACT TITLE in water_rights: "Hydrogeology".
0.500
associationcanalcreatedenvironmentalfrequentlyindustriallandlandscapeparksrecreationalrightsruralservessurfaceurbanusersutility
SHARED TOKENS (17): "association", "canal", "created", "environmental", "frequently", "industrial", "land", "landscape", "parks", "recreational", "rights", "rural", "serves", "surface", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
Wheat ↗ Q15645384 EXACT TITLE
acresdemandessentialfoodgeneralgroupincreasinglandlargermajormakingmillionpopulationproductionqualityrecordsource
SHARED TOKENS (17): "acres", "demand", "essential", "food", "general", "group", "increasing", "land", "larger", "major", "making", "million", "population", "production", "quality", "record", "source". | EXACT TITLE in water_rights: "Wheat".
0.500
canyoncivilconstructionemergencygeneralhomeidahoindustrialintegratedmunicipalnampanationalplanprivatepublicriversystemstraining
SHARED TOKENS (18): "canyon", "civil", "construction", "emergency", "general", "home", "idaho", "industrial", "integrated", "municipal", "nampa", "national", "plan", "private", "public", "river", "systems", "training". | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomebillioncapacitycentralcleanclimatecontainsdischargedistributionenvironmentalformformationindustriallandlevelmajormunicipaloperating
SHARED TOKENS (39): "agricultural", "agriculture", "become", "billion", "capacity", "central", "clean", "climate", "contains", "discharge", "distribution", "environmental", "form", "formation", "industrial", "land", "level", "major", "municipal", "operating".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamongassociationauthorityconstructioncontractscreateddepartmentestablishedextendfederalfundirrigationlandlaterlawlimitmaintenancemajormeridian
SHARED TOKENS (36): "act", "among", "association", "authority", "construction", "contracts", "created", "department", "established", "extend", "federal", "fund", "irrigation", "land", "later", "law", "limit", "maintenance", "major", "meridian".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
applicablebuildingcenterscommercialconsumersdeliverydemanddirectlydistributionequipmentfacilityfirmsfunctioninventorylaborlargemarketneedednetworkoperate
SHARED TOKENS (36): "applicable", "building", "centers", "commercial", "consumers", "delivery", "demand", "directly", "distribution", "equipment", "facility", "firms", "function", "inventory", "labor", "large", "market", "needed", "network", "operate".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
accessactcomprehensivecontinuingcreatedexistingfederalformationfuturegovernedgovernmentlawlocalmetropolitanplanningplanspopulationprocessprogramsprojects
SHARED TOKENS (26): "access", "act", "comprehensive", "continuing", "created", "existing", "federal", "formation", "future", "governed", "government", "law", "local", "metropolitan", "planning", "plans", "population", "process", "programs", "projects".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
acresactagencybecomebuiltdeliverydepartmentdevelopmentestablishedfederalgovernmentirrigationlawmanagementmillionoperationpotentialpowerprogramprojects
SHARED TOKENS (31): "acres", "act", "agency", "become", "built", "delivery", "department", "development", "established", "federal", "government", "irrigation", "law", "management", "million", "operation", "potential", "power", "program", "projects".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
approximatelyboisedatadistrictdistrictsdividedevengovernmentidaholegislaturelowerpopulationresidentssinglesouthsplit
SHARED TOKENS (16): "approximately", "boise", "data", "district", "districts", "divided", "even", "government", "idaho", "legislature", "lower", "population", "residents", "single", "south", "split". | EXACT TITLE in water_rights: "Idaho Legislature".
0.500
broadercomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargerlevelmanagemanagementnationalnetworkplacementplanning
SHARED TOKENS (35): "broader", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "level", "manage", "management", "national", "network", "placement", "planning".... | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
Nitrate ↗ Q49916468 EXACT TITLE
absenceagriculturalapplicationsassociatedcomponentscontainingdirectenergyenvironmentfertilizerfocusedhealthhistoricallymanufacturingmeansmillionnaturalpreservationproductionsignificant
SHARED TOKENS (23): "absence", "agricultural", "applications", "associated", "components", "containing", "direct", "energy", "environment", "fertilizer", "focused", "health", "historically", "manufacturing", "means", "million", "natural", "preservation", "production", "significant".... | EXACT TITLE in water_rights: "Nitrate".
0.500
accessagenciesclimatecommunitycomponentsconditionscreateddevelopmentdifferentdistincteconomiceconomyelectricalemergencyenforcementenvironmentenvironmentalessentialfacilitiesfirms
SHARED TOKENS (50): "access", "agencies", "climate", "community", "components", "conditions", "created", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "enforcement", "environment", "environmental", "essential", "facilities", "firms".... | EXACT TITLE in water_rights: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationavailabilitybeganbuildingbuiltcleanconstructioncriticaldesigndevelopeddownstreamearlyengineeringfailfloodfunctionsgoverninghealthincorporated
SHARED TOKENS (49): "additional", "application", "availability", "began", "building", "built", "clean", "construction", "critical", "design", "developed", "downstream", "early", "engineering", "fail", "flood", "functions", "governing", "health", "incorporated".... | EXACT TITLE in water_rights: "Dam". | EXACT TITLE in transportation_infrastructure: "Dam".
0.500
agriculturalalongsidebillionclimateconcentrateddevelopeddevelopmentdirectenvironmentenvironmentalfocusedgroupgrowthimpactincreaseindividuallimitedmillionnaturalpolicy
SHARED TOKENS (30): "agricultural", "alongside", "billion", "climate", "concentrated", "developed", "development", "direct", "environment", "environmental", "focused", "group", "growth", "impact", "increase", "individual", "limited", "million", "natural", "policy".... | EXACT TITLE in water_rights: "Population growth". | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlylandlargemajornaturalpopulationpotentialreduceresourcesurfacetimingtreatmenturbanwater
SHARED TOKENS (18): "become", "create", "demand", "developed", "directly", "land", "large", "major", "natural", "population", "potential", "reduce", "resource", "surface", "timing", "treatment", "urban", "water". | EXACT TITLE in water_rights: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
affectingagricultureannualavailabilitybecomeclimateconditionscostsdatedevelopingdirectlyeconomiceconomyenvironmentalfoodfuturehealthhistoryimpactimpacts
SHARED TOKENS (42): "affecting", "agriculture", "annual", "availability", "become", "climate", "conditions", "costs", "date", "developing", "directly", "economic", "economy", "environmental", "food", "future", "health", "history", "impact", "impacts".... | EXACT TITLE in water_rights: "Drought".
0.500
agriculturalanotherbodyenvironmentfacilityimpactindustrialmunicipalon-siteoptionsprocessresultingreturntreatedtreatmentuseswastewater
SHARED TOKENS (18): "agricultural", "another", "body", "environment", "facility", "impact", "industrial", "municipal", "on-site", "options", "process", "resulting", "return", "treated", "treatment", "uses", "waste", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
adaarmyboisebuiltcanalcanyoncompletedcorpscountiesengineersidahoirrigationmilesoperatedprimaryrivertreasurevalleywaterwestern
SHARED TOKENS (20): "ada", "army", "boise", "built", "canal", "canyon", "completed", "corps", "counties", "engineers", "idaho", "irrigation", "miles", "operated", "primary", "river", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.500
actapplicableassociationauthoritybestcentralchangescommunitycomprehensiveconditionsconflictscostscreatingdependdependsdesigndevelopmentdistrictseconomicenvironmental
SHARED TOKENS (50): "act", "applicable", "association", "authority", "best", "central", "changes", "community", "comprehensive", "conditions", "conflicts", "costs", "creating", "depend", "depends", "design", "development", "districts", "economic", "environmental".... | EXACT TITLE in water_rights: "Land-use planning".
0.500
apprenticeshipboundariescertificationcompletecontinuedextendlaborlevellicenseperiodpermanentplacementpotentialpracticepractitionersprofessionalregulatedstudysystemtraining
SHARED TOKENS (20): "apprenticeship", "boundaries", "certification", "complete", "continued", "extend", "labor", "level", "license", "period", "permanent", "placement", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "training". | EXACT TITLE in water_rights: "Apprenticeship". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
0.500
accordingcommunitydescribesdevelopmenteconomicfocusedfrequentlygrowthhistoricallyincreasesindividualinfrastructurelocalmarketobjectivespoliciespolicyprocessqualityregion
SHARED TOKENS (21): "according", "community", "describes", "development", "economic", "focused", "frequently", "growth", "historically", "increases", "individual", "infrastructure", "local", "market", "objectives", "policies", "policy", "process", "quality", "region".... | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
articlechainconsumerconsumersconvertcreatingdirectdirectlydistributionfacilitiesindependentmanagementmaterialsnetworkstructuresupplierssupplysystemsystemsthem
SHARED TOKENS (21): "article", "chain", "consumer", "consumers", "convert", "creating", "direct", "directly", "distribution", "facilities", "independent", "management", "materials", "network", "structure", "suppliers", "supply", "system", "systems", "them".... | EXACT TITLE in water_rights: "Supply chain". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
administrationagencyassetsauthoritycertificationcivilcommercialcontrolcreateddepartmentfederalgovernmentpersonnelregulatesspacestandardssurroundingtransportation
SHARED TOKENS (18): "administration", "agency", "assets", "authority", "certification", "civil", "commercial", "control", "created", "department", "federal", "government", "personnel", "regulates", "space", "standards", "surrounding", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
0.500
agricultureboisecivilcountieseastengineeringengineersidahoirrigationlevelnationaloperatedprimaryprovideriverwaterwestern
SHARED TOKENS (17): "agriculture", "boise", "civil", "counties", "east", "engineering", "engineers", "idaho", "irrigation", "level", "national", "operated", "primary", "provide", "river", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.500
acresadaapproximatelyboisecanalcanalscanyoncapacityidahoirrigationlakemilesriversystemtreasurevalleywaterwestern
SHARED TOKENS (18): "acres", "ada", "approximately", "boise", "canal", "canals", "canyon", "capacity", "idaho", "irrigation", "lake", "miles", "river", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.500
acquiredacquisitionsadditionalextendsformformationhistoryindependentlaterlinesmajornetworkoperatesoperatingprincipalregionalstarthroughout
SHARED TOKENS (18): "acquired", "acquisitions", "additional", "extends", "form", "formation", "history", "independent", "later", "lines", "major", "network", "operates", "operating", "principal", "regional", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributiondrainageengineeringenvironmentalmanagementmethodsnaturalphysicalplanningpolicypractitionerpreservationqualityresearchresourcesstudysurfacewater
SHARED TOKENS (20): "civil", "data", "distribution", "drainage", "engineering", "environmental", "management", "methods", "natural", "physical", "planning", "policy", "practitioner", "preservation", "quality", "research", "resources", "study", "surface", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotherbesteasementsenteritselflandlawlimitedownedprivatelypropertyprovidingpublicrealrightsroadstated
SHARED TOKENS (19): "access", "among", "another", "best", "easements", "enter", "itself", "land", "law", "limited", "owned", "privately", "property", "providing", "public", "real", "rights", "road", "stated". | EXACT TITLE in water_rights: "Easement". | EXACT TITLE in transportation_infrastructure: "Easement".
0.500
administrationagencyapproximatelyauthoritybillionbudgetconnectingcreateddatadepartmentenforcementfacilitiesfederalgovernmentlawlocaloperatedpersonnelpoliciesprimary
SHARED TOKENS (31): "administration", "agency", "approximately", "authority", "billion", "budget", "connecting", "created", "data", "department", "enforcement", "facilities", "federal", "government", "law", "local", "operated", "personnel", "policies", "primary".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordinganotherarmychaincivilcostsdeliveriesequipmentfacilityfoodinformationlinesmanagementmaterialsmodelmovingoperationalpartsphysicalplanning
SHARED TOKENS (31): "according", "another", "army", "chain", "civil", "costs", "deliveries", "equipment", "facility", "food", "information", "lines", "management", "materials", "model", "moving", "operational", "parts", "physical", "planning".... | EXACT TITLE in transportation_infrastructure: "Logistics".
0.500
administrationagenciesagencydepartmentdistrictexistingfederalfunctionsgovernmentlocalofficeoperateoperatorsprimarilyprogramsprovidersprovidingpublicregionalrequirements
SHARED TOKENS (27): "administration", "agencies", "agency", "department", "district", "existing", "federal", "functions", "government", "local", "office", "operate", "operators", "primarily", "programs", "providers", "providing", "public", "regional", "requirements".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
assetsbodybroadbroadercanalscapitalcategorycommunityconstructedconstructiondirectlyeconomicelectricalemploymentenvironmentalfacilitiesgovernmenthabitathealthinfrastructure
SHARED TOKENS (38): "assets", "body", "broad", "broader", "canals", "capital", "category", "community", "constructed", "construction", "directly", "economic", "electrical", "employment", "environmental", "facilities", "government", "habitat", "health", "infrastructure".... | EXACT TITLE in water_rights: "Public works". | EXACT TITLE in transportation_infrastructure: "Public works".
0.500
accordingagriculturalagriculturechangesclassificationcontainingdifferentenvironmentalfoodformhomeimpactindustrialmakingmethodsotherwisephysicalpreservationprimaryprocessing
SHARED TOKENS (21): "according", "agricultural", "agriculture", "changes", "classification", "containing", "different", "environmental", "food", "form", "home", "impact", "industrial", "making", "methods", "otherwise", "physical", "preservation", "primary", "processing".... | EXACT TITLE in water_rights: "Food processing". | EXACT TITLE in transportation_infrastructure: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestategeneralgovernmentintendedlandlawlegalmeansnaturalnonprofitownedownershipprivatepropertypublic
SHARED TOKENS (25): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "government", "intended", "land", "law", "legal", "means", "natural", "nonprofit", "owned", "ownership", "private", "property", "public".... | EXACT TITLE in water_rights: "Real estate". | EXACT TITLE in transportation_infrastructure: "Real estate".
0.500
Water treatment ↗ EXACT TITLE
advancedbecomescomponentsdevelopedenergyenvironmentenvironmentalhealthindustrialirrigationmaintenancematerialsmethodsprocessqualityreceivingrecreationresourceriverspecific
SHARED TOKENS (25): "advanced", "becomes", "components", "developed", "energy", "environment", "environmental", "health", "industrial", "irrigation", "maintenance", "materials", "methods", "process", "quality", "receiving", "recreation", "resource", "river", "specific".... | EXACT TITLE in water_rights: "Water treatment".
0.500
assesscompliancecontactdeterminesfrequentlyhealthimpactoptionsphysicalqualityreferencesafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (17): "assess", "compliance", "contact", "determines", "frequently", "health", "impact", "options", "physical", "quality", "reference", "safety", "significant", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.500
Telemetry ↗ Q209867 EXACT TITLE
communicationscontrolcostdatadigitalequipmenthydraulicinstructionsmeasuremediamonitoringneednetworkoperatephysicalpowerreceivereceivingrequiresystems
SHARED TOKENS (21): "communications", "control", "cost", "data", "digital", "equipment", "hydraulic", "instructions", "measure", "media", "monitoring", "need", "network", "operate", "physical", "power", "receive", "receiving", "require", "systems".... | EXACT TITLE in water_rights: "Telemetry".
0.500
accessallowingassociationcompetingcoordinationcostsdevelopmenteconomicestatefrequentlygeneralgovernmenthistoricalinfrastructureintegratedintendedlocalmodelmunicipalnetwork
SHARED TOKENS (44): "access", "allowing", "association", "competing", "coordination", "costs", "development", "economic", "estate", "frequently", "general", "government", "historical", "infrastructure", "integrated", "intended", "local", "model", "municipal", "network".... | EXACT TITLE in transportation_infrastructure: "Public transport".
0.500
constructioncontextcontroldescribeddesignedengineerequipmentfrequentlyfunctionshydraulicindustrialinformationinvolvinglaborlargeoperationsotherwisepowerprimarysource
SHARED TOKENS (23): "construction", "context", "control", "described", "designed", "engineer", "equipment", "frequently", "functions", "hydraulic", "industrial", "information", "involving", "labor", "large", "operations", "otherwise", "power", "primary", "source".... | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
approveddepartmentfacilitiesfederalidentifiedindividuallocalmajormetropolitannationalnetworkorganizationspipelineplanningsafetyservingstationssystemtransportation
SHARED TOKENS (19): "approved", "department", "facilities", "federal", "identified", "individual", "local", "major", "metropolitan", "national", "network", "organizations", "pipeline", "planning", "safety", "serving", "stations", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
accordingauthoritybeganboundariescivilconcentratedconsolidatedcountiesdifferentdistrictdistrictsdividedentitiesexistingformformergovernmentindependentlawlegally
SHARED TOKENS (36): "according", "authority", "began", "boundaries", "civil", "concentrated", "consolidated", "counties", "different", "district", "districts", "divided", "entities", "existing", "form", "former", "government", "independent", "law", "legally".... | EXACT TITLE in water_rights: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
adaboisecommercialdepartmentfacilityfunctionsgeneralidahoincreasemilesmillionnationaloperatedoperatesreceiverequiringrightssouthsupporttimes
SHARED TOKENS (22): "ada", "boise", "commercial", "department", "facility", "functions", "general", "idaho", "increase", "miles", "million", "national", "operated", "operates", "receive", "requiring", "rights", "south", "support", "times".... | EXACT TITLE in transportation_infrastructure: "Boise Airport".
0.500
actadministrationagenciesagencycivilcreateddepartmentdevelopmentfederalgovernmentmanagementnationaloperatespolicyprogramsprovidepublicregulationsrehabilitationresearch
SHARED TOKENS (24): "act", "administration", "agencies", "agency", "civil", "created", "department", "development", "federal", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "regulations", "rehabilitation", "research".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
annualapplicationapplicationsapproximatelyboundariescapacitycontainsdirectenergyevenformationneededprimarysourcesurface
SHARED TOKENS (15): "annual", "application", "applications", "approximately", "boundaries", "capacity", "contains", "direct", "energy", "even", "formation", "needed", "primary", "source", "surface". | EXACT TITLE in water_rights: "Geothermal heating".
0.500
Bridge ↗ Q12280 EXACT TITLE
allowingbridgebuiltcommunityconnectingconnectionconstructedconstructioncreatecrossdesigndesignedearlyengineeringengineersenvironmentfrequentlyimpactsindustrialintended
SHARED TOKENS (38): "allowing", "bridge", "built", "community", "connecting", "connection", "constructed", "construction", "create", "cross", "design", "designed", "early", "engineering", "engineers", "environment", "frequently", "impacts", "industrial", "intended".... | EXACT TITLE in water_rights: "Bridge". | EXACT TITLE in transportation_infrastructure: "Bridge".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualclassificationclimateconditionscontextdifferentformationimpactphysicalprovideresourcestudywaterzones
SHARED TOKENS (15): "agriculture", "annual", "classification", "climate", "conditions", "context", "different", "formation", "impact", "physical", "provide", "resource", "study", "water", "zones". | EXACT TITLE in water_rights: "Snowpack".
0.500
commercialdirectlydrainsindustrialinfrastructuremunicipalitiesseparateservedservingsewersurfacesystemsystemstreatmenturban
SHARED TOKENS (15): "commercial", "directly", "drains", "industrial", "infrastructure", "municipalities", "separate", "served", "serving", "sewer", "surface", "system", "systems", "treatment", "urban". | EXACT TITLE in water_rights: "Sanitary sewer".
0.500
associationbestcontractorscontroldescribedenvironmentequipmenthydraulicmanagemonitoringnaturalobjectivespressureprocessproducingprofileregulatedresourcesearchsurface
SHARED TOKENS (22): "association", "best", "contractors", "control", "described", "environment", "equipment", "hydraulic", "manage", "monitoring", "natural", "objectives", "pressure", "process", "producing", "profile", "regulated", "resource", "search", "surface".... | EXACT TITLE in water_rights: "Well drilling".
0.500
accessallowingbegancommunicationsdatadevelopersdevelopmentdigitaldividedearlyelectricalformindependentindividualinformationmeansmediaphysicalpowerreduced
SHARED TOKENS (23): "access", "allowing", "began", "communications", "data", "developers", "development", "digital", "divided", "early", "electrical", "form", "independent", "individual", "information", "means", "media", "physical", "power", "reduced".... | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
actapplicationbecomescleandischargeenterexpresslyflowsincreasesirrigationneedperiodpermitqualityrequirementsreturnsuppliedsurfacesurroundinguses
SHARED TOKENS (21): "act", "application", "becomes", "clean", "discharge", "enter", "expressly", "flows", "increases", "irrigation", "need", "period", "permit", "quality", "requirements", "return", "supplied", "surface", "surrounding", "uses".... | EXACT TITLE in water_rights: "Return flow".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbusinessescomponentsdesigneddirectlyfacilityfunctionindustriallargemanufacturingmaterialsmovingparkspartsproduction
SHARED TOKENS (17): "agriculture", "associated", "building", "businesses", "components", "designed", "directly", "facility", "function", "industrial", "large", "manufacturing", "materials", "moving", "parks", "parts", "production". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
actagricultureapproximatelybeganboardboisecapacitycompletedcompletionconstructiondesignflowshomeidahoirrigationlaborlawlevelmaterialsmiles
SHARED TOKENS (39): "act", "agriculture", "approximately", "began", "board", "boise", "capacity", "completed", "completion", "construction", "design", "flows", "home", "idaho", "irrigation", "labor", "law", "level", "materials", "miles".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalapproximatelybillionboardbusinessdirectlyfederallimitedlinesmetropolitanmilesmillionnationalnetworkoperateoperatesoperatorownedpartsserved
SHARED TOKENS (27): "additional", "approximately", "billion", "board", "business", "directly", "federal", "limited", "lines", "metropolitan", "miles", "million", "national", "network", "operate", "operates", "operator", "owned", "parts", "served".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
adaboardboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprimaryprogramspublic
SHARED TOKENS (32): "ada", "board", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in water_rights: "College of Western Idaho". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
0.500
agenciesapplybusinessescomprehensivedesignfacilitiesfuturegovernmentimpactslinesmoveplannersplanningpoliciesprivateprocesspublicstreetssystemtransportation
SHARED TOKENS (20): "agencies", "apply", "businesses", "comprehensive", "design", "facilities", "future", "government", "impacts", "lines", "move", "planners", "planning", "policies", "private", "process", "public", "streets", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
0.500
accessagenciesbeyondcommunitydesigneddevelopeddevelopingdischargeeconomicextendsformgovernmentlocalmetropolitanoperateoperatedoperatesoperatorsorganizationsprivate
SHARED TOKENS (29): "access", "agencies", "beyond", "community", "designed", "developed", "developing", "discharge", "economic", "extends", "form", "government", "local", "metropolitan", "operate", "operated", "operates", "operators", "organizations", "private".... | EXACT TITLE in transportation_infrastructure: "Paratransit".
0.500
agriculturecapitalcommercialcommunitycostcostsdependdifferentenergyinstitutionalirrigationlargelargerpersonnelpolicypracticepressureprimarilyproviderspublic
SHARED TOKENS (32): "agriculture", "capital", "commercial", "community", "cost", "costs", "depend", "different", "energy", "institutional", "irrigation", "large", "larger", "personnel", "policy", "practice", "pressure", "primarily", "providers", "public".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsagencyapplicationscontainingdetermineenvironmentalessentialformgrouphealthiiiincreasinglargerlistneededprimaryproductionproposedresearchrole
SHARED TOKENS (26): "affects", "agency", "applications", "containing", "determine", "environmental", "essential", "form", "group", "health", "iii", "increasing", "larger", "list", "needed", "primary", "production", "proposed", "research", "role".... | EXACT TITLE in water_rights: "Arsenic".
0.480
agriculturalapproximatelyclimateindustrialirrigationnaturalresourceresourcesriversourcesouthsupplysurfacewater
SHARED TOKENS (14): "agricultural", "approximately", "climate", "industrial", "irrigation", "natural", "resource", "resources", "river", "source", "south", "supply", "surface", "water". | EXACT TITLE in water_rights: "Water resources". | EXACT TITLE in transportation_infrastructure: "Water resources".
0.480
accessanotherdescribingestateevenlegalpropertyrightssharesspecificthoughtitleviewwater
SHARED TOKENS (14): "access", "another", "describing", "estate", "even", "legal", "property", "rights", "shares", "specific", "though", "title", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.480
Broadband ↗ Q194163 EXACT TITLE
accesscontextdatadifferentdigitalimplementationintegratedlevelnetworkproviderequirementssignalstransferuses
SHARED TOKENS (14): "access", "context", "data", "different", "digital", "implementation", "integrated", "level", "network", "provide", "requirements", "signals", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.480
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodecommercialconditionsdevelopedmodeloperatingprimarilyprogrampublicsourcesurveysystems
SHARED TOKENS (14): "beyond", "boundary", "code", "commercial", "conditions", "developed", "model", "operating", "primarily", "program", "public", "source", "survey", "systems". | EXACT TITLE in water_rights: "MODFLOW".
0.480
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentformationhomeindustriallandlayermajormaterialspressureregionsourcestudywater
SHARED TOKENS (14): "beyond", "environment", "formation", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "source", "study", "water". | EXACT TITLE in water_rights: "Aquifer".
0.480
articlecontrolscrossdesigndifferentmajorotherwisepracticeprimarilyreflectsroadseparatespecifieduses
SHARED TOKENS (14): "article", "controls", "cross", "design", "different", "major", "otherwise", "practice", "primarily", "reflects", "road", "separate", "specified", "uses". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.480
administrationagencydepartmentdivisionfederalmajorofficepreviouslyprogramprogramspublicroadroletransportation
SHARED TOKENS (14): "administration", "agency", "department", "division", "federal", "major", "office", "previously", "program", "programs", "public", "road", "role", "transportation". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
0.460
Reservoir ↗ Q131681 EXACT TITLE
bodybuildingbuiltcontrollingcreateddrainsexistingformlakepowerspacestoragewater
SHARED TOKENS (13): "body", "building", "built", "controlling", "created", "drains", "existing", "form", "lake", "power", "space", "storage", "water". | EXACT TITLE in water_rights: "Reservoir".
0.460
Ditch ↗ Q2048319 EXACT TITLE
alongsideconditionscreateddrainageeasternirrigationmajorprovideruralsourcethemwaterwhose
SHARED TOKENS (13): "alongside", "conditions", "created", "drainage", "eastern", "irrigation", "major", "provide", "rural", "source", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.460
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbodycontroldevelopeddischargefloodfrequentlyincreasinglandriverurbanvalleywater
SHARED TOKENS (13): "agricultural", "body", "control", "developed", "discharge", "flood", "frequently", "increasing", "land", "river", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.460
agriculturalclimateirrigationlocalmanagementmeasurementnaturalopenresourcerolesurfacesurfaceswater
SHARED TOKENS (13): "agricultural", "climate", "irrigation", "local", "management", "measurement", "natural", "open", "resource", "role", "surface", "surfaces", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.440
Pedestrian ↗ Q221488 EXACT TITLE
associatedcreatingearlyfoothistoricallynetworkprofessionalrecordruralsafetystreetsurban
SHARED TOKENS (12): "associated", "creating", "early", "foot", "historically", "network", "professional", "record", "rural", "safety", "streets", "urban". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.440
differentirrigationlawlegalmannerphysicalriversourcesurfacesystemsuserswater
SHARED TOKENS (12): "different", "irrigation", "law", "legal", "manner", "physical", "river", "source", "surface", "systems", "users", "water". | EXACT TITLE in water_rights: "Water right".
0.440
capacitydeliveriesdeliveryfeefuturepracticereturnrightssignificantstoragetransferswater
SHARED TOKENS (12): "capacity", "deliveries", "delivery", "fee", "future", "practice", "return", "rights", "significant", "storage", "transfers", "water". | EXACT TITLE in water_rights: "Water banking".
0.440
administrationagencyassociateddepartmenteconomicfederalmanagesnationalofficepotentialresourcesresponsible
SHARED TOKENS (12): "administration", "agency", "associated", "department", "economic", "federal", "manages", "national", "office", "potential", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.420
agencyboisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulationsresponsible
SHARED TOKENS (11): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations", "responsible". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.400
Utility ↗ Q466707 EXACT TITLE
amongcontextdevelopeddistinctfunctionfunctionsmeasurerelationshipsourceutility
SHARED TOKENS (10): "among", "context", "developed", "distinct", "function", "functions", "measure", "relationship", "source", "utility". | EXACT TITLE in water_rights: "Utility". | EXACT TITLE in transportation_infrastructure: "Utility".
0.380
determinesevaluatedevidencelegalobligationsprocessreviewsrightsshows
SHARED TOKENS (9): "determines", "evaluated", "evidence", "legal", "obligations", "process", "reviews", "rights", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.380
boiseeasternexpansionformeridaholakeoperatingpioneerthough
SHARED TOKENS (9): "boise", "eastern", "expansion", "former", "idaho", "lake", "operating", "pioneer", "though". | EXACT TITLE in water_rights: "Pioneer (train)". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.380
Snowplow ↗ Q14976 EXACT TITLE
frequentlyintendedlargereceiveservingspecificstreetssurfacestransportation
SHARED TOKENS (9): "frequently", "intended", "large", "receive", "serving", "specific", "streets", "surfaces", "transportation". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.380
drainageenvironmentalhydrologicmethodsmovingprimaryprocesssurfacewater
SHARED TOKENS (9): "drainage", "environmental", "hydrologic", "methods", "moving", "primary", "process", "surface", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.380
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboisedrainsidahomilesriverurbanwestern
SHARED TOKENS (9): "agricultural", "approximately", "boise", "drains", "idaho", "miles", "river", "urban", "western". | EXACT TITLE in water_rights: "Boise River". | EXACT TITLE in transportation_infrastructure: "Boise River".
0.360
agriculturebuildingdevelopmentestatelandlandscapenaturalreal
SHARED TOKENS (8): "agriculture", "building", "development", "estate", "land", "landscape", "natural", "real". | EXACT TITLE in water_rights: "Land development". | EXACT TITLE in transportation_infrastructure: "Land development".
0.360
capacitydischargeestimatedlandmajorrecordsurfacewater
SHARED TOKENS (8): "capacity", "discharge", "estimated", "land", "major", "record", "surface", "water". | EXACT TITLE in water_rights: "Streamflow".
0.360
crosspermitroadstreetssurfacesystemthoughuses
SHARED TOKENS (8): "cross", "permit", "road", "streets", "surface", "system", "though", "uses". | EXACT TITLE in water_rights: "Interchange (road)". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.360
Sidewalk ↗ Q177749 EXACT TITLE
designedlandprimarilyprivateroadsidesouthstreet
SHARED TOKENS (8): "designed", "land", "primarily", "private", "road", "side", "south", "street". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.320
Sugar beet ↗ Q151964 EXACT TITLE
containsgroupmillionproductiontogetherwhose
SHARED TOKENS (6): "contains", "group", "million", "production", "together", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.300
accesschaincostsdirectgeneralgroupintendeditselfmovingoperatingpracticepracticesregionspecializedtransportationunion
SHARED TOKENS (16): "access", "chain", "costs", "direct", "general", "group", "intended", "itself", "moving", "operating", "practice", "practices", "region", "specialized", "transportation", "union".
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturecanalscreateddatedesignedformformerhealthhistoricalirrigationmanagementmethodsoperatedpartspracticeregionresourcesystemsthroughout
SHARED TOKENS (21): "agricultural", "agriculture", "canals", "created", "date", "designed", "form", "former", "health", "historical", "irrigation", "management", "methods", "operated", "parts", "practice", "region", "resource", "systems", "throughout"....
0.300
analysisanotherapplicationsbodybroaderbusinessdatadatabasedateengineeringessentialindexinformationinstitutionalintegratedmanagemanagementmethodsnaturalopen
SHARED TOKENS (33): "analysis", "another", "applications", "body", "broader", "business", "data", "database", "date", "engineering", "essential", "index", "information", "institutional", "integrated", "manage", "management", "methods", "natural", "open"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
alreadyapprovalapprovedconditionsdeterminedigitalindependentinspectionmaintenancepartsproposedrepairroleshowingspecificwork
SHARED TOKENS (16): "already", "approval", "approved", "conditions", "determine", "digital", "independent", "inspection", "maintenance", "parts", "proposed", "repair", "role", "showing", "specific", "work".
0.300
advancedapplicationscentralcleancomponentscontrolcreatecreatedenvironmentequipmentfacilitiesindividualindustrialinsideintegratedlargemanufacturingmaterialsneedprocess
SHARED TOKENS (30): "advanced", "applications", "central", "clean", "components", "control", "create", "created", "environment", "equipment", "facilities", "individual", "industrial", "inside", "integrated", "large", "manufacturing", "materials", "need", "process"....
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesignengineersenvironmentfullincreaselineslowermakesneedpermittedreducereducedrequireresearchresultingroadrules
SHARED TOKENS (27): "associated", "become", "central", "design", "engineers", "environment", "full", "increase", "lines", "lower", "makes", "need", "permitted", "reduce", "reduced", "require", "research", "resulting", "road", "rules"....
0.300
accordingcreatingdemandformfunctionsmannernetworkolderprivateprogramsprovidepublicratherruralusers
SHARED TOKENS (15): "according", "creating", "demand", "form", "functions", "manner", "network", "older", "private", "programs", "provide", "public", "rather", "rural", "users".
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercivildevelopeddividedeconomicenforcementenvironmentalgoverninggovernsjurisdictionlandlawlegalmajorownershipprivatepropertypublicreal
SHARED TOKENS (26): "acquisition", "another", "civil", "developed", "divided", "economic", "enforcement", "environmental", "governing", "governs", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real"....
0.300
advancedagriculturalagriculturebusinessescostcostsdirectdistributioneastenvironmentalincreasingindustrialirrigationmanagementmunicipalnaturaloptionspracticeprocessreduce
SHARED TOKENS (32): "advanced", "agricultural", "agriculture", "businesses", "cost", "costs", "direct", "distribution", "east", "environmental", "increasing", "industrial", "irrigation", "management", "municipal", "natural", "options", "practice", "process", "reduce"....
0.300
actadministeredagenciesauthoritycodecomprehensiveconsequencedependdescribeddesigneddevelopmentdifferentdirectseconomicenactedfederalgrowthlawlegislationmeans
SHARED TOKENS (32): "act", "administered", "agencies", "authority", "code", "comprehensive", "consequence", "depend", "described", "designed", "development", "different", "directs", "economic", "enacted", "federal", "growth", "law", "legislation", "means"....
0.300
builtbusinessescenterscentralchangesconsequencedevelopmenteasteconomicenvironmentalexpansionformationgrowthmodelpopulationprocessresidentsruralsouthurban
SHARED TOKENS (20): "built", "businesses", "centers", "central", "changes", "consequence", "development", "east", "economic", "environmental", "expansion", "formation", "growth", "model", "population", "process", "residents", "rural", "south", "urban".
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
bestcontrolcriticalenforcementhealthidentifiedimpactlevelmeasuresmethodsoccupationalpracticesprovidingpublicremainrequiringroadruralsafetyside
SHARED TOKENS (25): "best", "control", "critical", "enforcement", "health", "identified", "impact", "level", "measures", "methods", "occupational", "practices", "providing", "public", "remain", "requiring", "road", "rural", "safety", "side"....
0.300
buildingbusinesscentraldesigneddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepublicrelationshipresidentialservingspaceurban
SHARED TOKENS (19): "building", "business", "central", "designed", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "relationship", "residential", "serving", "space", "urban".
0.300
administrationagenciesanotherbuiltchangescivilcontrolcreateddecisionsdivisioneconomiceducationenforcementenvironmentenvironmentalexpandedgoverninggovernmentincreaseinteraction
SHARED TOKENS (35): "administration", "agencies", "another", "built", "changes", "civil", "control", "created", "decisions", "division", "economic", "education", "enforcement", "environment", "environmental", "expanded", "governing", "government", "increase", "interaction"....
0.300
additionalagricultureannualboisechangesclimatedatadescribeddifferentearlyestimatedextendgeneralhistoryidahoimpactsincreaseincreasesincreasinginteraction
SHARED TOKENS (34): "additional", "agriculture", "annual", "boise", "changes", "climate", "data", "described", "different", "early", "estimated", "extend", "general", "history", "idaho", "impacts", "increase", "increases", "increasing", "interaction"....
0.300
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisiondrainageeastflowsidaholargermajormilesnationalprimarilyrecreationriversectionsouthvalleywest
SHARED TOKENS (17): "agricultural", "division", "drainage", "east", "flows", "idaho", "larger", "major", "miles", "national", "primarily", "recreation", "river", "section", "south", "valley", "west".
0.300
becomechangesdesignengineeringengineersmeasuresphysicalplannersresponsibleroadrulesafetystrategiessurfaceurbanuses
SHARED TOKENS (16): "become", "changes", "design", "engineering", "engineers", "measures", "physical", "planners", "responsible", "road", "rule", "safety", "strategies", "surface", "urban", "uses".
0.300
accessibleadministrationageagencyanotherbuildingcenterscommercialconstructiondepartmentdistributiondivisioneconomyeducationenvironmentalfederalgoverninggovernshealthhome
SHARED TOKENS (45): "accessible", "administration", "age", "agency", "another", "building", "centers", "commercial", "construction", "department", "distribution", "division", "economy", "education", "environmental", "federal", "governing", "governs", "health", "home"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturebodycontrolsdescribingdevelopmentenvironmentenvironmentalfertilizergeneralgrowthindustriallakepoliciesprocessprogramreduceresultingriversourcesurface
SHARED TOKENS (21): "agriculture", "body", "controls", "describing", "development", "environment", "environmental", "fertilizer", "general", "growth", "industrial", "lake", "policies", "process", "program", "reduce", "resulting", "river", "source", "surface"....
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
connectedenvironmentfacilityflowsinvolvingon-siteprimaryratereduceruralsystemsystemsthereforetreatedtreatmentwaste
SHARED TOKENS (16): "connected", "environment", "facility", "flows", "involving", "on-site", "primary", "rate", "reduce", "rural", "system", "systems", "therefore", "treated", "treatment", "waste".
0.300
anotherarticlebecomecapacitydemanddepartmentsincreasinginteractionplanningpublicresultingroadtimestransportationurban
SHARED TOKENS (15): "another", "article", "become", "capacity", "demand", "departments", "increasing", "interaction", "planning", "public", "resulting", "road", "times", "transportation", "urban".
0.300
alongsidecapacitycapitalconnectingconventionalcostdesigndesignedfeatureslowermillionnetworkpublicqualityreducereliabilitysinglesystemsystemstransportation
SHARED TOKENS (20): "alongside", "capacity", "capital", "connecting", "conventional", "cost", "design", "designed", "features", "lower", "million", "network", "public", "quality", "reduce", "reliability", "single", "system", "systems", "transportation".
0.300
advancedapplicationcapacitychangesconditionsdifferentemergencyincreaseinformationinfrastructurelimitmanagementprovidereduceroadsafetysystemsystemstimestransportation
SHARED TOKENS (22): "advanced", "application", "capacity", "changes", "conditions", "different", "emergency", "increase", "information", "infrastructure", "limit", "management", "provide", "reduce", "road", "safety", "system", "systems", "times", "transportation"....
0.300
affectsagriculturalagriculturebecomebodybuildingcategorychangesconstructioncontrolcontrollingdifferentdrainagelandlargelocalmakingmanagementminingoperations
SHARED TOKENS (34): "affects", "agricultural", "agriculture", "become", "body", "building", "category", "changes", "construction", "control", "controlling", "different", "drainage", "land", "large", "local", "making", "management", "mining", "operations"....
0.300
actadministersarmyassociatedauthorizationcorpsdevelopmentdivisionenactedengineersenvironmentalfloodimprovementsindexinfrastructurenationalnetpdfpublicreference
SHARED TOKENS (24): "act", "administers", "army", "associated", "authorization", "corps", "development", "division", "enacted", "engineers", "environmental", "flood", "improvements", "index", "infrastructure", "national", "net", "pdf", "public", "reference"....
0.300
additionalcommercialcomponentsconnectionsconsumersdevelopingdistributiondownstreamdrainagefacilitieshydraulichydrologicindustriallakelocallyneednetworkpressureprivateprovide
SHARED TOKENS (34): "additional", "commercial", "components", "connections", "consumers", "developing", "distribution", "downstream", "drainage", "facilities", "hydraulic", "hydrologic", "industrial", "lake", "locally", "need", "network", "pressure", "private", "provide"....
0.300
appearscreatedcrossevenfacilitiesfeaturesgovernlargelowerotherwiseplaceroadrulessafetyseparatesignalsstreetsurfacestogetherusers
SHARED TOKENS (20): "appears", "created", "cross", "even", "facilities", "features", "govern", "large", "lower", "otherwise", "place", "road", "rules", "safety", "separate", "signals", "street", "surfaces", "together", "users".
0.300
amongapproximatelyassociationboisecanyoncapacitycompletedcontainscountiescreatedcreatesdirectlyeastedgefederalformationidaholakelevellocal
SHARED TOKENS (39): "among", "approximately", "association", "boise", "canyon", "capacity", "completed", "contains", "counties", "created", "creates", "directly", "east", "edge", "federal", "formation", "idaho", "lake", "level", "local"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
applyboundariesdataengineeringformergeotechnicalhydraulicincreaseminutesmodelmonitoringprimarilyrealresponsesimplysystemtestingwater
SHARED TOKENS (18): "apply", "boundaries", "data", "engineering", "former", "geotechnical", "hydraulic", "increase", "minutes", "model", "monitoring", "primarily", "real", "response", "simply", "system", "testing", "water".
0.300
analysisbestbroaderbuildingchangesclimatecontroldescribingeffectiveengineeringfloodimpactincreaseindividualinfrastructurelandscapelevelmanagemanagementmeasures
SHARED TOKENS (33): "analysis", "best", "broader", "building", "changes", "climate", "control", "describing", "effective", "engineering", "flood", "impact", "increase", "individual", "infrastructure", "landscape", "level", "manage", "management", "measures"....
0.300
addressingappliesbroadcivilconstructioncontrolcreatedesignengineeringengineersenvironmentenvironmentalfocusedhealthimpactindustriallawlicensinglocalmanagement
SHARED TOKENS (38): "addressing", "applies", "broad", "civil", "construction", "control", "create", "design", "engineering", "engineers", "environment", "environmental", "focused", "health", "impact", "industrial", "law", "licensing", "local", "management"....
0.300
appliesapprovalassociationcontextdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactimpactsmajormakingmanagementmoveplanplanspolicies
SHARED TOKENS (35): "applies", "approval", "association", "context", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "impacts", "major", "making", "management", "move", "plan", "plans", "policies"....
0.300
accessadvancedbuiltcapacitycentralchangesclasscompletedconflictsconnectconnectedconnectingconstructedcontainingdesignedevenincreasingnetworkplansproperty
SHARED TOKENS (33): "access", "advanced", "built", "capacity", "central", "changes", "class", "completed", "conflicts", "connect", "connected", "connecting", "constructed", "containing", "designed", "even", "increasing", "network", "plans", "property"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwelleasteasterngeneralidahomajormilesnationalnorthwestofficialpacificriverroadrulesthroughoutwestwestern
SHARED TOKENS (17): "caldwell", "east", "eastern", "general", "idaho", "major", "miles", "national", "northwest", "official", "pacific", "river", "road", "rules", "throughout", "west", "western".
0.300
Agriculture in Idaho ↗ KW CROSS HIGH
acresagriculturalagriculturedifferenteconomyfarmsfoodidaholandmillionprocessingproducesproductionrolesectorsignificant
SHARED TOKENS (16): "acres", "agricultural", "agriculture", "different", "economy", "farms", "food", "idaho", "land", "million", "processing", "produces", "production", "role", "sector", "significant".
0.300
agriculturebillioncapacitycentralchangesclimateconditionscontextcurrentdemanddevelopmentdifferenteconomicenvironmentalexpansionfunctionfutureincreaseinformationinfrastructure
SHARED TOKENS (39): "agriculture", "billion", "capacity", "central", "changes", "climate", "conditions", "context", "current", "demand", "development", "different", "economic", "environmental", "expansion", "function", "future", "increase", "information", "infrastructure"....
0.300
affectagricultureanalysisapplicationboundarydifferentedgehealthhydraulicinteractionlandlegislationmakingmanagementmeansmethodsmodelmonitoringon-siteproduces
SHARED TOKENS (32): "affect", "agriculture", "analysis", "application", "boundary", "different", "edge", "health", "hydraulic", "interaction", "land", "legislation", "making", "management", "means", "methods", "model", "monitoring", "on-site", "produces"....
0.300
affectingamongcapacitycleanconstructedconstructioncreatingdemanddirectelectricalenergyenvironmentalimpactlandlargemakingminutesnaturalpopulationpower
SHARED TOKENS (34): "affecting", "among", "capacity", "clean", "constructed", "construction", "creating", "demand", "direct", "electrical", "energy", "environmental", "impact", "land", "large", "making", "minutes", "natural", "population", "power"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalbusinesscommercialdatedevelopedearlyfacilitiesgrowthhomeimprovementsincreasingindependentlargelargerlibrarymaintainsmaterialsnationalolder
SHARED TOKENS (32): "active", "agricultural", "business", "commercial", "date", "developed", "early", "facilities", "growth", "home", "improvements", "increasing", "independent", "large", "larger", "library", "maintains", "materials", "national", "older"....
0.300
connectsconsumerscurrentdeliverydirectdirectlydistinctdistributioneasternelectricalenergyevenformhistoricallyincreaselevellineslocallowermajor
SHARED TOKENS (30): "connects", "consumers", "current", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "electrical", "energy", "even", "form", "historically", "increase", "level", "lines", "local", "lower", "major"....
0.300
actadabroadbusinesschangescivilcostscouncileffectivefinaljanuarylaterlawnationalprohibitsprovidepublicrequirementsrequiresrights
SHARED TOKENS (20): "act", "ada", "broad", "business", "changes", "civil", "costs", "council", "effective", "final", "january", "later", "law", "national", "prohibits", "provide", "public", "requirements", "requires", "rights".
0.300
Traffic light ↗ Q8004 KW CROSS HIGH
advancedcapacitycompetingcontrolflowsinformationlevellocalnationalneedreduceroadsignalssouthsystemsystemsusers
SHARED TOKENS (17): "advanced", "capacity", "competing", "control", "flows", "information", "level", "local", "national", "need", "reduce", "road", "signals", "south", "system", "systems", "users".
0.300
buildingcircumstancesconditionscontainingcreatesenvironmentevenhealthmaterialspersonnelphysicalpropertypublicregulationssafetyspecificsubjectsystemthemtrained
SHARED TOKENS (21): "building", "circumstances", "conditions", "containing", "creates", "environment", "even", "health", "materials", "personnel", "physical", "property", "public", "regulations", "safety", "specific", "subject", "system", "them", "trained"....
0.300
announcedapprovedbillionclasscreateitselflatermilesnetworkoperatesoperatingpacificplansprincipalprojectroadsystemtransportationunionwest
SHARED TOKENS (21): "announced", "approved", "billion", "class", "create", "itself", "later", "miles", "network", "operates", "operating", "pacific", "plans", "principal", "project", "road", "system", "transportation", "union", "west"....
0.300
actaddressesaddressingagenciesagreementagreementscleanclimatecomplianceconcerningcontroldesigneddevelopmenteconomicenergyenforcementenvironmentenvironmentalestablishgrowth
SHARED TOKENS (44): "act", "addresses", "addressing", "agencies", "agreement", "agreements", "clean", "climate", "compliance", "concerning", "control", "designed", "development", "economic", "energy", "enforcement", "environment", "environmental", "establish", "growth"....
0.300
accessactadditionaladministrationapproximatelybeganbillionbuiltcompleteconstructioncontinuedcontrolledcostcreatingdesigndesigneddevelopedestablishedextendsfederal
SHARED TOKENS (47): "access", "act", "additional", "administration", "approximately", "began", "billion", "built", "complete", "construction", "continued", "controlled", "cost", "creating", "design", "designed", "developed", "established", "extends", "federal"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcommercialdeterminemanufacturingmeasuremeasurementpracticeprocesspublicregisterrequirementsresidentialstandardssuppliedsupplysystemwaterworks
SHARED TOKENS (19): "association", "building", "commercial", "determine", "manufacturing", "measure", "measurement", "practice", "process", "public", "register", "requirements", "residential", "standards", "supplied", "supply", "system", "water", "works".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
administrationanalysisanotherbroaderbuiltbusinesscapitalcategorycivilcodescommunicationscommunitycreatingdesigndevelopingdevelopmentdifferentdistributionearlyeconomic
SHARED TOKENS (65): "administration", "analysis", "another", "broader", "built", "business", "capital", "category", "civil", "codes", "communications", "community", "creating", "design", "developing", "development", "different", "distribution", "early", "economic"....
0.300
accordinganalysisbecomesboundariesdesigndocumentationengineerengineeringengineersenvironmentestablishedgeneralgovernmentlegallegislationlicenselicensedlicensurelocalmaintenance
SHARED TOKENS (45): "according", "analysis", "becomes", "boundaries", "design", "documentation", "engineer", "engineering", "engineers", "environment", "established", "general", "government", "legal", "legislation", "license", "licensed", "licensure", "local", "maintenance"....
0.300
actagenciesagencyapplyauthoritycouncilcreateddecisionsdesignedenactedenvironmentenvironmentalestablishedfederalfinalgovernmentimpactimpactsjanuarylaw
SHARED TOKENS (35): "act", "agencies", "agency", "apply", "authority", "council", "created", "decisions", "designed", "enacted", "environment", "environmental", "established", "federal", "final", "government", "impact", "impacts", "january", "law"....
0.300
accessalreadybestcannotcleancommunicationscompetingcontrolcostsdifferentenergyentityessentialfederalfrequentlygovernmentinfrastructureissuelargelines
SHARED TOKENS (40): "access", "already", "best", "cannot", "clean", "communications", "competing", "control", "costs", "different", "energy", "entity", "essential", "federal", "frequently", "government", "infrastructure", "issue", "large", "lines"....
0.300
actaffectagriculturalanotherapplicationsclimatecommercialcurrentdemanddevelopmentfuturegrowthimprovementsirrigationlevellocalmakesmanagemanagementmanufacturing
SHARED TOKENS (37): "act", "affect", "agricultural", "another", "applications", "climate", "commercial", "current", "demand", "development", "future", "growth", "improvements", "irrigation", "level", "local", "makes", "manage", "management", "manufacturing"....
0.300
civilengineeringinvolvingnetworktransportation
SHARED TOKENS (5): "civil", "engineering", "involving", "network", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.300
adaboisecentralconnectedcontainseasternidahoitselfmetropolitannationalpopulationrecreationruralsectionstarvalleywestern
SHARED TOKENS (17): "ada", "boise", "central", "connected", "contains", "eastern", "idaho", "itself", "metropolitan", "national", "population", "recreation", "rural", "section", "star", "valley", "western".
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganotherapplicationscanalcanalscontainingcriticalcustomerdemanddesigndesigneddevelopmentdifferentdrainageenergyenvironmentalequipmentessentialfacilities
SHARED TOKENS (48): "agricultural", "allowing", "another", "applications", "canal", "canals", "containing", "critical", "customer", "demand", "design", "designed", "development", "different", "drainage", "energy", "environmental", "equipment", "essential", "facilities"....
0.300
addressingaffectagriculturalagriculturecentralchangesclimateconcentrateddevelopmentdirectdischargedownstreameconomicenterenvironmentenvironmentalfertilizerfoodimpactimpacts
SHARED TOKENS (38): "addressing", "affect", "agricultural", "agriculture", "central", "changes", "climate", "concentrated", "development", "direct", "discharge", "downstream", "economic", "enter", "environment", "environmental", "fertilizer", "food", "impact", "impacts"....
0.300
civilconstructiondesignengineeringengineersflowsfuturemaintenancematerialsoperationplanningprofessionalstandardsstreetsstructuraltransportation
SHARED TOKENS (16): "civil", "construction", "design", "engineering", "engineers", "flows", "future", "maintenance", "materials", "operation", "planning", "professional", "standards", "streets", "structural", "transportation".
0.300
additionaladvancedagenciesbeganbusinessescontactcorpsdepartmentdevelopingemergencyfacilitieshistoricallymodeloperatepartspersonnelplacesprimaryprovideproviding
SHARED TOKENS (32): "additional", "advanced", "agencies", "began", "businesses", "contact", "corps", "department", "developing", "emergency", "facilities", "historically", "model", "operate", "parts", "personnel", "places", "primary", "provide", "providing"....
0.300
acresboisecanalcapacitycomponentsdesigneddistrictembankmentsidahoirrigationlowernampanationalplaceplacesprogramprojectprovideregisterriver
SHARED TOKENS (24): "acres", "boise", "canal", "capacity", "components", "designed", "district", "embankments", "idaho", "irrigation", "lower", "nampa", "national", "place", "places", "program", "project", "provide", "register", "river"....
0.300
Maize ↗ Q11575 KW CROSS HIGH
alongsideannualbecomebecomesbillioncommercialcontainsessentialfoodmajorpartsproducesproductionthroughouttreatmentuses
SHARED TOKENS (16): "alongside", "annual", "become", "becomes", "billion", "commercial", "contains", "essential", "food", "major", "parts", "produces", "production", "throughout", "treatment", "uses".
0.300
administrationagenciesamongchangescompliancecontrolcurrentdefinesdepartmentdesigndesigneddevelopeddocumentfederallawlocalnationalopenownedplacement
SHARED TOKENS (31): "administration", "agencies", "among", "changes", "compliance", "control", "current", "defines", "department", "design", "designed", "developed", "document", "federal", "law", "local", "national", "open", "owned", "placement"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
cannotconnectdesigndesigneddrainagedrainseveninfrastructureinsidelargemanagemunicipalparkspropertypublicreceiverequireresidentialsewerstreet
SHARED TOKENS (25): "cannot", "connect", "design", "designed", "drainage", "drains", "even", "infrastructure", "inside", "large", "manage", "municipal", "parks", "property", "public", "receive", "require", "residential", "sewer", "street"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdefinitionsdifferentformindividualloweroperateoperatesoperatingoperationsprimarilyright-of-wayrights-of-waysectionstreetssystemsystems
SHARED TOKENS (23): "broader", "capability", "capacity", "conditions", "definitions", "different", "form", "individual", "lower", "operate", "operates", "operating", "operations", "primarily", "right-of-way", "rights-of-way", "section", "streets", "system", "systems"....
0.300
agencycurrentdatadepartmentfederalgovernmentlandscapemajormakesmapsnaturalpublicregulatoryresearchresourcesresponsibilityspacestudysurveywhose
SHARED TOKENS (21): "agency", "current", "data", "department", "federal", "government", "landscape", "major", "makes", "maps", "natural", "public", "regulatory", "research", "resources", "responsibility", "space", "study", "survey", "whose"....
0.300
accessagreementsaloneamongassociatedavailabilitybecomebecomesbroadchangesclimateconditionsconflictscontrolcorporatecrossdescribingeasteconomicgovernment
SHARED TOKENS (54): "access", "agreements", "alone", "among", "associated", "availability", "become", "becomes", "broad", "changes", "climate", "conditions", "conflicts", "control", "corporate", "cross", "describing", "east", "economic", "government"....
0.300
accesscommunitycompletedesigndesignedeconomicengineersenvironmentalhealthhomeoperatedplannerspolicypractitionerspublicrequiressafetystreetstransportationurban
SHARED TOKENS (22): "access", "community", "complete", "design", "designed", "economic", "engineers", "environmental", "health", "home", "operated", "planners", "policy", "practitioners", "public", "requires", "safety", "streets", "transportation", "urban"....
0.300
actapprovalapprovalsapprovedbuildingcommercialconstructioncontextcontractorscostscreatesdesigndeterminedeveloperdevelopersdevelopmentdifferenteconomicengineersenvironmental
SHARED TOKENS (53): "act", "approval", "approvals", "approved", "building", "commercial", "construction", "context", "contractors", "costs", "creates", "design", "determine", "developer", "developers", "development", "different", "economic", "engineers", "environmental"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralchargesconnectingdifferentdistrictseastfeaturesinsidelinesmetropolitanoperateoperatesprimarilyregionalsystemsurban
SHARED TOKENS (17): "business", "central", "charges", "connecting", "different", "districts", "east", "features", "inside", "lines", "metropolitan", "operate", "operates", "primarily", "regional", "systems", "urban".
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscompletecompletedconnectedcurrenteasteasternestablishedfootformidahoimprovementslowermakingownerspartsriverseparateterritoryvalley
SHARED TOKENS (22): "business", "complete", "completed", "connected", "current", "east", "eastern", "established", "foot", "form", "idaho", "improvements", "lower", "making", "owners", "parts", "river", "separate", "territory", "valley"....
🫐 BERRY44 edges
0.280
createengineernaturaluses
SHARED TOKENS (4): "create", "engineer", "natural", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.280
conflictscreatingdepartmentdesigneddifferentdividedevenpathwaypermitprimaryprovidesurfaceurbanusers
SHARED TOKENS (14): "conflicts", "creating", "department", "designed", "different", "divided", "even", "pathway", "permit", "primary", "provide", "surface", "urban", "users".
0.280
agencyassociationidahointegrated
SHARED TOKENS (4): "agency", "association", "idaho", "integrated". | EXACT TITLE in water_rights: "Idaho State Bar".
0.280
actchaptercodedevelopmentenactedfederallawlegislationpowerprojectsregulationtimestitlewater
SHARED TOKENS (14): "act", "chapter", "code", "development", "enacted", "federal", "law", "legislation", "power", "projects", "regulation", "times", "title", "water".
0.260
agriculturalfullindustriallegalmerelyownershipperiodpriorrightssourcesystemuserswater
SHARED TOKENS (13): "agricultural", "full", "industrial", "legal", "merely", "ownership", "period", "prior", "rights", "source", "system", "users", "water".
0.260
collegecommunitydifferenteducationforminstitutionsopenpolicyprogramsseniortransferuniversityworkforce
SHARED TOKENS (13): "college", "community", "different", "education", "form", "institutions", "open", "policy", "programs", "senior", "transfer", "university", "workforce".
0.240
amongdetermineseasternlandlawownershippossesspropertyrightssimplysystemwater
SHARED TOKENS (12): "among", "determines", "eastern", "land", "law", "ownership", "possess", "property", "rights", "simply", "system", "water".
0.240
allowingdesigneddirectlyirrigationnetworkoperatedplacepotentialsurfacesystemsystemswater
SHARED TOKENS (12): "allowing", "designed", "directly", "irrigation", "network", "operated", "place", "potential", "surface", "system", "systems", "water".
0.240
accessconnectingdesignedformerlocalmajormoveprovideresidentialroadservesstreets
SHARED TOKENS (12): "access", "connecting", "designed", "former", "local", "major", "move", "provide", "residential", "road", "serves", "streets".
0.240
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeconstructionequipmentindustrialinfrastructurelargelegalordinaryroadspecifiedtransportationwater
SHARED TOKENS (12): "bridge", "construction", "equipment", "industrial", "infrastructure", "large", "legal", "ordinary", "road", "specified", "transportation", "water".
0.220
distributionfloodformirrigationmanagementpracticessignificantsurfacethereforethroughoutwater
SHARED TOKENS (11): "distribution", "flood", "form", "irrigation", "management", "practices", "significant", "surface", "therefore", "throughout", "water".
0.220
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
continuedeasteasternidaholimitedmilespriorsouthsystemwestwestern
SHARED TOKENS (11): "continued", "east", "eastern", "idaho", "limited", "miles", "prior", "south", "system", "west", "western".
0.220
containseastexpandedmajornorthwestpacificriversouthsouthwestwestwestern
SHARED TOKENS (11): "contains", "east", "expanded", "major", "northwest", "pacific", "river", "south", "southwest", "west", "western".
0.220
demanddistributionfailpressurereducedsignificantstoragesuppliessystemsystemswater
SHARED TOKENS (11): "demand", "distribution", "fail", "pressure", "reduced", "significant", "storage", "supplies", "system", "systems", "water".
0.220
controldistinctgoverninglawownershippropertyqualityregulationsresourceresourceswater
SHARED TOKENS (11): "control", "distinct", "governing", "law", "ownership", "property", "quality", "regulations", "resource", "resources", "water".
0.220
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherbuiltcanalcanalsexistingfloodnaturalprovideright-of-wayriverwater
SHARED TOKENS (11): "another", "built", "canal", "canals", "existing", "flood", "natural", "provide", "right-of-way", "river", "water".
0.220
departmentdepartmentsdirectlyeconomyfederalgovernmentplanreportsservingsystemtransportation
SHARED TOKENS (11): "department", "departments", "directly", "economy", "federal", "government", "plan", "reports", "serving", "system", "transportation".
0.220
boisecrosshomeidahomajormetropolitanmilesnorthwestprimarilyriverserves
SHARED TOKENS (11): "boise", "cross", "home", "idaho", "major", "metropolitan", "miles", "northwest", "primarily", "river", "serves".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in water_rights: "Subdivision". | EXACT TITLE in transportation_infrastructure: "Subdivision".
0.210
Alfalfa ↗ Q156106 EXACT TITLE
south
SHARED TOKENS (1): "south". | EXACT TITLE in water_rights: "Alfalfa".
0.200
Abandon ↗ Q397584 EXACT TITLE
abandonabandonedabandonment
EXACT TITLE in water_rights: "Abandon".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
forfeiture
EXACT TITLE in water_rights: "Forfeit".
0.200
applicationdesignengineeringfacilitiesmanagementoccupationaloperationplanningprovidetransportation
SHARED TOKENS (10): "application", "design", "engineering", "facilities", "management", "occupational", "operation", "planning", "provide", "transportation".
0.180
Garden City, Idaho ↗ KW CROSS HIGH
adaboisegovernmentidahometropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (9): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate", "street".
0.180
Park and ride ↗ Q738031 KW CROSS HIGH
connectionslargemarketingmetropolitanpoolpublicroadsystemtransfer
SHARED TOKENS (9): "connections", "large", "marketing", "metropolitan", "pool", "public", "road", "system", "transfer".
0.180
Water table ↗ Q3342272 KW CROSS HIGH
increasinglevellowermaterialspressuresimplysurfaceuntilwater
SHARED TOKENS (9): "increasing", "level", "lower", "materials", "pressure", "simply", "surface", "until", "water".
0.180
creatingeffectiveequipmentirrigationlandlargesectionsystemswater
SHARED TOKENS (9): "creating", "effective", "equipment", "irrigation", "land", "large", "section", "systems", "water".
0.160
canyonconnectingeastidahomeridiannamparivervalley
SHARED TOKENS (8): "canyon", "connecting", "east", "idaho", "meridian", "nampa", "river", "valley".
0.160
establishedfoodidaholegislaturemakingpopulationregionsource
SHARED TOKENS (8): "established", "food", "idaho", "legislature", "making", "population", "region", "source".
0.160
bodycountiesgoverninglegallimitedlocalmunicipalowned
SHARED TOKENS (8): "body", "counties", "governing", "legal", "limited", "local", "municipal", "owned".
0.160
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentrypermittedresearchroadsafetyshows
SHARED TOKENS (8): "businesses", "economic", "entry", "permitted", "research", "road", "safety", "shows".
0.140
associatedhistoryidahonorthwestpacificwestwestern
SHARED TOKENS (7): "associated", "history", "idaho", "northwest", "pacific", "west", "western".
0.140
demandenvironmentalphysicalpracticesuppliessurfacewater
SHARED TOKENS (7): "demand", "environmental", "physical", "practice", "supplies", "surface", "water".
0.140
agencycontinuingdepartmentfederalgovernmentmanagementnatural
SHARED TOKENS (7): "agency", "continuing", "department", "federal", "government", "management", "natural".
0.140
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahometropolitannampapopulationwilder
SHARED TOKENS (7): "boise", "canyon", "idaho", "metropolitan", "nampa", "population", "wilder".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahometropolitanpopulationrural
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "population", "rural".
0.120
linesownershipprivatepropertypublicresources
SHARED TOKENS (6): "lines", "ownership", "private", "property", "public", "resources".
0.120
finalidahoincorporatedterritoryunionuntil
SHARED TOKENS (6): "final", "idaho", "incorporated", "territory", "union", "until".
0.120
commerciallargelicensematerialsoperateparts
SHARED TOKENS (6): "commercial", "large", "license", "materials", "operate", "parts".
0.100
adaconnectingcountiesidahostar
SHARED TOKENS (5): "ada", "connecting", "counties", "idaho", "star".
0.100
commercialenvironmentlandphysicalprocess
SHARED TOKENS (5): "commercial", "environment", "land", "physical", "process".
0.100
costsitselfreducedroadtransportation
SHARED TOKENS (5): "costs", "itself", "reduced", "road", "transportation".
0.100
Melba, Idaho ↗ Q522047 KW CROSS HIGH
boisecanyonidahometropolitanpopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "metropolitan", "population".
0.100
canyonestablishedidahometropolitanpopulation
SHARED TOKENS (5): "canyon", "established", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Water Rights × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How do irrigation water rights affect road and highway planning in the Treasure Valley?
Irrigation districts in the Treasure Valley hold senior water rights along the Snake River that predate most modern transportation corridors, requiring civil engineers to design highways and bridges around established canal systems rather than through them. The United States Army Corps of Engineers coordinates with local irrigation authorities when transportation projects near the Snake River to ensure water conveyance infrastructure remains unobstructed. Right of way acquisition for new roads in Ada and surrounding counties often requires negotiating with irrigation entities that control both water and the land adjacent to transportation routes.
What role does the Clean Water Act play in Treasure Valley transportation projects near water sources?
Transportation development in Boise and Nampa must comply with Clean Water Act standards administered by the United States Environmental Protection Agency, which regulates stormwater runoff from highways and bridges that could contaminate water sources used for irrigation. Civil engineering firms designing transportation infrastructure in the Treasure Valley must conduct water quality assessments and implement erosion control measures to protect irrigation intakes along the Snake River and tributary systems. The EPA's oversight ensures that highway expansion and urban sprawl do not degrade water resources that support both agricultural water rights holders and metropolitan populations.
How does surveying impact the intersection of water rights claims and transportation right of way in the Treasure Valley?
Surveyors in Ada County and the Treasure Valley must accurately map both water rights boundaries and transportation corridors to prevent conflicts between irrigation easements and highway right of way designations. Precise surveying data determines whether transportation infrastructure projects in Boise, Nampa, and surrounding areas will encroach on water delivery systems or require relocation of existing irrigation infrastructure. The zoning process in Treasure Valley municipalities depends on survey records that document water rights locations, allowing planners to route new transportation networks away from senior water interests.
Why do transportation projects in the Treasure Valley require coordination with water rights holders?
Urban sprawl from Boise east and west across the Treasure Valley frequently requires transportation corridors to cross or run parallel to irrigation canals and water conveyance systems that are protected under Idaho water law. The Army Corps of Engineers and state civil engineering departments mandate consultation with irrigation districts when designing bridges, roads, and public infrastructure to prevent interference with water delivery during construction and operation. Boise State University and regional planning agencies have documented that coordinated planning between water rights authorities and transportation agencies reduces project costs and environmental impacts in the metropolitan Treasure Valley area.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Water Rights × Transportation Infrastructure 25 QID bridges 241 edges 6,343 ext links 2026-07-18 00:01:50 UTC 2d00668b58e17111
Water Rights corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Water Rights ↗ boisestandard.org/standard ↗
Parent Corridors
Water Rights × All Other Verticals