—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Water Rights ↔ relates to ↔ Mortgage Lending

20 Wikipedia bridge articles confirmed in both vertical ledgers. 266 deterministic cross-vertical edges. 6,388 external source links harvested. Every edge provenance-stamped. Every claim auditable.

20 QID Bridge Articles
266 Cross Edges
6,388 External Sources
298 Wikipedia Articles
21 🌲 Evergreen
188 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Water Rights
× Mortgage Lending
QID Bridge Articles
20
confirmed Wikipedia overlap
Total Cross Edges
266
External Sources Harvested
6,388
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (20)
Boise State UniversityWellGroundwaterZoningTreasure ValleyEasementReal estateWater rightBoise RiverUrban sprawlNampa, IdahoEagle, IdahoReal estate developmentAda County, IdahoBoise, IdahoCaldwell, IdahoSubdivisionCanyon County, IdahoKuna, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationlandmetropolitanpublicpropertyadaenvironmentalwaterdifferentresidentialurbanamongcollegewestcommonresourcesusesagricultural
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:59:09 UTC
Content Hash
05cae2323cfb7643
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
20 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (18): "among", "boise", "business", "college", "degrees", "division", "education", "idaho", "independent", "institution", "junior", "member", "program", "programs", "public", "research", "university", "west". | URL->B (1): https://boisestate.edu/. | EXACT TITLE in water_rights: "Boise State University". | EXACT TITLE in mortgage_lending: "Boise State University".
amongboisebusinesscollegedegreesdivisioneducationidahoindependentinstitutionjuniormemberprogramprogramspublicresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Well
Q43483 EXACT TITLE 1.000
QID OVERLAP: Q43483 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (30): "access", "another", "begins", "common", "completed", "constructed", "construction", "contains", "contamination", "create", "date", "environmental", "historically", "least", "modern", "point", "potential", "provide", "require", "resources".... | EXACT TITLE in water_rights: "Well". | EXACT TITLE in mortgage_lending: "Well".
accessanotherbeginscommoncompletedconstructedconstructioncontainscontaminationcreatedateenvironmentalhistoricallyleastmodernpointpotentialproviderequireresourcesruralsitesourcesstructuresupplysurroundingtreatmentuseswaterwells
A well is an excavation or structure created on the earth by digging, driving, or drilling to access liquid resources, usually water. The oldest and most common kind of well is a water well, to access groundwater in underground aquifers. The well water is drawn up by a pump, or using containers, such as buckets that are raised mechanically or by hand. Water can also be injected back into the aquifer through the well. Wells were first constructed at least eight thousand years ago and historically vary in construction from a sediment of a dry watercourse to the qanats of Iran, and the stepwells and sakiehs of India. Placing a lining in the well shaft helps create stability, and linings of wood or wickerwork date back at least as far as the Iron Age. Wells have traditionally been sunk by hand digging, as is still the case in rural areas of the developing world. These wells are inexpensive and low-tech as they use mostly manual labour, and the structure can be lined with brick or stone as the excavation proceeds. A more modern method called caissoning uses pre-cast reinforced concrete well rings that are lowered into the hole. Driven wells can be created in unconsolidated material with a well hole structure, which consists of a hardened drive point and a screen of perforated pipe, after which a pump is installed to collect the water. Deeper wells can be excavated by hand drilling methods or machine drilling, using a bit in a borehole. Drilled wells are usually cased with a factory-made pipe composed of steel or plastic. Drilled wells can access water at much greater depths than dug wells. Two broad classes of well are shallow or unconfined wells completed within the uppermost saturated aquifer at that location, and deep or confined wells, sunk through an impermeable stratum into an aquifer beneath. A collector well can be constructed adjacent to a freshwater lake or stream with water percolating through the intervening material. The site of a well can be selected by a hydrogeologist, or groundwater surveyor. Water may be pumped or hand drawn. Impurities from the surface can easily reach shallow sources and contamination of the supply by pathogens or chemical contaminants needs to be avoided. Well water typically contains more minerals in solution than surface water and may require treatment before being potable. Soil salination can occur as the water table falls and the surrounding soil begins to dry out.
ells can be excavated by hand drilling methods or machine drilling, using a bit in a borehole. Drilled wells are usually cased with a factory-made pipe composed of steel or plastic. Drilled wells can access water at much greater depths than dug wells. Two broad classes of well are shallow or unconfined wells completed within the uppermost saturated aquifer at that location, and deep or confined wells, sunk through an impermeable stratum into an aquifer beneath. A collector well can be constructed adjacent to a freshwater lake or stream with water percolating through the intervening material. The site of a well can be selected by a hydrogeologist, or groundwater surveyor. Water may be pumped or hand drawn. Impurities from the surface can easily reach shallow sources and contamination of the supply by pathogens or chemical contaminants needs to be avoided. Well water typically contains more minerals in solution than surface water and may require treatment before being potable. Soil salination can occur as the water table falls and the surrounding soil begins to dry out.
Until recent centuries, all artificial wells were pumpless hand-dug wells of varying degrees of sophistication, and they remain a very important source of potable water in some rural developing areas, where they are routinely dug and used today. Their indispensability has produced a number of literary references, literal and figurative, including the reference to the incident of Jesus meeting a woman at Jacob's well (John 4:6) in the Bible and the "Ding Dong Bell" nursery rhyme about a cat in a well. Hand-dug wells are excavations with diameters large enough to accommodate one or more people with shovels digging down to below the water table. The excavation is braced horizontally to avoid landslide or erosion endangering the people digging. They can be lined with stone or brick; extending this lining upwards above the ground surface to form a wall around the well serves to reduce both contamination and accidental falls into the well. A more modern method called caissoning uses reinforced concrete or plain concrete pre-cast well rings that are lowered into the hole. A well-digging team digs under a cutting ring and the well column slowly sinks into the aquifer, whilst protecting the team from collapse of the well bore. Hand-dug wells are inexpensive and low tech (compared to drilling) and they use mostly manual labour to access groundwater in rural locations of developing countries. They may be built with a high degree of community participation, or by local entrepreneurs who specialize in hand-dug wells. They have been successfully excavated to 60 metres (200 ft). They have low operational and maintenance costs, in part because water can be extracted by hand, without a pump. The water often comes from an aquifer or groundwater, and can be easily deepened, which may be necessary if the ground water level drops, by telescoping the lining further down into the aquifer. The yield of existing hand dug wells may be improved by deepening or introducing vertical tunnels or perforated pipes. Drawbacks to hand-dug wells are numerous. It can be impractical to hand dig wells in areas where hard rock is present, and they can be time-consuming to dig and line even in favourable areas. Because they exploit shallow aquifers, the well may be susceptible to yield fluctuations and possible contamination from surface water, including sewage. Hand dug well construction generally requires the use of a well trained construction team, and the capital investment for equipment such as concrete ring moulds, heavy lifting equipment, well shaft formwork, motorized de-watering pumps, and fuel can be large for people in developing countries. Construction of hand dug wells can be dangerous due to collapse of the well bore, falling objects and asphyxiation, including from dewatering pump exhaust fumes. The Woodingdean Water Well, hand-dug between 1858 and 1862, is the deepest hand-dug well at 392 metres (1,285 ft). The Big Well in Greensburg, Kansas, is billed as the world's largest hand-dug well, at 109 feet (33 m) deep and 32 feet (9.8 m) in diameter. However, the Well of Joseph in the Cairo Citadel at 280 feet (85 m) deep and the Pozzo di San Patrizio (St.
Groundwater
Q161598 EXACT TITLE 1.000
QID OVERLAP: Q161598 in water_rights (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (37): "agricultural", "agriculture", "become", "billion", "capacity", "central", "change", "commonly", "contains", "distribution", "environmental", "form", "formation", "geothermal", "industrial", "land", "loss", "municipal", "operating", "percent".... | EXACT TITLE in water_rights: "Groundwater".
agriculturalagriculturebecomebillioncapacitycentralchangecommonlycontainsdistributionenvironmentalformformationgeothermalindustriallandlossmunicipaloperatingpercentprimaryprocessprovidepublicresultssepticsolelysourcesourcesstudy+7
d the water table. Groundwater is recharged from the surface; it may discharge from the surface naturally at springs and seeps, and can form oases or wetlands. Groundwater is also often withdrawn for agricultural, municipal, and industrial use by constructing and operating extraction wells. The study of the distribution and movement of groundwater is hydrogeology, also called groundwater hydrology. Typically, groundwater is thought of as water flowing through shallow aquifers, but, in the technical sense, it can also contain soil moisture, permafrost (frozen soil), immobile water in very low permeability bedrock, and deep geothermal or oil formation water. Groundwater is hypothesized to provide lubrication that can possibly influence the movement of faults. It is likely that much of Earth's subsurface contains some water, which may be mixed with other fluids in some instances. Groundwater is often cheaper, more convenient and less vulnerable to pollution than surface water. Therefore, it is commonly used for public drinking water supplies. For example, groundwater provides the largest source of usable water storage in the United States, and California annually withdraws the largest amount of groundwater of all the states. Underground reservoirs contain far more water than the capacity of all surface reservoirs and lakes in the US, including the Great Lakes. Many municipal water supplies are derived solely from groundwater. Over 2 billion people rely on it as their primary water source worldwide. Human use of groundwater causes environmental problems. For example, polluted groundwater is less visible and more difficult to clean up than pollution in rivers and lakes. Groundwater pollution most often results from improper disposal of wastes on land. Major sources include industrial and household chemicals and garbage landfills, excessive fertilizers and pesticides used in agriculture, industrial waste lagoons, tailings and process wastewater from mines, industrial fracking, oil field brine pits, leaking underground oil storage tanks and pipelines, sewage sludge and septic systems. Additionally, groundwater is susceptible to saltwater intrusion in coastal areas and can cause land subsidence when extracted unsustainably, leading to sinking cities (like Bangkok) and loss in elevation (such as the multiple meters lost in the Central Valley of California). These issues are made more complicated by sea level rise and other effects of climate change, particularly those on the water cycle.
Quantities Groundwater is the most accessed source of freshwater around the world, including as drinking water, irrigation, and manufacturing. Groundwater accounts for about half of the world's drinking water, 40% of its irrigation water, and a third of water for industrial purposes. Another estimate stated that globally groundwater accounts for about one third of all water withdrawals, and surface water for the other two thirds. Groundwater provides drinking water to at least 50% of the global population. About 2.5 billion people depend solely on groundwater resources to satisfy their basic daily water needs. A similar estimate was published in 2021 which stated that "groundwater is estimated to supply between a quarter and a third of the world's annual freshwater withdrawals to meet agricultural, industrial and domestic demands." Global freshwater withdrawal was probably around 600 km3 per year in 1900 and increased to 3,880 km3 per year in 2017. The rate of increase was especially high (around 3% per year) during the period 1950–1980, partly due to a higher population growth rate, and partly to rapidly increasing groundwater development, particularly for irrigation. The rate of increase is (as per 2022) approximately 1% per year, in tune with the current population growth rate. Global groundwater depletion has been calculated to be between 100 and 300 km3 per year. This depletion is mainly caused by "expansion of irrigated agriculture in drylands". The Asia-Pacific region is the largest groundwater abstractor in the world, containing seven out of the ten countries that extract most groundwater (Bangladesh, China, India, Indonesia, Iran, Pakistan and Turkey).
Municipal and industrial water supplies are provided through large wells. Multiple wells for one water supply source are termed "wellfields", which may withdraw water from confined or unconfined aquifers. Using groundwater from deep, confined aquifers provides more protection from surface water contamination. Some wells, termed "collector wells", are specifically designed to induce infiltration of surface (usually river) water. Aquifers that provide sustainable fresh groundwater to urban areas and for agricultural irrigation are typically close to the ground surface (within a couple of hundred metres) and have some recharge by fresh water. This recharge is typically from rivers or meteoric water (precipitation) that percolates into the aquifer through overlying unsaturated materials. In cases where the groundwater has unacceptable levels of salinity or specific ions, desalination is a common treatment,.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (29): "building", "common", "determine", "developed", "development", "different", "exceptions", "form", "government", "growth", "industrial", "land", "land-use", "local", "nature", "places", "planning", "policy", "property", "regulations".... | EXACT TITLE in water_rights: "Zoning". | EXACT TITLE in mortgage_lending: "Zoning".
buildingcommondeterminedevelopeddevelopmentdifferentexceptionsformgovernmentgrowthindustriallandland-uselocalnatureplacesplanningpolicypropertyregulationsregulatoryresidentialrulesshapesinglesystemsurbanuseszoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
(e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
pment may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "primarily", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanprimarilyregionresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Easement
Q448405 EXACT TITLE 1.000
QID OVERLAP: Q448405 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (18): "access", "among", "another", "best", "common", "easements", "enter", "itself", "land", "law", "privately", "property", "public", "purpose", "real", "rights", "road", "stated". | EXACT TITLE in water_rights: "Easement". | EXACT TITLE in mortgage_lending: "Easement".
accessamonganotherbestcommoneasementsenteritselflandlawprivatelypropertypublicpurposerealrightsroadstated
ated purpose. For example, an easement may allow someone to use a road on their neighbor's land to get to their own.' Another example is someone's right to fish in a privately owned pond, or to have access to a public beach. The rights of an easement holder vary substantially among jurisdictions. Types Historically, common law courts would enforce only four types of easements: Easements of way (also known as Right-of-way) Easements of support (pertaining to excavations) Easements of "light and air" Rights pertaining to artificial waterways Courts now recognize more varieties of easements, but these original four categories still form the foundation of easement law.
As defined by Evershed MR in Re Ellenborough Park [1956] Ch 131, an easement requires the existence of at least two pieces of land. The land with the benefit of the easement is the dominant estate or dominant tenement, while the land burdened by the easement is the servient estate or servient tenement. For example, the owner of parcel A holds an easement to use a driveway on parcel B to gain access to A's house. Here, parcel A is the dominant estate, receiving the benefit, and parcel B is the servient estate, granting the benefit or suffering the burden. Public or private A private easement is held by private individuals or entities.
Appurtenant or in gross In the US, an easement appurtenant is one that benefits the dominant estate and "runs with the land" and so generally transfers automatically when the dominant estate is transferred. An appurtenant easement allows property owners to access land that is only accessible through a neighbor's land. Conversely, an easement in gross benefits an individual or a legal entity, rather than a dominant estate. The easement can be for a personal use (for example, an easement to use a boat ramp) or a commercial use (for example, an easement to a railroad company to cross property to build and maintain a rail line). Historically, an easement in gross was neither assignable nor inheritable, but commercial easements are now freely transferable to a third party. They are divisible but must be exclusive (the original owner no longer uses it and exclusive to easement holder) and all holders of the easement must agree to divide.
R
Q684740 EXACT TITLE 1.000
QID OVERLAP: Q684740 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (24): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "government", "intended", "land", "law", "legal", "nature", "nonprofit", "ownership", "private", "property", "public", "purpose", "real".... | EXACT TITLE in water_rights: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
acquisitionbusinesscommercialdifferententityestategeneralgovernmentintendedlandlawlegalnaturenonprofitownershipprivatepropertypublicpurposerealresidentialresourcesstatuswater
lic. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S. state. History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes.
ats, jewelry, furniture, tools, and the rolling stock of a farm and farm animals. The term real estate includes any land and buildings under private ownership, public (state) ownership or commercial (business) ownership. The purpose or usage of the real estate in question may differ from its ownership status. The property may be for residential or commercial use, used by the state, government or the general public. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S.
History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes. Internet real estate as a concept began with the first appearance of real estate platforms on the World Wide Web (www) and occurred in 1999. Residential real estate Residential real estate may contain either a single-family or multifamily structure that is available for occupation or for non-business purposes. Residences can be classified by how they are connected to neighbouring residences and land. Different types of housing tenure can be used for the same physical type. For example, connected residences might be owned by a single entity and leased out, or owned separately with an agreement covering the relationship between units and common areas and concerns. According to the Congressional Research Service, in 2021, 65% of homes in the U.S.
W
Q7973730 EXACT TITLE 0.880
QID OVERLAP: Q7973730 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (9): "different", "generally", "irrigation", "law", "legal", "physical", "source", "systems", "water". | EXACT TITLE in water_rights: "Water right". | EXACT TITLE in mortgage_lending: "Water right".
differentgenerallyirrigationlawlegalphysicalsourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in water_rights (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in water_rights: "Boise River".
agriculturalapproximatelyboiseidahourbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (36): "agency", "associated", "become", "building", "commercial", "core", "costs", "currently", "described", "development", "environmental", "existing", "expansion", "form", "geographic", "growth", "increased", "industrial", "infrastructure", "land"....
agencyassociatedbecomebuildingcommercialcorecostscurrentlydescribeddevelopmentenvironmentalexistingexpansionformgeographicgrowthincreasedindustrialinfrastructurelandlargelossmodernplanningpopulationprivatepropertyprotectionrapidreliance+6
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Another prominent form of retail development in areas characterized by sprawl is the shopping mall. Unlike the strip mall, this is usually composed of a single building surrounded by a parking lot that contains multiple shops, usually "anchored" by one or more department stores. The function and size is also distinct from the strip mall. The focus is almost exclusively on recreational shopping rather than daily goods. Shopping malls also tend to serve a wider (regional) public and require higher-order infrastructure such as highway access and can have floorspaces in excess of 1 million sq ft (93,000 m2). Shopping malls are often detrimental to downtown shopping centres of nearby cities since the shopping malls act as a surrogate for the city centre. Some downtowns have responded to this challenge by building shopping centres of their own. Fast food chains are often built early in areas with low property values where the population is expected to boom and where large traffic is predicted, and set a precedent for future development. Eric Schlosser, in his book Fast Food Nation, argues that fast food chains accelerate suburban sprawl and help set its tone with their expansive parking lots, flashy signs, and plastic architecture (65). Duany Plater Zyberk & Company believe that this reinforces a destructive pattern of growth in an endless quest to move away from the sprawl that only results in creating more of it. Effects Environmental One of the major environmental problems associated with urban sprawl is land consumption, habitat loss, land pollution, subsequent reduction in biodiversity and destruction of local ecosystems. A review by Brian Czech and colleagues, finds that urbanization endangers more species and is more geographically ubiquitous in the mainland United States than any other human activity. Urban sprawl is disruptive to native flora & fauna and introduces invasive plants into their environments, which are considered to be harmful to local biomes. Although the effects can be mitigated through careful maintenance of native vegetation, the process of ecological succession and public education, sprawl represents one of the primary threats to biodiversity. Regions with high birth rates and immigration are therefore faced with environmental problems due to unplanned urban growth and emerging megacities such as Kolkata, Shenzen, and Chongqing. Unregulated urban sprawl in these areas contributes to severe pollution, resource depletion, and ecosystem degradation. For instance, Kolkata's expansion has led to extensive deforestation and wetland destruction, endangering biodiversity and increasing flood risks. Additionally, Chongqing, as one of China's fastest-growing urban centers. struggles with severe air pollution due to its reliance on coal-powered industries, with particulate matter (PM2.5) levels often exceeding World Health Organization safety limits. The rapid expansion of urban infrastructure in such megacities increases greenhouse gas emissions, with transportation and construction sectors contributing significantly to climate change.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (16): "according", "boise", "canyon", "college", "footprint", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegefootprinthomeidahomeridianmetropolitannampanorthwestpopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Eagle, Idaho
Q1516870 EXACT TITLE 0.800
QID OVERLAP: Q1516870 in water_rights (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
adaboiseidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
Real estate development
Q695829 QID OVERLAP 0.800
QID OVERLAP: Q695829 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (44): "act", "approval", "approvals", "approved", "assume", "building", "commercial", "construction", "context", "costs", "creates", "determine", "development", "different", "engineers", "environmental", "estate", "existing", "financing", "growth"....
actapprovalapprovalsapprovedassumebuildingcommercialconstructioncontextcostscreatesdeterminedevelopmentdifferentengineersenvironmentalestateexistingfinancinggrowthincreaselandmanagemarketingobtainpermitsplaceplanningplanspotential+14
ersee construction or renovation. Developers usually take significant financial risks in the creation or renovation of real estate and receive the greatest rewards. Typically, developers purchase a tract of land, determine the marketing of the property, develop the building program and design, obtain the necessary public approval and financing, build the structures, and rent out, manage, and ultimately sell it. Real estate development has been criticized for contributing to urban sprawl and environmental degradation. Supporters argue that development expands housing supply, reduces housing costs, stimulates economic growth and creates jobs.
Some developers only handle part of the process. For example, some developers source a property and get the plans and permits approved before selling the property with the plans and permits to a builder at a premium price. Alternatively, a developer who is also a builder may purchase a property with the plans and permits in place so that they do not have the risk of failing to obtain planning approval and can start construction on the development immediately. Financial difficulties in development and investing differ because of leverage. Developers work with many different counterparts along each step of this process, including architects, city planners, engineers, surveyors, inspectors, contractors, lawyers, leasing agents, etc. In the Town and Country Planning context in the United Kingdom, “development” is defined in the Town and Country Planning Act 1990 s55. Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in water_rights (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "pacific", "population", "private".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlocalmetropolitannorthwestpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "counties", "east", "estimated", "home", "idaho", "locally", "metropolitan", "population", "treasure", "valley".
adaannualboisecapitalcountieseastestimatedhomeidaholocallymetropolitanpopulationtreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
S
Q1179955 EXACT TITLE 0.710
QID OVERLAP: Q1179955 in water_rights (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (1): "subdivision". | EXACT TITLE in water_rights: "Subdivision". | EXACT TITLE in mortgage_lending: "Subdivision".
subdivision
Subdivision may refer to: Arts and entertainment Subdivision (metre), in music Subdivision (film), 2009 "Subdivision", an episode of Prison Break (season 2) Subdivisions (EP), by Sinch, 2005 "Subdivisions" (song), by Rush, 1982
Science, technology and mathematics Subdivision (rank), a taxonomic rank Subdivision (botany), or subphylum, a taxonomic rank Subdivision (graph theory), adding new vertices to some edges of a graph, whereby replacing the edges by paths Subdivision (simplicial complex) Subdivision (simplicial set) Subdivision surface, in computer graphics Other uses Subdivision, an administrative division, a portion of a country Subdivision (India), an administrative division in India Subdivision (land), the act of dividing land into smaller pieces
Other uses Subdivision, an administrative division, a portion of a country Subdivision (India), an administrative division in India Subdivision (land), the act of dividing land into smaller pieces See also All pages with titles containing Subdivision All pages with titles beginning with Subdivision Division (disambiguation)
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in water_rights (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
246 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP246 edges
🌲 EVERGREEN1 edges
0.650
adaboisebureaucompletedconstructioncontroldirectlyeastengineersfederalfloodformsidahoirrigationoperatingoperationalprimarilyprimaryprivatepurpose
SHARED TOKENS (22): "ada", "boise", "bureau", "completed", "construction", "control", "directly", "east", "engineers", "federal", "flood", "forms", "idaho", "irrigation", "operating", "operational", "primarily", "primary", "private", "purpose".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
🌿 BRANCH188 edges
0.500
applicationsbankbankingbecomecomplianceconsumerdependsdevelopeddirectestatefeesfinanceindividualinstitutionsjurisdictionlendermarketspaidrealregulated
SHARED TOKENS (23): "applications", "bank", "banking", "become", "compliance", "consumer", "depends", "developed", "direct", "estate", "fees", "finance", "individual", "institutions", "jurisdiction", "lender", "markets", "paid", "real", "regulated".... | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
amongapproximatelyboisedivisionestablishedidaholateroperatesprimarilyproductionprofessionalpublicresearchruralschoolsstatewideuniversity
SHARED TOKENS (17): "among", "approximately", "boise", "division", "established", "idaho", "later", "operates", "primarily", "production", "professional", "public", "research", "rural", "schools", "statewide", "university". | EXACT TITLE in water_rights: "University of Idaho".
0.500
announcedboiseconstructedhomeidahooperationspersonnelplacepopulationprimaryprovidesouthwestsupporttrainingwestern
SHARED TOKENS (15): "announced", "boise", "constructed", "home", "idaho", "operations", "personnel", "place", "population", "primary", "provide", "southwest", "support", "training", "western". | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.500
additionalagenciesassetsbankbankingbeyondbillioncommercialcommunitydecisionsdefinitionsfederalgovernmentinstitutioninstitutionslocallocallynationalofficeoperated
SHARED TOKENS (22): "additional", "agencies", "assets", "bank", "banking", "beyond", "billion", "commercial", "community", "decisions", "definitions", "federal", "government", "institution", "institutions", "local", "locally", "national", "office", "operated".... | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanotherassessmentschangechangesclassificationdatadirectlyenvironmentalhistoricallyimpactlandland-usemanagementparcelpracticespreviouslyprimaryresourcesrisk
SHARED TOKENS (26): "agricultural", "another", "assessments", "change", "changes", "classification", "data", "directly", "environmental", "historically", "impact", "land", "land-use", "management", "parcel", "practices", "previously", "primary", "resources", "risk".... | EXACT TITLE in water_rights: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyaroundassociatedbestboisecapitalcontainsdistinctdividedeastgeographicidahojulylandnationalnorthwestofficialorganized
SHARED TOKENS (32): "agricultural", "agriculture", "approximately", "around", "associated", "best", "boise", "capital", "contains", "distinct", "divided", "east", "geographic", "idaho", "july", "land", "national", "northwest", "official", "organized".... | EXACT TITLE in water_rights: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
0.500
additionaladequateagriculturalapplicationsboundariescapacityconditionscostsdepartmentdistrictestimatedformationgeothermalindustrialprocessesratereduceresourcessourcesupply
SHARED TOKENS (21): "additional", "adequate", "agricultural", "applications", "boundaries", "capacity", "conditions", "costs", "department", "district", "estimated", "formation", "geothermal", "industrial", "processes", "rate", "reduce", "resources", "source", "supply".... | EXACT TITLE in water_rights: "Geothermal energy".
0.500
actadditionaladequateamongannualauthoritybureaucommunitycomplianceconsumerdatadepartmentdirectdisclosureenforcementestablishexaminationexpandedfederalfields
SHARED TOKENS (44): "act", "additional", "adequate", "among", "annual", "authority", "bureau", "community", "compliance", "consumer", "data", "department", "direct", "disclosure", "enforcement", "establish", "examination", "expanded", "federal", "fields".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
accountingassociationscharacteristicsdeterminefeesfirmimpactindependentlyobligationspractitionerpractitionersprocessprofessionalprofessionalspublicqualityregisteredrequiresrolesector
SHARED TOKENS (24): "accounting", "associations", "characteristics", "determine", "fees", "firm", "impact", "independently", "obligations", "practitioner", "practitioners", "process", "professional", "professionals", "public", "quality", "registered", "requires", "role", "sector".... | EXACT TITLE in mortgage_lending: "Accountant".
0.500
anothercommonlyconnectedconstructedcontaminationdevelopeddistributionflowgoverninginteractionlocalmaintainedplacesqualitystudysuppliessystemsystemswaterwells
SHARED TOKENS (20): "another", "commonly", "connected", "constructed", "contamination", "developed", "distribution", "flow", "governing", "interaction", "local", "maintained", "places", "quality", "study", "supplies", "system", "systems", "water", "wells". | EXACT TITLE in water_rights: "Hydrogeology".
0.500
acreageactamendmentsamongassociationauthoritybureauconstructioncontractsdepartmentestablishedfederalfundirrigatedirrigationlandlaterlawlimitmeridian
SHARED TOKENS (30): "acreage", "act", "amendments", "among", "association", "authority", "bureau", "construction", "contracts", "department", "established", "federal", "fund", "irrigated", "irrigation", "land", "later", "law", "limit", "meridian".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
actactualappliesauthoritybankbusinesscapacitycommunitycomplyconsumercoursedefinesdevelopmentdifferentfederalfinancegovernmentindividualinstitutionlarge
SHARED TOKENS (34): "act", "actual", "applies", "authority", "bank", "business", "capacity", "community", "comply", "consumer", "course", "defines", "development", "different", "federal", "finance", "government", "individual", "institution", "large".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
accessanotherbankdescribingestateevenlegalnamesownerpropertyrightsspecifictitleunderlyingwater
SHARED TOKENS (15): "access", "another", "bank", "describing", "estate", "even", "legal", "names", "owner", "property", "rights", "specific", "title", "underlying", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.500
centralchangescombinationconsequencecoredevelopmenteastenvironmentalexpansionformationformsgrowthmodelpopulationprocessruralsouthurban
SHARED TOKENS (18): "central", "changes", "combination", "consequence", "core", "development", "east", "environmental", "expansion", "formation", "forms", "growth", "model", "population", "process", "rural", "south", "urban". | EXACT TITLE in mortgage_lending: "Suburbanization".
0.500
actagencybecomebureaucurrentlydeliverydepartmentdevelopmentestablishedfederalgovernmentirrigationlawmanagementoperationpotentialprogramprovisionsresourcesale
SHARED TOKENS (24): "act", "agency", "become", "bureau", "currently", "delivery", "department", "development", "established", "federal", "government", "irrigation", "law", "management", "operation", "potential", "program", "provisions", "resource", "sale".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundavailabilitybuildingconstructiondevelopedfailfloodflowfunctionsgoverningincreaseindustrialirrigatedirrigationlandlargelongerloss
SHARED TOKENS (39): "additional", "application", "around", "availability", "building", "construction", "developed", "fail", "flood", "flow", "functions", "governing", "increase", "industrial", "irrigated", "irrigation", "land", "large", "longer", "loss".... | EXACT TITLE in water_rights: "Dam".
0.500
accountactamongannualapprovedapproximatelybankbankingbillioncapitalcentralcommercialcommitteecontroldecisionsdepartmentdutiesemploymententityestablished
SHARED TOKENS (48): "account", "act", "among", "annual", "approved", "approximately", "bank", "banking", "billion", "capital", "central", "commercial", "committee", "control", "decisions", "department", "duties", "employment", "entity", "established".... | EXACT TITLE in water_rights: "Federal Reserve".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecarryingcreatedemanddevelopeddirectlylandlargepopulationpotentialreducerelatedresourcetimingtreatmenturbanvolumewater
SHARED TOKENS (18): "become", "carrying", "create", "demand", "developed", "directly", "land", "large", "population", "potential", "reduce", "related", "resource", "timing", "treatment", "urban", "volume", "water". | EXACT TITLE in water_rights: "Stormwater".
0.500
Drought ↗ Q43059 EXACT TITLE
affectingagricultureannualavailabilitybecomechangeconditionscostsdatedirectlyenvironmentalexperiencefuturehistoryimpactincreaseincreasedincreasingjulylarge
SHARED TOKENS (32): "affecting", "agriculture", "annual", "availability", "become", "change", "conditions", "costs", "date", "directly", "environmental", "experience", "future", "history", "impact", "increase", "increased", "increasing", "july", "large".... | EXACT TITLE in water_rights: "Drought".
0.500
affectdeedsdeterminedocumentingestablishedestateframeworkinstrumentsinterestslandlawlegalotherwiseprincipalprotectpublicrealrecordregistersystem
SHARED TOKENS (22): "affect", "deeds", "determine", "documenting", "established", "estate", "framework", "instruments", "interests", "land", "law", "legal", "otherwise", "principal", "protect", "public", "real", "record", "register", "system".... | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
agriculturalanothercommondomesticimpactindustrialmeanmunicipalprocessprocessespurposetreatmenttypesuseswater
SHARED TOKENS (15): "agricultural", "another", "common", "domestic", "impact", "industrial", "mean", "municipal", "process", "processes", "purpose", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
adaboisebureaucanyonchannelcompletedcountiesengineersidahoirrigationoperatedprimarytreasurevalleywaterwestern
SHARED TOKENS (16): "ada", "boise", "bureau", "canyon", "channel", "completed", "counties", "engineers", "idaho", "irrigation", "operated", "primary", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.500
aroundassetsbankbankingbillioncommercialcommonlyconsumercorporatefailinstitutioninstitutionsmembernonprofitoperationsperiodpublicsharesystems
SHARED TOKENS (19): "around", "assets", "bank", "banking", "billion", "commercial", "commonly", "consumer", "corporate", "fail", "institution", "institutions", "member", "nonprofit", "operations", "period", "public", "share", "systems". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
actapplicableassociationassumeauthoritybestcentralchangechangescommunityconditionscostscreatingdependdependsdevelopmentdistrictsenvironmentalfacilitiesfunction
SHARED TOKENS (38): "act", "applicable", "association", "assume", "authority", "best", "central", "change", "changes", "community", "conditions", "costs", "creating", "depend", "depends", "development", "districts", "environmental", "facilities", "function".... | EXACT TITLE in water_rights: "Land-use planning".
0.500
alteranotherbankingcommonconditionsconsolidatedcontextcorporatedifferentexistingfeesfinanceformshomelongermakesmanagementobligationobligationsperiod
SHARED TOKENS (27): "alter", "another", "banking", "common", "conditions", "consolidated", "context", "corporate", "different", "existing", "fees", "finance", "forms", "home", "longer", "makes", "management", "obligation", "obligations", "period".... | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
assessmentsassociationbankcannotcollateralcommonlycompletecomplycostsdeedexistingfeefeesfutureholdersitemslawlegallendermaking
SHARED TOKENS (33): "assessments", "association", "bank", "cannot", "collateral", "commonly", "complete", "comply", "costs", "deed", "existing", "fee", "fees", "future", "holders", "items", "law", "legal", "lender", "making".... | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
approximatelybecomebillionchangecommoncreatecreatescurrentdescribesdevelopeddevelopmenteducationenvironmentalgrowthimpactincreaseincreasedincreasinginstitutionalland
SHARED TOKENS (45): "approximately", "become", "billion", "change", "common", "create", "creates", "current", "describes", "developed", "development", "education", "environmental", "growth", "impact", "increase", "increased", "increasing", "institutional", "land".... | EXACT TITLE in water_rights: "Urbanization". | EXACT TITLE in mortgage_lending: "Urbanization".
0.500
actchaptercodecostsestatefeeshomeownerslawnaturepracticepracticesproceduresprocessprotectproviderealrequiresthemtitle
SHARED TOKENS (19): "act", "chapter", "code", "costs", "estate", "fees", "homeowners", "law", "nature", "practice", "practices", "procedures", "process", "protect", "provide", "real", "requires", "them", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
chaindocumentdocumentationdocumentshistoricallawmaintainedofficeownerownershippropertyrecordservestitletransfers
SHARED TOKENS (15): "chain", "document", "documentation", "documents", "historical", "law", "maintained", "office", "owner", "ownership", "property", "record", "serves", "title", "transfers". | EXACT TITLE in mortgage_lending: "Chain of title".
0.500
agricultureboisebureaucountieseastengineersidahoirrigationnationaloperatedprimaryprovidepurposewaterwestern
SHARED TOKENS (15): "agriculture", "boise", "bureau", "counties", "east", "engineers", "idaho", "irrigation", "national", "operated", "primary", "provide", "purpose", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.500
Hydrology ↗ Q42250 EXACT TITLE
datadistributionenvironmentalfieldsmanagementphysicalplanningpolicypractitionerqualityrelatedresearchresourcesstudywater
SHARED TOKENS (15): "data", "distribution", "environmental", "fields", "management", "physical", "planning", "policy", "practitioner", "quality", "related", "research", "resources", "study", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
authorityestategoverninggovernmentimprovementsjurisdictionlandnationalpropertyraterealregionrentalrequiressystemtransactionvaluewhose
SHARED TOKENS (18): "authority", "estate", "governing", "government", "improvements", "jurisdiction", "land", "national", "property", "rate", "real", "region", "rental", "requires", "system", "transaction", "value", "whose". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
actualbusinessbuyerscollateralcommercialcommonlycostsdeedsdefectsestateevidencefeeformgeneralgenerallyindependentinstitutionalinterestslandlarge
SHARED TOKENS (45): "actual", "business", "buyers", "collateral", "commercial", "commonly", "costs", "deeds", "defects", "estate", "evidence", "fee", "form", "general", "generally", "independent", "institutional", "interests", "land", "large".... | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsflowformationhomeindustriallandlayermaterialspressureregionrelatedsourcestudyunderlyingwaterwells
SHARED TOKENS (17): "beyond", "characteristics", "flow", "formation", "home", "industrial", "land", "layer", "materials", "pressure", "region", "related", "source", "study", "underlying", "water", "wells". | EXACT TITLE in water_rights: "Aquifer".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmentexpansionfeefeesfundgovernmentgrowthimpactimprovementslocalneededpopulationprojectpublicreduce
SHARED TOKENS (18): "capital", "construction", "costs", "development", "expansion", "fee", "fees", "fund", "government", "growth", "impact", "improvements", "local", "needed", "population", "project", "public", "reduce". | EXACT TITLE in mortgage_lending: "Impact fee".
0.500
accordingagriculturalagriculturechangesclassificationcontainingdifferentenvironmentalformformshomeimpactindustrialmakingotherwisephysicalprimaryprocessingrequiredresults
SHARED TOKENS (20): "according", "agricultural", "agriculture", "changes", "classification", "containing", "different", "environmental", "form", "forms", "home", "impact", "industrial", "making", "otherwise", "physical", "primary", "processing", "required", "results". | EXACT TITLE in water_rights: "Food processing".
0.500
Water treatment ↗ EXACT TITLE
developedenvironmentalflowincreasedindustrialirrigationmaterialsprocessprocessesqualityresourcespecificsupplysystemstreatmentuseswater
SHARED TOKENS (17): "developed", "environmental", "flow", "increased", "industrial", "irrigation", "materials", "process", "processes", "quality", "resource", "specific", "supply", "systems", "treatment", "uses", "water". | EXACT TITLE in water_rights: "Water treatment".
0.500
actagencyauthorizedbillionbureauchargesconsumerconsumersdataenforcementestablishedfederalfeesgovernmentindependentinstitutionsjurisdictionlawlimitmechanism
SHARED TOKENS (37): "act", "agency", "authorized", "billion", "bureau", "charges", "consumer", "consumers", "data", "enforcement", "established", "federal", "fees", "government", "independent", "institutions", "jurisdiction", "law", "limit", "mechanism".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
accountingbusinesscreatedocumentdocumentsfunctionsgeneralindividualinformationoperationsprocessrealrecordrecordedrecordsreportreportssourcesystemstransaction
SHARED TOKENS (21): "accounting", "business", "create", "document", "documents", "functions", "general", "individual", "information", "operations", "process", "real", "record", "recorded", "records", "report", "reports", "source", "systems", "transaction".... | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
additionalaroundassetscollateralcommondatediscoveryfeefinancefundfuturelaterlenderlossmanagersmarketmarketsmechanismobligationotherwise
SHARED TOKENS (36): "additional", "around", "assets", "collateral", "common", "date", "discovery", "fee", "finance", "fund", "future", "later", "lender", "loss", "managers", "market", "markets", "mechanism", "obligation", "otherwise".... | EXACT TITLE in water_rights: "Short (finance)". | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyoncentralchannelcommercialconstructedconstructioncontroldevelopedeastfeaturesfloodflowsheavilyhistoryidahoirrigationlargenationalnorthwest
SHARED TOKENS (36): "agencies", "canyon", "central", "channel", "commercial", "constructed", "construction", "control", "developed", "east", "features", "flood", "flows", "heavily", "history", "idaho", "irrigation", "large", "national", "northwest".... | EXACT TITLE in water_rights: "Snake River".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
agencyannouncedassetsassociationbillioncommonlydepartmentdescribedfederalfinancegovernmentheadquarteredhomeincreasedmakingmanagementmarketmarketsnationalprivate
SHARED TOKENS (25): "agency", "announced", "assets", "association", "billion", "commonly", "department", "described", "federal", "finance", "government", "headquartered", "home", "increased", "making", "management", "market", "markets", "national", "private".... | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescommunicationsconstructiondevelopmentequipmentestablishfeaturesformsgovernmenthistorylandlawlegalownershipplanningprofessionalpropertyrecordedrequired
SHARED TOKENS (23): "analysis", "boundaries", "communications", "construction", "development", "equipment", "establish", "features", "forms", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "recorded", "required".... | EXACT TITLE in water_rights: "Surveying".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
bankbankingbuildingbusinesscapitalcharacteristicscollateralcommercialdemanddescribeddevelopeddirectlydomesticestateexistingfeaturesformhomeinstitutionlaw
SHARED TOKENS (42): "bank", "banking", "building", "business", "capital", "characteristics", "collateral", "commercial", "demand", "described", "developed", "directly", "domestic", "estate", "existing", "features", "form", "home", "institution", "law".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
additionalagenciesanotherbankbankingbusinesscapitalcommercialconsumerconsumersdeeddirectlydiscoveryeligibleenterentityfederalfeefeesframework
SHARED TOKENS (48): "additional", "agencies", "another", "bank", "banking", "business", "capital", "commercial", "consumer", "consumers", "deed", "directly", "discovery", "eligible", "enter", "entity", "federal", "fee", "fees", "framework".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
actbillingcompareconnectedconnectionconsumerconsumersexceptionsfederalfeeslawlendermakingplanspracticesprincipalproceduresprohibitsregulatesregulation
SHARED TOKENS (23): "act", "billing", "compare", "connected", "connection", "consumer", "consumers", "exceptions", "federal", "fees", "law", "lender", "making", "plans", "practices", "principal", "procedures", "prohibits", "regulates", "regulation".... | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
actaddressaddressingagencyamendmentschangescontaminationcontroldirectlyengineersenvironmentalfederalformgoverninginvolvinglawmaintainmodernphysicalprimarily
SHARED TOKENS (29): "act", "address", "addressing", "agency", "amendments", "changes", "contamination", "control", "directly", "engineers", "environmental", "federal", "form", "governing", "involving", "law", "maintain", "modern", "physical", "primarily".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
annualapplicationapplicationsapproximatelyaroundboundariescapacitycontainsdirectevenformationgeothermalmeanneededprimarysource
SHARED TOKENS (16): "annual", "application", "applications", "approximately", "around", "boundaries", "capacity", "contains", "direct", "even", "formation", "geothermal", "mean", "needed", "primary", "source". | EXACT TITLE in water_rights: "Geothermal heating".
0.500
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationconditionscontextdifferentformationimpactphysicalpropertiesprovideresourcestudywater
SHARED TOKENS (15): "agriculture", "annual", "change", "classification", "conditions", "context", "different", "formation", "impact", "physical", "properties", "provide", "resource", "study", "water". | EXACT TITLE in water_rights: "Snowpack".
0.500
affordableassociateddemandemergencyformsgenerallygovernmenthomeincreasedindexlocalmarketsnationalownershiprentalresponsesupply
SHARED TOKENS (17): "affordable", "associated", "demand", "emergency", "forms", "generally", "government", "home", "increased", "index", "local", "markets", "national", "ownership", "rental", "response", "supply". | EXACT TITLE in mortgage_lending: "Affordable housing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangescommonconditionsconsolidationcontroldevelopeddirectlydistributionenvironmentalfieldsflowformgrowthimprovementsirrigation
SHARED TOKENS (46): "agricultural", "agriculture", "application", "applies", "central", "changes", "common", "conditions", "consolidation", "control", "developed", "directly", "distribution", "environmental", "fields", "flow", "form", "growth", "improvements", "irrigation".... | EXACT TITLE in water_rights: "Irrigation". | EXACT TITLE in mortgage_lending: "Irrigation".
0.500
associationbestcontaminationcontroldescribedequipmentevaluationmanagemodernnaturepressureprocessproducingprofileprotectregulatedrequiredresourcesearchsources
SHARED TOKENS (22): "association", "best", "contamination", "control", "described", "equipment", "evaluation", "manage", "modern", "nature", "pressure", "process", "producing", "profile", "protect", "regulated", "required", "resource", "search", "sources".... | EXACT TITLE in water_rights: "Well drilling".
0.500
actapplicationenterflowflowsgenerallyirrigationjoiningperiodpermitpointqualityrequirementsrisksourcessurroundinguseswater
SHARED TOKENS (18): "act", "application", "enter", "flow", "flows", "generally", "irrigation", "joining", "period", "permit", "point", "quality", "requirements", "risk", "sources", "surrounding", "uses", "water". | EXACT TITLE in water_rights: "Return flow".
0.500
agriculturalagricultureannualapprovalcontextdefinitionsdevelopmentdividedevenformsgenerallyirrigatedirrigationlandperiodpermittedproducingproductionrequirerequires
SHARED TOKENS (22): "agricultural", "agriculture", "annual", "approval", "context", "definitions", "development", "divided", "even", "forms", "generally", "irrigated", "irrigation", "land", "period", "permitted", "producing", "production", "require", "requires".... | EXACT TITLE in water_rights: "Agricultural land".
0.500
actagricultureapproximatelyboisebureaucapacitychangedcompletedcompletionconstructionflowshomeidahoincreasedirrigationlaborlawmaterialsmonthsnational
SHARED TOKENS (30): "act", "agriculture", "approximately", "boise", "bureau", "capacity", "changed", "completed", "completion", "construction", "flows", "home", "idaho", "increased", "irrigation", "labor", "law", "materials", "months", "national".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
adaboisecanyoncollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampapopulationprimaryprogramspublicsouthwesttreasurevalley
SHARED TOKENS (22): "ada", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "primary", "programs", "public", "southwest", "treasure", "valley".... | EXACT TITLE in water_rights: "College of Western Idaho". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
0.500
Credit risk ↗ Q162714 EXACT TITLE
anotherassessmentsassetsassociatedbankbusinesscompleteconsumercostsfailflowsgeneralgovernmentincreasedlenderlossmarketobligationobligationsparticipants
SHARED TOKENS (27): "another", "assessments", "assets", "associated", "bank", "business", "complete", "consumer", "costs", "fail", "flows", "general", "government", "increased", "lender", "loss", "market", "obligation", "obligations", "participants".... | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
academicsaccessadditionalapprovedbureauclaimsconsumerconsumersdateestategenerallyhomehomeownersindependentlegalmaintainmarketmovepropertyprotection
SHARED TOKENS (26): "academics", "access", "additional", "approved", "bureau", "claims", "consumer", "consumers", "date", "estate", "generally", "home", "homeowners", "independent", "legal", "maintain", "market", "move", "property", "protection".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
Fannie Mae ↗ Q621096 EXACT TITLE
additionalassetsassociationassociationscommonlyestablishedfederalhomelocalmakingmarketnationalprocessrankingsreliance
SHARED TOKENS (15): "additional", "assets", "association", "associations", "commonly", "established", "federal", "home", "local", "making", "market", "national", "process", "rankings", "reliance". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.500
Reddit ↗ Q1136 EXACT TITLE
accordingacquiredamongbillioncommonlycreatecurrentdatafeaturesindependentjulylinksmarketmedianewsnicheoperatedorganizedpageplatform
SHARED TOKENS (29): "according", "acquired", "among", "billion", "commonly", "create", "current", "data", "features", "independent", "july", "links", "market", "media", "news", "niche", "operated", "organized", "page", "platform".... | EXACT TITLE in mortgage_lending: "Reddit".
0.500
agriculturearoundcapitalcommercialcommunitycostsdependdifferentinstitutionalirrigationlargelargerpersonnelpolicypracticepressureprimarilyprovidersprovisionpublic
SHARED TOKENS (31): "agriculture", "around", "capital", "commercial", "community", "costs", "depend", "different", "institutional", "irrigation", "large", "larger", "personnel", "policy", "practice", "pressure", "primarily", "providers", "provision", "public".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsagencyapplicationscombinationcommoncontainingcontaminationdetermineenvironmentalformformsgroupincreasinglargerneededprimaryproductionpropertiesprotectionresearch
SHARED TOKENS (24): "affects", "agency", "applications", "combination", "common", "containing", "contamination", "determine", "environmental", "form", "forms", "group", "increasing", "larger", "needed", "primary", "production", "properties", "protection", "research".... | EXACT TITLE in water_rights: "Arsenic".
0.480
alongsidecontainsformindustrialirrigationlandlargemovingreportssurroundingtreatmenttypesuseswater
SHARED TOKENS (14): "alongside", "contains", "form", "industrial", "irrigation", "land", "large", "moving", "reports", "surrounding", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Surface water".
0.480
aroundassociatedbuildingconstructiondevelopmentdomesticfacilitiesfinancingindustrialinfrastructurepercentplanningprocesswork
SHARED TOKENS (14): "around", "associated", "building", "construction", "development", "domestic", "facilities", "financing", "industrial", "infrastructure", "percent", "planning", "process", "work". | EXACT TITLE in water_rights: "Construction". | EXACT TITLE in mortgage_lending: "Construction".
0.480
Ditch ↗ Q2048319 EXACT TITLE
alongsidearoundchannelcommonlyconditionsfieldsirrigationproviderequiredruralsourcethemwaterwhose
SHARED TOKENS (14): "alongside", "around", "channel", "commonly", "conditions", "fields", "irrigation", "provide", "required", "rural", "source", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.480
anotherboundariescommoncommonlyenvironmentalfeaturesflowslandplacespointrathersinglesystemwater
SHARED TOKENS (14): "another", "boundaries", "common", "commonly", "environmental", "features", "flows", "land", "places", "point", "rather", "single", "system", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.480
Wheat ↗ Q15645384 EXACT TITLE
aroundcommondemandgeneralgroupincreasinglandlargermakingpopulationproductionqualityrecordsource
SHARED TOKENS (14): "around", "common", "demand", "general", "group", "increasing", "land", "larger", "making", "population", "production", "quality", "record", "source". | EXACT TITLE in water_rights: "Wheat".
0.480
accountingacquisitionanalysisassetsclassificationcompletionlawperiodprincipalprocesspropertysystemvaluezoning
SHARED TOKENS (14): "accounting", "acquisition", "analysis", "assets", "classification", "completion", "law", "period", "principal", "process", "property", "system", "value", "zoning". | EXACT TITLE in mortgage_lending: "Amortization".
0.480
Nitrate ↗ Q49916468 EXACT TITLE
agriculturalapplicationsassociatedcommoncontainingdirecthistoricallymodernnatureprocessesproductionsourcesourceswater
SHARED TOKENS (14): "agricultural", "applications", "associated", "common", "containing", "direct", "historically", "modern", "nature", "processes", "production", "source", "sources", "water". | EXACT TITLE in water_rights: "Nitrate".
0.480
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodecommercialconditionsdevelopedflowmodeloperatingprimarilyprogrampublicsourcesystems
SHARED TOKENS (14): "beyond", "boundary", "code", "commercial", "conditions", "developed", "flow", "model", "operating", "primarily", "program", "public", "source", "systems". | EXACT TITLE in water_rights: "MODFLOW".
0.480
capacitycollateralcreatedetermineevenfinallargerlendermanagementprocessprovidequalityriskuses
SHARED TOKENS (14): "capacity", "collateral", "create", "determine", "even", "final", "larger", "lender", "management", "process", "provide", "quality", "risk", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.480
alongsidebankcapitalcentralcollateraldeterminefederalfinancingfutureperiodperiodspolicyprincipalrate
SHARED TOKENS (14): "alongside", "bank", "capital", "central", "collateral", "determine", "federal", "financing", "future", "period", "periods", "policy", "principal", "rate". | EXACT TITLE in mortgage_lending: "Interest rate".
0.460
agriculturalapproximatelychangeflowindustrialirrigationresourceresourcessourcesourcessouthsupplywater
SHARED TOKENS (13): "agricultural", "approximately", "change", "flow", "industrial", "irrigation", "resource", "resources", "source", "sources", "south", "supply", "water". | EXACT TITLE in water_rights: "Water resources".
0.460
adaapproximatelyboisecanyoncapacitychannelidahoirrigationsystemtreasurevalleywaterwestern
SHARED TOKENS (13): "ada", "approximately", "boise", "canyon", "capacity", "channel", "idaho", "irrigation", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.460
characteristicscommoncompliancecontactdeterminesgenerallyimpactphysicalqualitystandardssupplytreatmentwater
SHARED TOKENS (13): "characteristics", "common", "compliance", "contact", "determines", "generally", "impact", "physical", "quality", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.460
Telemetry ↗ Q209867 EXACT TITLE
commonlycommunicationscontroldataequipmentinstructionsmediamodernnetworkoperatephysicalrequiresystems
SHARED TOKENS (13): "commonly", "communications", "control", "data", "equipment", "instructions", "media", "modern", "network", "operate", "physical", "require", "systems". | EXACT TITLE in water_rights: "Telemetry".
0.460
commercialdefectivedirectlyindustrialinfrastructuresanitaryseparateservingsewersystemsystemstreatmenturban
SHARED TOKENS (13): "commercial", "defective", "directly", "industrial", "infrastructure", "sanitary", "separate", "serving", "sewer", "system", "systems", "treatment", "urban". | EXACT TITLE in water_rights: "Sanitary sewer".
0.440
anotherchaincurrentdifferentevenformslongermagnitudemakingprocessratesingle
SHARED TOKENS (12): "another", "chain", "current", "different", "even", "forms", "longer", "magnitude", "making", "process", "rate", "single". | EXACT TITLE in water_rights: "Radionuclide".
0.440
approximatelyboisedatadistrictdistrictsdividedevengovernmentidahopopulationsinglesouth
SHARED TOKENS (12): "approximately", "boise", "data", "district", "districts", "divided", "even", "government", "idaho", "population", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
0.440
actualcommonfloodformshomelistedlosspolicypropertyprotectionrequirespecialized
SHARED TOKENS (12): "actual", "common", "flood", "forms", "home", "listed", "loss", "policy", "property", "protection", "require", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.420
billionconditionsdependsdirectlyenvironmentalformmaintainphysicalrequiredwaterwork
SHARED TOKENS (11): "billion", "conditions", "depends", "directly", "environmental", "form", "maintain", "physical", "required", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.420
Escrow ↗ Q338451 EXACT TITLE
accountcompletedconditionsdeeddependentestablishedobligationsprimaryprincipalpropertytransaction
SHARED TOKENS (11): "account", "completed", "conditions", "deed", "dependent", "established", "obligations", "primary", "principal", "property", "transaction". | EXACT TITLE in mortgage_lending: "Escrow".
0.420
agencyboisedepartmentenvironmentalfederalgovernmentidahomaintainedqualityregionalregulations
SHARED TOKENS (11): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "maintained", "quality", "regional", "regulations". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.420
Lien ↗ Q4469383 EXACT TITLE
applicationformformsgenerallyinterestsobligationownerperformancepropertyspecifictypes
SHARED TOKENS (11): "application", "form", "forms", "generally", "interests", "obligation", "owner", "performance", "property", "specific", "types". | EXACT TITLE in water_rights: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.420
bankdeeddivisionfirmlenderlossmitigationprocessreducesaleworks
SHARED TOKENS (11): "bank", "deed", "division", "firm", "lender", "loss", "mitigation", "process", "reduce", "sale", "works". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.400
bankingcapacitydeliveryfeefutureperiodspracticerightstransferswater
SHARED TOKENS (10): "banking", "capacity", "delivery", "fee", "future", "periods", "practice", "rights", "transfers", "water". | EXACT TITLE in water_rights: "Water banking".
0.400
analysisbureauclassificationcorporatelabormanagementmeanpotentialriskrole
SHARED TOKENS (10): "analysis", "bureau", "classification", "corporate", "labor", "management", "mean", "potential", "risk", "role". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.380
codecommonlyfederalhomelawleastregulatedregulationstypes
SHARED TOKENS (9): "code", "commonly", "federal", "home", "law", "least", "regulated", "regulations", "types". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.380
determinesevidencelegalobligationsprocessprocessesreviewsrightsshows
SHARED TOKENS (9): "determines", "evidence", "legal", "obligations", "process", "processes", "reviews", "rights", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.380
costsestatefeespaidpointpropertyrealtitletransaction
SHARED TOKENS (9): "costs", "estate", "fees", "paid", "point", "property", "real", "title", "transaction". | EXACT TITLE in mortgage_lending: "Closing costs".
0.380
administrationagencyassociateddepartmentfederalnationalofficepotentialresources
SHARED TOKENS (9): "administration", "agency", "associated", "department", "federal", "national", "office", "potential", "resources". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.360
Trust deed ↗ Q7848150 EXACT TITLE
commondeedestategenerallawlegalrealsystems
SHARED TOKENS (8): "common", "deed", "estate", "general", "law", "legal", "real", "systems". | EXACT TITLE in mortgage_lending: "Trust deed".
0.360
agriculturebuildingdevelopmentestatelandlandscapepurposereal
SHARED TOKENS (8): "agriculture", "building", "development", "estate", "land", "landscape", "purpose", "real". | EXACT TITLE in water_rights: "Land development". | EXACT TITLE in mortgage_lending: "Land development".
0.360
capacitychannelestimatedflowlandrecordvolumewater
SHARED TOKENS (8): "capacity", "channel", "estimated", "flow", "land", "record", "volume", "water". | EXACT TITLE in water_rights: "Streamflow".
0.360
Zillow ↗ Q8071921 EXACT TITLE
comcurrentestateformergroupleadershiprealreal-estate
SHARED TOKENS (8): "com", "current", "estate", "former", "group", "leadership", "real", "real-estate". | EXACT TITLE in mortgage_lending: "Zillow".
0.360
agriculturalirrigationlocalmanagementprocessesresourcerolewater
SHARED TOKENS (8): "agricultural", "irrigation", "local", "management", "processes", "resource", "role", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.340
applicationsapprovalcommercialinstitutionslicensedofficersrelated
SHARED TOKENS (7): "applications", "approval", "commercial", "institutions", "licensed", "officers", "related". | EXACT TITLE in mortgage_lending: "Loan officer".
0.340
commonenvironmentalmovingprimaryprocessprocesseswater
SHARED TOKENS (7): "common", "environmental", "moving", "primary", "process", "processes", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.320
Reservoir ↗ Q131681 EXACT TITLE
buildingcontrollingexistingformretainingwater
SHARED TOKENS (6): "building", "controlling", "existing", "form", "retaining", "water". | EXACT TITLE in water_rights: "Reservoir".
0.320
Parcel ↗ Q7136418 EXACT TITLE
bankdeliveryindividuallandmodernparcel
SHARED TOKENS (6): "bank", "delivery", "individual", "land", "modern", "parcel". | EXACT TITLE in water_rights: "Parcel". | EXACT TITLE in mortgage_lending: "Parcel".
0.320
Sugar beet ↗ Q151964 EXACT TITLE
commoncontainsgroupproductiontogetherwhose
SHARED TOKENS (6): "common", "contains", "group", "production", "together", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.320
anotherconditionsdocumentlegalspecifiedsubject
SHARED TOKENS (6): "another", "conditions", "document", "legal", "specified", "subject". | EXACT TITLE in mortgage_lending: "Promissory note".
0.300
administrationaffectaffectingaloneamongassociationbankbillionestateevenfederalfundgovernmenthistoryhomehomeownersimpactincreasedincreasingindex
SHARED TOKENS (38): "administration", "affect", "affecting", "alone", "among", "association", "bank", "billion", "estate", "even", "federal", "fund", "government", "history", "home", "homeowners", "impact", "increased", "increasing", "index"....
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturedatefieldsformformerhistoricalirrigatedirrigationmaintainedmanagementoperatedpracticeregionresourcesystemswater
SHARED TOKENS (17): "agricultural", "agriculture", "date", "fields", "form", "former", "historical", "irrigated", "irrigation", "maintained", "management", "operated", "practice", "region", "resource", "systems", "water".
0.300
assetscommercialentityestatelawnatureperiodpropertyprotectprotectionprovisionsrateratherrealresidentialriskstructuresubjecttransactionstypes
SHARED TOKENS (21): "assets", "commercial", "entity", "estate", "law", "nature", "period", "property", "protect", "protection", "provisions", "rate", "rather", "real", "residential", "risk", "structure", "subject", "transactions", "types"....
0.300
analysisanotherapplicationsbroaderbusinesscommondatadategeographicindexinformationinstitutionalintegratedmanagemanagementoperationsphysicalplanningpreviouslyprocedures
SHARED TOKENS (28): "analysis", "another", "applications", "broader", "business", "common", "data", "date", "geographic", "index", "information", "institutional", "integrated", "manage", "management", "operations", "physical", "planning", "previously", "procedures"....
0.300
accordingagreementsamongassociatedbankbankingbecomechangedcharacteristicscommercialdifferentestateflowgeneralgenerallyhomeownersindividuallargelenderlonger
SHARED TOKENS (42): "according", "agreements", "among", "associated", "bank", "banking", "become", "changed", "characteristics", "commercial", "different", "estate", "flow", "general", "generally", "homeowners", "individual", "large", "lender", "longer"....
0.300
accordingamongchangechangedchangeschargescommondirectdistinctfederalformsgenerallygovernmentindexlegallylendermarketmarketsobtainoutside
SHARED TOKENS (32): "according", "among", "change", "changed", "changes", "charges", "common", "direct", "distinct", "federal", "forms", "generally", "government", "index", "legally", "lender", "market", "markets", "obtain", "outside"....
0.300
applicationscentralcontaminationcontrolcreateequipmentfacilitiesindividualindustrialinsideintegratedlargemaintainmaterialsmodernprocessprocessingproductionreduceresearch
SHARED TOKENS (25): "applications", "central", "contamination", "control", "create", "equipment", "facilities", "individual", "industrial", "inside", "integrated", "large", "maintain", "materials", "modern", "process", "processing", "production", "reduce", "research"....
0.300
accessactadministrationaffordableagencyconstructioncurrentlydepartmentdevelopmentdifferentfacilitiesfederalfinancegovernmentlendermarketnationalofficeownerprincipal
SHARED TOKENS (28): "access", "act", "administration", "affordable", "agency", "construction", "currently", "department", "development", "different", "facilities", "federal", "finance", "government", "lender", "market", "national", "office", "owner", "principal"....
0.300
accessadditionalapplicationassetsassociatedchargescollateralcommonlyconventionalcostsestateevaluationfeegeneralhomejuniorlenderlinespaidperiod
SHARED TOKENS (36): "access", "additional", "application", "assets", "associated", "charges", "collateral", "commonly", "conventional", "costs", "estate", "evaluation", "fee", "general", "home", "junior", "lender", "lines", "paid", "period"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercommondevelopeddividedenforcementenvironmentalgenerallygoverningjurisdictionlandlawlegalownershipprivatepropertypublicrealrelationshipsrights
SHARED TOKENS (23): "acquisition", "another", "common", "developed", "divided", "enforcement", "environmental", "generally", "governing", "jurisdiction", "land", "law", "legal", "ownership", "private", "property", "public", "real", "relationships", "rights"....
0.300
adaaddsboisecanyoncommonlycountiescurrentlyhomeidaholargermeridianmetropolitannampanorthwestpacificpercentpopulationsectiontreasurevalley
SHARED TOKENS (20): "ada", "adds", "boise", "canyon", "commonly", "counties", "currently", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "northwest", "pacific", "percent", "population", "section", "treasure", "valley".
0.300
agriculturalagriculturecombinationcostsdirectdistributioneastenvironmentalfieldsincreasingindustrialirrigationmanagementmunicipalpracticeprocessreduceregionremainrequire
SHARED TOKENS (28): "agricultural", "agriculture", "combination", "costs", "direct", "distribution", "east", "environmental", "fields", "increasing", "industrial", "irrigation", "management", "municipal", "practice", "process", "reduce", "region", "remain", "require"....
0.300
actadequateagenciesauthoritycodeconsequencedependdescribeddevelopmentdifferentdirectsfederalgrowthlawlistednationalneededpointprimaryprohibits
SHARED TOKENS (29): "act", "adequate", "agencies", "authority", "code", "consequence", "depend", "described", "development", "different", "directs", "federal", "growth", "law", "listed", "national", "needed", "point", "primary", "prohibits"....
0.300
actagenciesagencybankbureaudepartmentestablishedfederalindependentinstitutionsjulylicensednationalofficeregulatoryserves
SHARED TOKENS (16): "act", "agencies", "agency", "bank", "bureau", "department", "established", "federal", "independent", "institutions", "july", "licensed", "national", "office", "regulatory", "serves".
0.300
approvalbuildingcannotcodecodescompletioncomplianceconstructiondevelopmentemploymentexpansionfinancinggenerallygovernmentlawlocalnationalneededobtainpermit
SHARED TOKENS (28): "approval", "building", "cannot", "code", "codes", "completion", "compliance", "construction", "development", "employment", "expansion", "financing", "generally", "government", "law", "local", "national", "needed", "obtain", "permit"....
0.300
administrationagenciesanotherchangescontroldecisionsdivisioneducationenforcementenvironmentalexpandedgenerallygoverninggovernmentincreaseinteractionitselfjudiciallawlegal
SHARED TOKENS (29): "administration", "agencies", "another", "changes", "control", "decisions", "division", "education", "enforcement", "environmental", "expanded", "generally", "governing", "government", "increase", "interaction", "itself", "judicial", "law", "legal"....
0.300
accountadditionalagricultureannualboisechangechangedchangescoursedatadegreesdescribeddifferentestimatedexperiencegeneralgenerallyhistoryidahoincrease
SHARED TOKENS (33): "account", "additional", "agriculture", "annual", "boise", "change", "changed", "changes", "course", "data", "degrees", "described", "different", "estimated", "experience", "general", "generally", "history", "idaho", "increase"....
0.300
authorityboundariesdistrictdistrictsentitygeographicgovernmentirrigationlargelocalobtainorganizedpublicstatutesubdivisionwater
SHARED TOKENS (16): "authority", "boundaries", "district", "districts", "entity", "geographic", "government", "irrigation", "large", "local", "obtain", "organized", "public", "statute", "subdivision", "water".
0.300
administrationbankchargescommercialdepartmententitiesestatefederalfeefeesfirmgenerallygovernmentinstrumentsprincipalprivateprocesspurchaseratereal
SHARED TOKENS (26): "administration", "bank", "charges", "commercial", "department", "entities", "estate", "federal", "fee", "fees", "firm", "generally", "government", "instruments", "principal", "private", "process", "purchase", "rate", "real"....
0.300
actaffordablearoundassessmentsassetsbankbankingbillioncapitalcentralcommercialconsumercreatedemanddepartmentdevelopmentemergencyestateexistingfebruary
SHARED TOKENS (60): "act", "affordable", "around", "assessments", "assets", "bank", "banking", "billion", "capital", "central", "commercial", "consumer", "create", "demand", "department", "development", "emergency", "estate", "existing", "february"....
0.300
actadministrationagenciesassetsauthoritybillionbureaubusinesschangescommonlycomplianceconsumerconsumerscostsdataestablishedfailfederalgrowthinstitutions
SHARED TOKENS (38): "act", "administration", "agencies", "assets", "authority", "billion", "bureau", "business", "changes", "commonly", "compliance", "consumer", "consumers", "costs", "data", "established", "fail", "federal", "growth", "institutions"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsdescribingdevelopmentenvironmentalgeneralgrowthincreasedindustrialpointprocessprogramreducesourcesourceswater
SHARED TOKENS (16): "agriculture", "controls", "describing", "development", "environmental", "general", "growth", "increased", "industrial", "point", "process", "program", "reduce", "source", "sources", "water".
0.300
availabilitybankcentralcombinationdescribedestatefuturelocallossmarketmarketsnationalpolicypropertypublicrapidrealregionalrisk
SHARED TOKENS (19): "availability", "bank", "central", "combination", "described", "estate", "future", "local", "loss", "market", "markets", "national", "policy", "property", "public", "rapid", "real", "regional", "risk".
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
commonlyconnecteddomesticflowsinvolvingprimaryprocessesratereduceruralsepticsystemsystemsthereforetreatment
SHARED TOKENS (15): "commonly", "connected", "domestic", "flows", "involving", "primary", "processes", "rate", "reduce", "rural", "septic", "system", "systems", "therefore", "treatment".
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecrossdifferentestategovernmentlandlegallineslocalmeanoperateotherwiseownerownershipphysicalprivaterealrightsroad
SHARED TOKENS (25): "authority", "capable", "cross", "different", "estate", "government", "land", "legal", "lines", "local", "mean", "operate", "otherwise", "owner", "ownership", "physical", "private", "real", "rights", "road"....
0.300
accessanotherapplicationapprovedassociatedcapitalchangesclassificationcommonlydescribeddevelopmentdifferentdirectformformsgeographichomeindividuallargelegal
SHARED TOKENS (28): "access", "another", "application", "approved", "associated", "capital", "changes", "classification", "commonly", "described", "development", "different", "direct", "form", "forms", "geographic", "home", "individual", "large", "legal"....
0.300
collateralconsumerdirectlyeducationgenerallyhomehomeownersimprovementsitselflendermaintainperiodpropertyrequirerequirementsthemuses
SHARED TOKENS (17): "collateral", "consumer", "directly", "education", "generally", "home", "homeowners", "improvements", "itself", "lender", "maintain", "period", "property", "require", "requirements", "them", "uses".
0.300
applicationapprovalchapterclaimscodeconsolidationformgeneralgoverningindividualjuniorpartiallyplansplatformprioritypropertyprotectionprovidepurposerequirements
SHARED TOKENS (25): "application", "approval", "chapter", "claims", "code", "consolidation", "form", "general", "governing", "individual", "junior", "partially", "plans", "platform", "priority", "property", "protection", "provide", "purpose", "requirements"....
0.300
affectsagriculturalagriculturebecomebuildingchangesconstructioncontaminationcontrolcontrollingdifferentflowgenerallylandlargelocalmakingmanagementoperationspoint
SHARED TOKENS (33): "affects", "agricultural", "agriculture", "become", "building", "changes", "construction", "contamination", "control", "controlling", "different", "flow", "generally", "land", "large", "local", "making", "management", "operations", "point"....
0.300
actadministersassociatedauthorizationdevelopmentdivisionengineersenvironmentalfloodimprovementsindexinfrastructurenationalpdfprotectionpublicrequirementsresourceswater
SHARED TOKENS (19): "act", "administers", "associated", "authorization", "development", "division", "engineers", "environmental", "flood", "improvements", "index", "infrastructure", "national", "pdf", "protection", "public", "requirements", "resources", "water".
0.300
additionalcommercialconsumersdistributionfacilitiesflowgenerallyindustrialinstitutionlocallynetworkpointpressureprivateprovidepublicratherseparatesewersources
SHARED TOKENS (25): "additional", "commercial", "consumers", "distribution", "facilities", "flow", "generally", "industrial", "institution", "locally", "network", "point", "pressure", "private", "provide", "public", "rather", "separate", "sewer", "sources"....
0.300
amongapproximatelyassociationboisebureaucanyoncapacitycompletedcontainscountiescreatesdirectlyeastedgefebruaryfederalflatformationidaholocal
SHARED TOKENS (31): "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "completed", "contains", "counties", "creates", "directly", "east", "edge", "february", "federal", "flat", "formation", "idaho", "local"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
applyaroundboundarieschangecharacteristicscommondataflowformerincreasemodelpointprimarilypropertiesrealresponseresultssystemtestingwater
SHARED TOKENS (21): "apply", "around", "boundaries", "change", "characteristics", "common", "data", "flow", "former", "increase", "model", "point", "primarily", "properties", "real", "response", "results", "system", "testing", "water"....
0.300
analysisbestbroaderbuildingchangechangescontroldescribingeffectivefloodimpactincreaseincreasedindividualinfrastructurelandscapemanagemanagementmitigationpotential
SHARED TOKENS (30): "analysis", "best", "broader", "building", "change", "changes", "control", "describing", "effective", "flood", "impact", "increase", "increased", "individual", "infrastructure", "landscape", "manage", "management", "mitigation", "potential"....
0.300
accountapplicationappliesdifferentgenerallyhomelendermarketmarketsnetworkofficerspaidplanningpolicyprocessprocessesresearchriskspecializedspecific
SHARED TOKENS (21): "account", "application", "applies", "different", "generally", "home", "lender", "market", "markets", "network", "officers", "paid", "planning", "policy", "process", "processes", "research", "risk", "specialized", "specific"....
0.300
addressingappliesconstructioncontrolcreateengineersenvironmentalimpactindustriallawlicensinglocalmaintainmanagementmunicipalnatureplansprofessionalprotectpublic
SHARED TOKENS (33): "addressing", "applies", "construction", "control", "create", "engineers", "environmental", "impact", "industrial", "law", "licensing", "local", "maintain", "management", "municipal", "nature", "plans", "professional", "protect", "public"....
0.300
accordingaccountactagencybankbankingbillioncapitalchargescommercialcommonconditionsconsumerconsumersfederalfinancingfunctionsfundgovernmentincreased
SHARED TOKENS (36): "according", "account", "act", "agency", "bank", "banking", "billion", "capital", "charges", "commercial", "common", "conditions", "consumer", "consumers", "federal", "financing", "functions", "fund", "government", "increased"....
0.300
acquisitionacquisitionsactanotherassetsbusinesscapitalcentralconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirectentitiesentityfederalgoverned
SHARED TOKENS (43): "acquisition", "acquisitions", "act", "another", "assets", "business", "capital", "central", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "entities", "entity", "federal", "governed"....
0.300
actagencyamongauthoritybankbankingcombinationcommercialfederalfirmformgroupinstitutionlargelaterlawmarketmemberpdfregulatory
SHARED TOKENS (23): "act", "agency", "among", "authority", "bank", "banking", "combination", "commercial", "federal", "firm", "form", "group", "institution", "large", "later", "law", "market", "member", "pdf", "regulatory"....
0.300
agencyanotherassetsbankbillioncommercialcommonlydifferentestategenerallygovernmentgroupissuemarketobligationsofficepaidperiodsprincipalpriority
SHARED TOKENS (35): "agency", "another", "assets", "bank", "billion", "commercial", "commonly", "different", "estate", "generally", "government", "group", "issue", "market", "obligations", "office", "paid", "periods", "principal", "priority"....
0.300
establishestateformhomelandmarketprocesspropertyrealreportreportsrolesalevaluationvalue
SHARED TOKENS (15): "establish", "estate", "form", "home", "land", "market", "process", "property", "real", "report", "reports", "role", "sale", "valuation", "value".
0.300
agencyapprovedaroundcommitteedepartmenteducationenforcementengineersenvironmentalestablishingfederalgovernmentindependentinformationjulylegallocalmattersnationaloperation
SHARED TOKENS (29): "agency", "approved", "around", "committee", "department", "education", "enforcement", "engineers", "environmental", "establishing", "federal", "government", "independent", "information", "july", "legal", "local", "matters", "national", "operation"....
0.300
applycommercialcommoncommonlycurrentdescribingestatefeaturesfinallargelongermarketmeanmonthsnecessarilyownerperiodsprincipalpropertyprovisions
SHARED TOKENS (27): "apply", "commercial", "common", "commonly", "current", "describing", "estate", "features", "final", "large", "longer", "market", "mean", "months", "necessarily", "owner", "periods", "principal", "property", "provisions"....
0.300
affectinganalysisapplicationbusinesschangesdemandestatefinancemarketsrealrelatedresearchresidentialsupplyurban
SHARED TOKENS (15): "affecting", "analysis", "application", "business", "changes", "demand", "estate", "finance", "markets", "real", "related", "research", "residential", "supply", "urban".
0.300
agriculturearoundassessmentsbillioncapacitycentralchangechangesconditionscontextcurrentdemanddevelopmentdifferentenvironmentalexpandingexpansionexperienceflowfunction
SHARED TOKENS (46): "agriculture", "around", "assessments", "billion", "capacity", "central", "change", "changes", "conditions", "context", "current", "demand", "development", "different", "environmental", "expanding", "expansion", "experience", "flow", "function"....
0.300
administersaffordablebusinesscommunitydevelopmentdistrictimpactindependentleadershiplocalmitigationnationalnetworknonprofitpreserveprofessionalprogramresearchruralserving
SHARED TOKENS (24): "administers", "affordable", "business", "community", "development", "district", "impact", "independent", "leadership", "local", "mitigation", "national", "network", "nonprofit", "preserve", "professional", "program", "research", "rural", "serving"....
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
additionalapplicationapprovedconstructioncurrentlydepartmentdirectlyeligiblefeefinancinghomeimprovementslargerlimitpaidpercentprivateprogrampropertiesproperty
SHARED TOKENS (29): "additional", "application", "approved", "construction", "currently", "department", "directly", "eligible", "fee", "financing", "home", "improvements", "larger", "limit", "paid", "percent", "private", "program", "properties", "property"....
0.300
analysiscommercialcostsdefinitionsdependsdevelopeddevelopmentdifferentincreaseindustriallandpolicypreviouslyrequirerequiresrisksitespecializedstudy
SHARED TOKENS (19): "analysis", "commercial", "costs", "definitions", "depends", "developed", "development", "different", "increase", "industrial", "land", "policy", "previously", "require", "requires", "risk", "site", "specialized", "study".
0.300
acquisitionavailabilityclaimsconsumerdependsfeesformerinstitutionsitemslargelawlegallendernationalperiodsprincipalprocedurespropertypublicpurchase
SHARED TOKENS (29): "acquisition", "availability", "claims", "consumer", "depends", "fees", "former", "institutions", "items", "large", "law", "legal", "lender", "national", "periods", "principal", "procedures", "property", "public", "purchase"....
0.300
administrationagencybillioncostsdepartmenteducationeligibleemergencyestablishedestimatedexpandedfacilitiesfederalfuturegovernmenthomelong-termmembernationalprogram
SHARED TOKENS (21): "administration", "agency", "billion", "costs", "department", "education", "eligible", "emergency", "established", "estimated", "expanded", "facilities", "federal", "future", "government", "home", "long-term", "member", "national", "program"....
0.300
administrationagencyauthoritydepartmentdevelopmententitiesexpandedfederalfinancehomeindependentlegalofficeplaceregulatesregulatoryroleseparatestructuresystem
SHARED TOKENS (21): "administration", "agency", "authority", "department", "development", "entities", "expanded", "federal", "finance", "home", "independent", "legal", "office", "place", "regulates", "regulatory", "role", "separate", "structure", "system"....
0.300
affectagricultureanalysisanalyzedapplicationboundarycharacteristicscontaminationdifferentedgeinteractionlandmakingmanagementmodelnatureprotectionpublicqualityrather
SHARED TOKENS (28): "affect", "agriculture", "analysis", "analyzed", "application", "boundary", "characteristics", "contamination", "different", "edge", "interaction", "land", "making", "management", "model", "nature", "protection", "public", "quality", "rather"....
0.300
accountingaffectingamongcapacityconstructedconstructioncreatingdemanddirectenvironmentalimpactincreasedlandlargelossmakingpopulationprincipallyprovideregion
SHARED TOKENS (28): "accounting", "affecting", "among", "capacity", "constructed", "construction", "creating", "demand", "direct", "environmental", "impact", "increased", "land", "large", "loss", "making", "population", "principally", "provide", "region"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeagriculturalbusinesscatalogcharacteristicscommercialdatedevelopedfacilitiesgenerallygrowthhomeimprovementsincreasingindependentlargelargerlibrarymaintainsmaterials
SHARED TOKENS (31): "active", "agricultural", "business", "catalog", "characteristics", "commercial", "date", "developed", "facilities", "generally", "growth", "home", "improvements", "increasing", "independent", "large", "larger", "library", "maintains", "materials"....
0.300
actapplicableappliescodecommonlyconcerningdevelopmentdifferentenforcementexpandedfederalfinancinglawmakesmembernationalorganizedparticipateprivateprograms
SHARED TOKENS (30): "act", "applicable", "applies", "code", "commonly", "concerning", "development", "different", "enforcement", "expanded", "federal", "financing", "law", "makes", "member", "national", "organized", "participate", "private", "programs"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
analysisconsumersdatadepartmentsdeterminefilesfinancegovernmentindividualinformationpotentialprimarilyratereportrisksources
SHARED TOKENS (16): "analysis", "consumers", "data", "departments", "determine", "files", "finance", "government", "individual", "information", "potential", "primarily", "rate", "report", "risk", "sources".
0.300
buildingcharacteristicsconditionscontainingcreatesevengenerallymaterialspersonnelphysicalpropertypublicregulationsriskspecificsubjectsystemthem
SHARED TOKENS (18): "building", "characteristics", "conditions", "containing", "creates", "even", "generally", "materials", "personnel", "physical", "property", "public", "regulations", "risk", "specific", "subject", "system", "them".
0.300
accountadministrationagenciesagencyassetscentralcommercialcommunitydevelopmentfederalfundgovernmentholdersindependentinstitutionsnationaloperatesoperatingoperationsprovide
SHARED TOKENS (21): "account", "administration", "agencies", "agency", "assets", "central", "commercial", "community", "development", "federal", "fund", "government", "holders", "independent", "institutions", "national", "operates", "operating", "operations", "provide"....
0.300
actaddressingadequateagenciesagreementsassessmentschangecommoncomplianceconcerningcontroldevelopmentenforcementenvironmentalestablishgrowthimpactintersectsinvolvingjudicial
SHARED TOKENS (39): "act", "addressing", "adequate", "agencies", "agreements", "assessments", "change", "common", "compliance", "concerning", "control", "development", "enforcement", "environmental", "establish", "growth", "impact", "intersects", "involving", "judicial"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcommercialcommondetermineflowmodernoutsidepracticeprocesspublicregisterrequiredrequirementsresidentialstandardssupplysystemtypesvolume
SHARED TOKENS (22): "association", "building", "commercial", "common", "determine", "flow", "modern", "outside", "practice", "process", "public", "register", "required", "requirements", "residential", "standards", "supply", "system", "types", "volume"....
0.300
Financial literacy ↗ KW CROSS HIGH
agenciesauthoritycannotcommoncostsdecisionsdevelopmenteducationestablishedfinancefuturegovernmentindividualinformationmanagenationalprogramsprojectprovideresearch
SHARED TOKENS (24): "agencies", "authority", "cannot", "common", "costs", "decisions", "development", "education", "established", "finance", "future", "government", "individual", "information", "manage", "national", "programs", "project", "provide", "research"....
0.300
Home equity loan ↗ KW CROSS HIGH
actualcannotcollateralcollegecreateseducationfinancehistoryhomeinstitutionlawlenderlimitlineslongerplacepropertypurchaseraterequire
SHARED TOKENS (24): "actual", "cannot", "collateral", "college", "creates", "education", "finance", "history", "home", "institution", "law", "lender", "limit", "lines", "longer", "place", "property", "purchase", "rate", "require"....
0.300
actagenciesagencyapplyaroundassessmentsauthoritydecisionsenvironmentalestablishedfederalfinalgovernmentimpactlawnationalpolicypotentialpreservequality
SHARED TOKENS (26): "act", "agencies", "agency", "apply", "around", "assessments", "authority", "decisions", "environmental", "established", "federal", "final", "government", "impact", "law", "national", "policy", "potential", "preserve", "quality"....
0.300
accessbestcannotcharacteristicscommunicationscontrolcostsdifferententityfederalformsgovernmentinfrastructureinstitutionissuelargelineslocalmaintainsmarket
SHARED TOKENS (37): "access", "best", "cannot", "characteristics", "communications", "control", "costs", "different", "entity", "federal", "forms", "government", "infrastructure", "institution", "issue", "large", "lines", "local", "maintains", "market"....
0.300
actaffectagriculturalanotherapplicationschangecommercialcurrentdemanddevelopmentfuturegrowthimprovementsincreasedirrigationlocallossmakesmanagemanagement
SHARED TOKENS (33): "act", "affect", "agricultural", "another", "applications", "change", "commercial", "current", "demand", "development", "future", "growth", "improvements", "increased", "irrigation", "local", "loss", "makes", "manage", "management"....
0.300
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbridgebusinesscommonconventionalcostsdocumentationfeesfinancefinancinggenerallyindividuallargerlenderpendingperiodraterequirerisk
SHARED TOKENS (22): "additional", "applications", "bridge", "business", "common", "conventional", "costs", "documentation", "fees", "finance", "financing", "generally", "individual", "larger", "lender", "pending", "period", "rate", "require", "risk"....
0.300
annualcompareconsumerdefinitionseffectivefeefinanceformintendedlegalprotectionrateratherrequiredstandardized
SHARED TOKENS (15): "annual", "compare", "consumer", "definitions", "effective", "fee", "finance", "form", "intended", "legal", "protection", "rate", "rather", "required", "standardized".
0.300
Pollution ↗ Q58734 KW CROSS HIGH
agenciesagriculturalagriculturealongsideapproximatelyaroundboundariesconcentratedconstructioncontaminationcoredevelopmentenvironmentalformformationformsgenerallyhistoricallyimpactincreasing
SHARED TOKENS (41): "agencies", "agricultural", "agriculture", "alongside", "approximately", "around", "boundaries", "concentrated", "construction", "contamination", "core", "development", "environmental", "form", "formation", "forms", "generally", "historically", "impact", "increasing"....
0.300
actactiveagenciesapproximatelyauthorityauthorizedbillionbuildingbusinesscapacityconductconstructioncontroldepartmentdirectdirectlydutieseastengineersenvironmental
SHARED TOKENS (60): "act", "active", "agencies", "approximately", "authority", "authorized", "billion", "building", "business", "capacity", "conduct", "construction", "control", "department", "direct", "directly", "duties", "east", "engineers", "environmental"....
0.300
administrationaffordableagenciesagricultureassociationcollateralcostsdepartmentdevelopmenteffectiveevenfederalfinancinggovernmenthomehomeownersnationalofficeprimarilyprivately
SHARED TOKENS (27): "administration", "affordable", "agencies", "agriculture", "association", "collateral", "costs", "department", "development", "effective", "even", "federal", "financing", "government", "home", "homeowners", "national", "office", "primarily", "privately"....
0.300
adaboisecentralconnectedcontainsidahoitselfmetropolitannationalpopulationruralsectionstarvalleywestern
SHARED TOKENS (15): "ada", "boise", "central", "connected", "contains", "idaho", "itself", "metropolitan", "national", "population", "rural", "section", "star", "valley", "western".
0.300
actagenciesamonganotherapproximatelybankingbillionbroaderchangesconsumersdifferentdomesticestimatedevenflowgovernmentincreaseinstitutionsinstrumentsleast
SHARED TOKENS (29): "act", "agencies", "among", "another", "approximately", "banking", "billion", "broader", "changes", "consumers", "different", "domestic", "estimated", "even", "flow", "government", "increase", "institutions", "instruments", "least"....
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalanotherapplicationscontainingdemanddevelopmentdifferentenvironmentalequipmentfacilitiesfootprinthistoricalinfrastructurelandmanagementmodernmovemovingplaceplaces
SHARED TOKENS (30): "agricultural", "another", "applications", "containing", "demand", "development", "different", "environmental", "equipment", "facilities", "footprint", "historical", "infrastructure", "land", "management", "modern", "move", "moving", "place", "places"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbusinesscapitalchaincomplyconditionscontrollingcorporatedirectentityexpansionfeesgrowthindividuallargelegallicenseslicensingmarketmodel
SHARED TOKENS (30): "another", "business", "capital", "chain", "comply", "conditions", "controlling", "corporate", "direct", "entity", "expansion", "fees", "growth", "individual", "large", "legal", "licenses", "licensing", "market", "model"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedcommoncommonlyconnectdevelopmenteasementsevenexpandedfeefinalfunctionsgovernmentimpactincreasedlandlaterlegal
SHARED TOKENS (40): "acquisition", "another", "application", "authorized", "common", "commonly", "connect", "development", "easements", "even", "expanded", "fee", "final", "functions", "government", "impact", "increased", "land", "later", "legal"....
0.300
addressingaffectagriculturalagriculturecentralchangechangesconcentratedcontaminationdevelopmentdirectenterenvironmentalfieldsimpactinterestslandlargelocalmanagement
SHARED TOKENS (34): "addressing", "affect", "agricultural", "agriculture", "central", "change", "changes", "concentrated", "contamination", "development", "direct", "enter", "environmental", "fields", "impact", "interests", "land", "large", "local", "management"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
additionaladministrationagencyagricultureapplicationapprovedbeyondchangeclassificationconditionsconsumercurrentlydefinesdepartmentemploymentestimatedfeegrowthholdersimplementation
SHARED TOKENS (35): "additional", "administration", "agency", "agriculture", "application", "approved", "beyond", "change", "classification", "conditions", "consumer", "currently", "defines", "department", "employment", "estimated", "fee", "growth", "holders", "implementation"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalchangescontroldescribeddevelopmentexpansionfinancefinancingfirmfundgenerallong-termmanagementoperationalotherwiseownershipprivateprovide
SHARED TOKENS (25): "active", "business", "capital", "changes", "control", "described", "development", "expansion", "finance", "financing", "firm", "fund", "general", "long-term", "management", "operational", "otherwise", "ownership", "private", "provide"....
0.300
agenciesconstructiondepartmentsdistinguishgovernmentinfrastructurelocallymunicipalnationalphysicalplaceprivateprofessionalpublicsectorsystemsworks
SHARED TOKENS (17): "agencies", "construction", "departments", "distinguish", "government", "infrastructure", "locally", "municipal", "national", "physical", "place", "private", "professional", "public", "sector", "systems", "works".
0.300
boisebureaucapacitydistrictflatidahoirrigationlistednampanationalplaceplacesprogramprojectprovideregistertreasurevalleywaterwestern
SHARED TOKENS (20): "boise", "bureau", "capacity", "district", "flat", "idaho", "irrigation", "listed", "nampa", "national", "place", "places", "program", "project", "provide", "register", "treasure", "valley", "water", "western".
0.300
associatedbankcommercialdateestatefuturehomelatermakingmarketprocesspropertyrealremainresidentialvalue
SHARED TOKENS (16): "associated", "bank", "commercial", "date", "estate", "future", "home", "later", "making", "market", "process", "property", "real", "remain", "residential", "value".
0.300
agencycurrentdatadepartmentfederalgovernmentheadquarteredlandscapemakespublicregulatoryresearchresourcesstudywhosework
SHARED TOKENS (16): "agency", "current", "data", "department", "federal", "government", "headquartered", "landscape", "makes", "public", "regulatory", "research", "resources", "study", "whose", "work".
0.300
Bankruptcy ↗ Q152074 EXACT TITLE
cannotentitieslegalprocessstatus
SHARED TOKENS (5): "cannot", "entities", "legal", "process", "status". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.300
accessaddressagreementsalonealteramongassociatedavailabilitybecomechangesconditionscontrolcorporatecrossdescribingeastgovernmenthistoryindividualinstitutions
SHARED TOKENS (42): "access", "address", "agreements", "alone", "alter", "among", "associated", "availability", "become", "changes", "conditions", "control", "corporate", "cross", "describing", "east", "government", "history", "individual", "institutions"....
0.300
affordableamongassetsestateincreaseinvolvinglargelargermakingmarketparticipateperiodrealreal-estatetypes
SHARED TOKENS (15): "affordable", "among", "assets", "estate", "increase", "involving", "large", "larger", "making", "market", "participate", "period", "real", "real-estate", "types".
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscompletecompletedconnectedcoursecurrenteastestablishedformidahoimprovementsmakingmodernorganizedpointseparateterritoryvalleywestwestern
SHARED TOKENS (20): "business", "complete", "completed", "connected", "course", "current", "east", "established", "form", "idaho", "improvements", "making", "modern", "organized", "point", "separate", "territory", "valley", "west", "western".
🫐 BERRY57 edges
0.280
agenciesconventionalfeesincreasingindividuallargelargerlenderlimitpurchasequalityresidentialthemvalue
SHARED TOKENS (14): "agencies", "conventional", "fees", "increasing", "individual", "large", "larger", "lender", "limit", "purchase", "quality", "residential", "them", "value".
0.280
actaddressauthorizedcapitalcommonlygovernmentincreasingintendedlargemarketpracticespressureprimarilyregulations
SHARED TOKENS (14): "act", "address", "authorized", "capital", "commonly", "government", "increasing", "intended", "large", "market", "practices", "pressure", "primarily", "regulations".
0.280
bankbroadercollateraldocumentationinstitutionslargelenderlimitnatureprivatepropertyreal-estaterequirestatus
SHARED TOKENS (14): "bank", "broader", "collateral", "documentation", "institutions", "large", "lender", "limit", "nature", "private", "property", "real-estate", "require", "status".
0.280
actagenciesbureauconsumerconsumersdatafederalfilesinformationintendedprivateprotectionregulatesreports
SHARED TOKENS (14): "act", "agencies", "bureau", "consumer", "consumers", "data", "federal", "files", "information", "intended", "private", "protection", "regulates", "reports".
0.280
agencyassociationidahointegrated
SHARED TOKENS (4): "agency", "association", "idaho", "integrated". | EXACT TITLE in water_rights: "Idaho State Bar".
0.280
contaminationdemanddistributionfailflowmaintainedpressureprotectreducedsourcessuppliessystemsystemswater
SHARED TOKENS (14): "contamination", "demand", "distribution", "fail", "flow", "maintained", "pressure", "protect", "reduced", "sources", "supplies", "system", "systems", "water".
0.280
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthomememberprogramreportsurban
SHARED TOKENS (14): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "government", "home", "member", "program", "reports", "urban".
0.260
accordingcommunitydirectdistrictestategeographicidentifiedprojectpublicratherrealreceivedspecific
SHARED TOKENS (13): "according", "community", "direct", "district", "estate", "geographic", "identified", "project", "public", "rather", "real", "received", "specific".
0.260
agriculturaldoctrineindustriallegalmerelyownershipperiodpriorpurposerightssourcesystemwater
SHARED TOKENS (13): "agricultural", "doctrine", "industrial", "legal", "merely", "ownership", "period", "prior", "purpose", "rights", "source", "system", "water".
0.260
Alfalfa ↗ Q156106 EXACT TITLE
aroundcommonlysouth
SHARED TOKENS (3): "around", "commonly", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.260
actamongapplychangeschaptercodeconsumerconsumerslawpdfprotectionprovisionssigned
SHARED TOKENS (13): "act", "among", "apply", "changes", "chapter", "code", "consumer", "consumers", "law", "pdf", "protection", "provisions", "signed".
0.260
accessbankcollateralextendsfinancemaintainmarketotherwisepracticeprovisionqualityriskuniversity
SHARED TOKENS (13): "access", "bank", "collateral", "extends", "finance", "maintain", "market", "otherwise", "practice", "provision", "quality", "risk", "university".
0.250
currentgovernmentidahoofficeofficers
SHARED TOKENS (5): "current", "government", "idaho", "office", "officers". | URL->B (1): https://sos.idaho.gov/.
0.240
Mobile home ↗ Q1434998 KW CROSS HIGH
differenthomelegalmoveplaceprimarilyrequiredsharesitestructuretemporarywork
SHARED TOKENS (12): "different", "home", "legal", "move", "place", "primarily", "required", "share", "site", "structure", "temporary", "work".
0.240
aroundbureauchangedcontainseastexpandednorthwestpacificsouthsouthwestwestwestern
SHARED TOKENS (12): "around", "bureau", "changed", "contains", "east", "expanded", "northwest", "pacific", "south", "southwest", "west", "western".
0.240
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturaldivisioneastflowsidaholargernationalprimarilysectionsouthvalleywest
SHARED TOKENS (12): "agricultural", "division", "east", "flows", "idaho", "larger", "national", "primarily", "section", "south", "valley", "west".
0.240
controldistinctgoverninglawownershippropertyqualityregulationsrelatedresourceresourceswater
SHARED TOKENS (12): "control", "distinct", "governing", "law", "ownership", "property", "quality", "regulations", "related", "resource", "resources", "water".
0.240
capitalcommercialconventionalestatefinancingprivatepropertyrealresidentialriskshort-termspecific
SHARED TOKENS (12): "capital", "commercial", "conventional", "estate", "financing", "private", "property", "real", "residential", "risk", "short-term", "specific".
0.240
boundariesconveyancedeeddescribeddescriptionlandlawlegalpropertyrealrequiredspecific
SHARED TOKENS (12): "boundaries", "conveyance", "deed", "described", "description", "land", "law", "legal", "property", "real", "required", "specific".
0.240
aroundcreatingeffectiveequipmentfieldsirrigatedirrigationlandlargesectionsystemswater
SHARED TOKENS (12): "around", "creating", "effective", "equipment", "fields", "irrigated", "irrigation", "land", "large", "section", "systems", "water".
0.220
accordingformsgenerallyraterealremainsrisksingletypesunlessvalue
SHARED TOKENS (11): "according", "forms", "generally", "rate", "real", "remains", "risk", "single", "types", "unless", "value".
0.220
amongcommondetermineslandlaworganizedownershippropertyrightssystemwater
SHARED TOKENS (11): "among", "common", "determines", "land", "law", "organized", "ownership", "property", "rights", "system", "water".
0.220
additionalflathomememberobtainprincipalpropertyprovideresidentialseparatesupport
SHARED TOKENS (11): "additional", "flat", "home", "member", "obtain", "principal", "property", "provide", "residential", "separate", "support".
0.220
directlyirrigationmaintainednetworkoperatedplacepotentialsystemsystemstypeswater
SHARED TOKENS (11): "directly", "irrigation", "maintained", "network", "operated", "place", "potential", "system", "systems", "types", "water".
0.220
allocationbusinessdifferentestateitemslandmarketrealreal-estateresidentialsingle
SHARED TOKENS (11): "allocation", "business", "different", "estate", "items", "land", "market", "real", "real-estate", "residential", "single".
0.220
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastidahometropolitanpopulationschoolsstarwest
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "east", "idaho", "metropolitan", "population", "schools", "star", "west".
0.220
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturalagriculturedifferentidaholandprocessingproductionrepresentsrolesalesector
SHARED TOKENS (11): "agricultural", "agriculture", "different", "idaho", "land", "processing", "production", "represents", "role", "sale", "sector".
0.220
Maize ↗ Q11575 KW CROSS HIGH
alongsideannualbecomebillioncommercialcontainsincreasedmodernproductiontreatmentuses
SHARED TOKENS (11): "alongside", "annual", "become", "billion", "commercial", "contains", "increased", "modern", "production", "treatment", "uses".
0.200
Abandon ↗ Q397584 EXACT TITLE
abandonabandonedabandonment
EXACT TITLE in water_rights: "Abandon".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
agencyboisebureaudepartmentgovernmentidahonationalpotentialprotectstaff
SHARED TOKENS (10): "agency", "boise", "bureau", "department", "government", "idaho", "national", "potential", "protect", "staff".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
forfeiture
EXACT TITLE in water_rights: "Forfeit".
0.200
actchaptercodedevelopmentfederallawpurposeregulationtitlewater
SHARED TOKENS (10): "act", "chapter", "code", "development", "federal", "law", "purpose", "regulation", "title", "water".
0.200
Trailer park ↗ Q1426493 KW CROSS HIGH
communityconstructioncoursehomemodernmovingparksplacestatustemporary
SHARED TOKENS (10): "community", "construction", "course", "home", "modern", "moving", "parks", "place", "status", "temporary".
0.200
buildingcommonlyestatelenderpropertypurchaserealtransactionvaluationvalue
SHARED TOKENS (10): "building", "commonly", "estate", "lender", "property", "purchase", "real", "transaction", "valuation", "value".
0.180
commondistributionfloodformirrigationmanagementpracticesthereforewater
SHARED TOKENS (9): "common", "distribution", "flood", "form", "irrigation", "management", "practices", "therefore", "water".
0.180
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationruralwestern
SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "rural", "western".
0.180
chaptercodecommonfederalformprocesssectionstatutetitle
SHARED TOKENS (9): "chapter", "code", "common", "federal", "form", "process", "section", "statute", "title".
0.180
constructiondateitselflabormaterialsnamespropertyrealtitle
SHARED TOKENS (9): "construction", "date", "itself", "labor", "materials", "names", "property", "real", "title".
0.160
associatedexaminationhistoryidahonorthwestpacificwestwestern
SHARED TOKENS (8): "associated", "examination", "history", "idaho", "northwest", "pacific", "west", "western".
0.140
USDA home loan ↗ KW CROSS HIGH
agriculturedepartmentdevelopmenthomeprogrampropertyrural
SHARED TOKENS (7): "agriculture", "department", "development", "home", "program", "property", "rural".
0.140
agriculturaleastflatidaholandnorthwestprimarily
SHARED TOKENS (7): "agricultural", "east", "flat", "idaho", "land", "northwest", "primarily".
0.140
establishedfebruaryidahomakingpopulationregionsource
SHARED TOKENS (7): "established", "february", "idaho", "making", "population", "region", "source".
0.140
affectingdeedgenerallegallenderoutsideprocess
SHARED TOKENS (7): "affecting", "deed", "general", "legal", "lender", "outside", "process".
0.140
doctrinelinesownershipprivatepropertypublicresources
SHARED TOKENS (7): "doctrine", "lines", "ownership", "private", "property", "public", "resources".
0.140
costslenderprivatepropertypurposerequiredsale
SHARED TOKENS (7): "costs", "lender", "private", "property", "purpose", "required", "sale".
0.140
Lateral canal ↗ Q6495566 KW CROSS HIGH
anothercourseexistingfloodperiodsprovidewater
SHARED TOKENS (7): "another", "course", "existing", "flood", "periods", "provide", "water".
0.140
determinefloodlosspropertiespropertyriskspecific
SHARED TOKENS (7): "determine", "flood", "loss", "properties", "property", "risk", "specific".
0.140
Water table ↗ Q3342272 KW CROSS HIGH
actualdependentflowincreasingmaterialspressurewater
SHARED TOKENS (7): "actual", "dependent", "flow", "increasing", "materials", "pressure", "water".
0.140
estateformfunctionshomeownerrealstatus
SHARED TOKENS (7): "estate", "form", "functions", "home", "owner", "real", "status".
0.140
agencycontinuingdepartmentfederalgovernmentmanagementprotect
SHARED TOKENS (7): "agency", "continuing", "department", "federal", "government", "management", "protect".
0.140
Negative equity ↗ KW CROSS HIGH
assetsestatehomeownersownerrealvaluewhose
SHARED TOKENS (7): "assets", "estate", "homeowners", "owner", "real", "value", "whose".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
demandenvironmentalphysicalpracticesupplieswater
SHARED TOKENS (6): "demand", "environmental", "physical", "practice", "supplies", "water".
0.100
finalidahojulyorganizedterritory
SHARED TOKENS (5): "final", "idaho", "july", "organized", "territory".
0.100
Peppermint ↗ Q156037 KW CROSS HIGH
amongcrosseastsourceswestern
SHARED TOKENS (5): "among", "cross", "east", "sources", "western".
0.100
anotherconvertperiodpreviouslyprincipal
SHARED TOKENS (5): "another", "convert", "period", "previously", "principal".
◈ Frequently Asked Questions
Water Rights × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
Why do lenders in Ada County, Idaho require water right documentation before approving residential mortgages?
Lenders in Ada County verify that properties have enforceable water rights from either the Boise River or groundwater wells because mortgage underwriting standards mandate confirmation of essential utilities. A property in Boise or Eagle without documented water rights represents an uninsurable title defect that violates standard lending requirements for residential real estate.
How do adjudicated water rights affect property values and mortgage eligibility in the Treasure Valley?
Adjudicated water rights in Ada County establish senior claims to surface water or groundwater, directly increasing property collateral value for mortgage lenders. Properties in Nampa or Boise with confirmed water rights allocations from state records qualify for standard financing, while properties with junior or contested rights typically face higher loan costs or denial.
What happens to a mortgage when urban sprawl in the Treasure Valley reduces available groundwater for wells?
When rapid real estate development depletes groundwater supplies in Ada County or Eagle, existing mortgages may face refinancing complications if well-dependent properties lose water access. Lenders conduct periodic reviews of water availability on mortgaged properties, and diminished groundwater can trigger reappraisals that reduce loan-to-value ratios for residential borrowers.
Can zoning changes for residential development in Boise or Nampa affect mortgage terms related to water rights?
When Ada County or city planners rezone land for residential development, the underlying water rights allocation must be verified against new property boundaries before lenders will approve mortgages. Zoning changes that increase population density in Boise or Nampa require lenders to confirm that existing water rights from the Boise River or groundwater sources support the new residential use.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Water Rights × Mortgage Lending 20 QID bridges 266 edges 6,388 ext links 2026-07-17 23:59:09 UTC 7eb9969419209848
Water Rights corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Water Rights ↗ boisestandard.org/standard ↗
Parent Corridors
Water Rights × All Other Verticals