—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Water Rights ↔ relates to ↔ Childcare Family

12 Wikipedia bridge articles confirmed in both vertical ledgers. 251 deterministic cross-vertical edges. 6,644 external source links harvested. Every edge provenance-stamped. Every claim auditable.

12 QID Bridge Articles
251 Cross Edges
6,644 External Sources
283 Wikipedia Articles
13 🌲 Evergreen
182 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Water Rights
× Childcare Family
QID Bridge Articles
12
confirmed Wikipedia overlap
Total Cross Edges
251
External Sources Harvested
6,644
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.0000  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (12)
Boise State UniversityTreasure ValleyAdministrative lawBoise, IdahoReal estate developmentNampa, IdahoAda County, IdahoStar, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadacanyoncollegepubliccapitalestimatedhomeamongdivisioneducationprogramuniversitylandlocallowerrivertreasure
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:55:18 UTC
Content Hash
bd8b2b0212526821
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
12 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in water_rights (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (17): "among", "boise", "business", "college", "division", "education", "engineering", "health", "idaho", "independent", "institution", "program", "programs", "public", "reported", "research", "university". | EXACT TITLE in water_rights: "Boise State University". | EXACT TITLE in childcare_family: "Boise State University".
amongboisebusinesscollegedivisioneducationengineeringhealthidahoindependentinstitutionprogramprogramspublicreportedresearchuniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in water_rights (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "historically", "idaho", "land", "local", "lower", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Treasure Valley". | EXACT TITLE in childcare_family: "Treasure Valley".
associationboisehistoricallyidaholandlocallowerregionresourcesriverruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
A
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (29): "administration", "administrative", "agencies", "another", "built", "century", "changes", "control", "created", "decisions", "division", "economic", "education", "enforcement", "expanded", "generally", "governing", "increase", "itself", "law"....
administrationadministrativeagenciesanotherbuiltcenturychangescontrolcreateddecisionsdivisioneconomiceducationenforcementexpandedgenerallygoverningincreaseitselflawlegalmodelpublicregulatereviewrulessectorstructuresystem
In the last fifty years, administrative law, in many countries of the civil law tradition, has opened itself to the influence of rules posed by supranational legal orders, in which judicial principles have strong importance: it has led, for one, to changes in some traditional concepts of the administrative law model, as has happened with the public procurements or with judicial control of administrative activity and, for another, has built a supranational or international public administration, as in the environmental sector or with reference to education, for which, within the United Nations' system, it has been possible to assist to a further increase of administrative structure devoted to coordinate the States' activity in that sector.
In Brazil, administrative cases are typically heard either by the Federal Courts (in matters concerning the Federal Union) or by the Public Treasury divisions of State Courts (in matters concerning the States). In 1998 a constitutional reform led by the government of President Fernando Henrique Cardoso introduced regulatory agencies as a part of the executive branch. Since 1988, Brazilian administrative law has been strongly influenced by the judicial interpretations of the constitutional principles of public administration (Art. 37 of the Federal Constitution): legality, impersonality, publicity of administrative acts, morality and efficiency. Chile In Chile, the President of the Republic exercises the administrative function, in collaboration with several ministries or other authorities with ministerial rank. Each ministry has one or more under-secretaries that act through public service to meet public needs.
Germany In Germany, administrative law (German: Verwaltungsrecht) includes all law that specifically governs the legal relationships between public authorities and private persons, and that is not more precisely described as constitutional law. It sets out the tasks, aims and powers, as well as the organization and procedure, for all public authorities (German: Behörden). As a field of legal study, administrative law has been differentiated from other branches of public law since the late 19th century in Germany; the precise delimitations of "administration" as a concept, however, are in contention. Administrative law defines all aspects of public administration in the modern German state, whose legal culture emphasizes private persons' subjective rights (also, pursuant to art. 19IV of the current German Constitution of 1949, such rights must be fully justiciable).
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "counties", "estimated", "home", "idaho", "level", "locally", "major", "population", "river", "treasure", "valley".
adaannualboisecapitalcountiesestimatedhomeidaholevellocallymajorpopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Real estate development
Q695829 QID OVERLAP 0.800
QID OVERLAP: Q695829 in water_rights (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (42): "act", "approval", "approvals", "approved", "building", "commercial", "construction", "context", "costs", "creates", "creation", "design", "developers", "development", "different", "economic", "estate", "financing", "growth", "increase"....
actapprovalapprovalsapprovedbuildingcommercialconstructioncontextcostscreatescreationdesigndevelopersdevelopmentdifferenteconomicestatefinancinggrowthincreaselandleasinglowermarketingobtainpermitsplanningprocessprogramproperty+12
ersee construction or renovation. Developers usually take significant financial risks in the creation or renovation of real estate and receive the greatest rewards. Typically, developers purchase a tract of land, determine the marketing of the property, develop the building program and design, obtain the necessary public approval and financing, build the structures, and rent out, manage, and ultimately sell it. Real estate development has been criticized for contributing to urban sprawl and environmental degradation. Supporters argue that development expands housing supply, reduces housing costs, stimulates economic growth and creates jobs.
Some developers only handle part of the process. For example, some developers source a property and get the plans and permits approved before selling the property with the plans and permits to a builder at a premium price. Alternatively, a developer who is also a builder may purchase a property with the plans and permits in place so that they do not have the risk of failing to obtain planning approval and can start construction on the development immediately. Financial difficulties in development and investing differ because of leverage. Developers work with many different counterparts along each step of this process, including architects, city planners, engineers, surveyors, inspectors, contractors, lawyers, leasing agents, etc. In the Town and Country Planning context in the United Kingdom, “development” is defined in the Town and Country Planning Act 1990 s55. Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Nampa, Idaho
Q622633 QID OVERLAP 0.720
QID OVERLAP: Q622633 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (11): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "population", "principal", "university", "western".
boisecanyoncollegehomeidahomeridiannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in water_rights (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "estimated", "home", "idaho", "jurisdiction", "local", "population", "private".
adaboisecapitaldistrictestimatedhomeidahojurisdictionlocalpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.680
QID OVERLAP: Q1516815 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (9): "ada", "boise", "canyon", "century", "district", "idaho", "population", "schools", "star".
adaboisecanyoncenturydistrictidahopopulationschoolsstar
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.580
QID OVERLAP: Q1516870 in water_rights (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (4): "ada", "boise", "idaho", "population".
adaboiseidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
239 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP239 edges
🌲 EVERGREEN2 edges
0.650
adaarmybeganboisebuiltcompletedconstructioncontroldirectlyearlyfederalidaholeveloperatingoperationalprimaryprivatepurposeriverupstream
SHARED TOKENS (21): "ada", "army", "began", "boise", "built", "completed", "construction", "control", "directly", "early", "federal", "idaho", "level", "operating", "operational", "primary", "private", "purpose", "river", "upstream".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
0.610
ageearlyeducationnetworkoperatedoperatesownedownersprivateprogramsproviderprovidingschools
SHARED TOKENS (13): "age", "early", "education", "network", "operated", "operates", "owned", "owners", "private", "programs", "provider", "providing", "schools". | URL->B (1): https://www.roarkcapital.com/files/Primrose-Press_Release.pdf. | EXACT TITLE in childcare_family: "Primrose Schools".
🌿 BRANCH181 edges
0.500
YMCA ↗ Q157169 EXACT TITLE
affiliatedassociationbodydeliverdevelopmentfacilitiesindependentlocalnationalorganizationspracticeprogramsprovidingregionalstaffstatedsubjectwork
SHARED TOKENS (18): "affiliated", "association", "body", "deliver", "development", "facilities", "independent", "local", "national", "organizations", "practice", "programs", "providing", "regional", "staff", "stated", "subject", "work". | EXACT TITLE in childcare_family: "YMCA".
0.500
Orphanage ↗ Q160645 EXACT TITLE
cannotcenterscenturycontroldescribedduefundgenerallygrouphomeincreaseinstitutioninstitutionslegaloperatepopulationrecruitrehabilitationresidentialresponsibility
SHARED TOKENS (25): "cannot", "centers", "century", "control", "described", "due", "fund", "generally", "group", "home", "increase", "institution", "institutions", "legal", "operate", "population", "recruit", "rehabilitation", "residential", "responsibility".... | EXACT TITLE in childcare_family: "Orphanage".
0.500
Well ↗ Q43483 EXACT TITLE
accessageanothercompletedconstructioncontainscreatecreatedhistoricallyleastpointproviderequireresourcesruralsitestructuresupplysurroundingtreatment
SHARED TOKENS (22): "access", "age", "another", "completed", "construction", "contains", "create", "created", "historically", "least", "point", "provide", "require", "resources", "rural", "site", "structure", "supply", "surrounding", "treatment".... | EXACT TITLE in water_rights: "Well". | EXACT TITLE in childcare_family: "Well".
0.500
ageanothercalculatedchaincurrentdifferentenoughevenlevellongermakingprocessratesinglestablethoughtreated
SHARED TOKENS (17): "age", "another", "calculated", "chain", "current", "different", "enough", "even", "level", "longer", "making", "process", "rate", "single", "stable", "though", "treated". | EXACT TITLE in water_rights: "Radionuclide".
0.500
clientsdevelopmentdifferentdirectearlyindividuallong-termrelatedrelationshipsschoolsstudysupportsystemsystemsview
SHARED TOKENS (15): "clients", "development", "different", "direct", "early", "individual", "long-term", "related", "relationships", "schools", "study", "support", "system", "systems", "view". | EXACT TITLE in childcare_family: "Family therapy".
0.500
Land use ↗ Q1165944 EXACT TITLE
anotherbuiltcategoriescategorychangesclassificationdatadescribedirectlyhistoricallylandland-usemajormanagementparcelpracticesprimaryresourcesrisksignificant
SHARED TOKENS (24): "another", "built", "categories", "category", "changes", "classification", "data", "describe", "directly", "historically", "land", "land-use", "major", "management", "parcel", "practices", "primary", "resources", "risk", "significant".... | EXACT TITLE in water_rights: "Land use". | EXACT TITLE in childcare_family: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturearoundassociatedboisecapitalcenturycontainsdistinctearlyeconomygeographicidahoisolatedjulylandnationalofficialperiodspopulationrelatively
SHARED TOKENS (32): "agriculture", "around", "associated", "boise", "capital", "century", "contains", "distinct", "early", "economy", "geographic", "idaho", "isolated", "july", "land", "national", "official", "periods", "population", "relatively".... | EXACT TITLE in water_rights: "Idaho". | EXACT TITLE in childcare_family: "Idaho".
0.500
Parenting ↗ Q1217379 EXACT TITLE
affectassociateddevelopmenteducationalexperienceshistorylegallong-termolderphysicalprocessproviderprovidersreceiverelationshipresearchrolesinglesupports
SHARED TOKENS (19): "affect", "associated", "development", "educational", "experiences", "history", "legal", "long-term", "older", "physical", "process", "provider", "providers", "receive", "relationship", "research", "role", "single", "supports". | EXACT TITLE in childcare_family: "Parenting".
0.500
agecoordinationdesigneddevelopmentdifferentequipmentfacilitiesinstitutionsolderphysicalprovideprovidingpublicrecreationschoolssupporting
SHARED TOKENS (16): "age", "coordination", "designed", "development", "different", "equipment", "facilities", "institutions", "older", "physical", "provide", "providing", "public", "recreation", "schools", "supporting". | EXACT TITLE in childcare_family: "Playground".
0.500
anotherbodydrainageengineeringflowslandplacespointratherriversciencesinglesystemthoughwater
SHARED TOKENS (15): "another", "body", "drainage", "engineering", "flows", "land", "places", "point", "rather", "river", "science", "single", "system", "though", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.500
additionaladequateapplicationsbuiltcapacitycenturyconditionscostcostsdepartmentdistrictestimatedindustrialoccursprocessesratereduceresourcessourcespace
SHARED TOKENS (22): "additional", "adequate", "applications", "built", "capacity", "century", "conditions", "cost", "costs", "department", "district", "estimated", "industrial", "occurs", "processes", "rate", "reduce", "resources", "source", "space".... | EXACT TITLE in water_rights: "Geothermal energy".
0.500
anotherconnecteddesigndesigneddistributionengineeringflowgoverninglocalplacesqualitystudysuppliessystemsystemsthoughwater
SHARED TOKENS (17): "another", "connected", "design", "designed", "distribution", "engineering", "flow", "governing", "local", "places", "quality", "study", "supplies", "system", "systems", "though", "water". | EXACT TITLE in water_rights: "Hydrogeology".
0.500
absenceaffectaffectsamongbroadercommunitycreatedecisionsdefinesdetermineshealthindividuallevelmerelyprofessionalratherrelationshipsrolework
SHARED TOKENS (19): "absence", "affect", "affects", "among", "broader", "community", "create", "decisions", "defines", "determines", "health", "individual", "level", "merely", "professional", "rather", "relationships", "role", "work". | EXACT TITLE in childcare_family: "Mental health".
0.500
Wheat ↗ Q15645384 EXACT TITLE
aroundcenturydemandessentialfoodgeneralgrouplandlargermajormakingpopulationqualityrecordrelativelysource
SHARED TOKENS (16): "around", "century", "demand", "essential", "food", "general", "group", "land", "larger", "major", "making", "population", "quality", "record", "relatively", "source". | EXACT TITLE in water_rights: "Wheat".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturecapacitycentralcontainsdistributionformindustriallandlevelmajormunicipaloperatingpercentprimaryprocessprovidepublicresultssepticshifted
SHARED TOKENS (30): "agriculture", "capacity", "central", "contains", "distribution", "form", "industrial", "land", "level", "major", "municipal", "operating", "percent", "primary", "process", "provide", "public", "results", "septic", "shifted".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamongassociationauthorityconstructioncontractscreateddepartmentestablishedfederalfundlandlawmaintenancemajormeridiannationalprogramprojectprovisions
SHARED TOKENS (27): "act", "among", "association", "authority", "construction", "contracts", "created", "department", "established", "federal", "fund", "land", "law", "maintenance", "major", "meridian", "national", "program", "project", "provisions".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
affectsageagencyamongapprovedclientscommunityconditionscreateddatadecisionsdescribedgeneralgrouphealthhomeinstitutionlegalmakingplacement
SHARED TOKENS (32): "affects", "age", "agency", "among", "approved", "clients", "community", "conditions", "created", "data", "decisions", "described", "general", "group", "health", "home", "institution", "legal", "making", "placement".... | EXACT TITLE in childcare_family: "Foster care".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdevelopmentdifferentformgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulatoryresidentialrulessinglesystemsurban
SHARED TOKENS (22): "allowing", "building", "development", "different", "form", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulatory", "residential", "rules", "single", "systems", "urban".... | EXACT TITLE in water_rights: "Zoning". | EXACT TITLE in childcare_family: "Zoning".
0.500
Living wage ↗ Q543406 EXACT TITLE
additionalauthoritycalculatedcreateddemanddiscoverydueeconomiceconomyemploymentfoodhealthlaborlegalpolicyprogramspurchasingqualityratherrelated
SHARED TOKENS (28): "additional", "authority", "calculated", "created", "demand", "discovery", "due", "economic", "economy", "employment", "food", "health", "labor", "legal", "policy", "programs", "purchasing", "quality", "rather", "related".... | EXACT TITLE in childcare_family: "Living wage".
0.500
abandonmentaccessaccountaffectagenciesarticlebeyondcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationevenfuturehealth
SHARED TOKENS (51): "abandonment", "access", "account", "affect", "agencies", "article", "beyond", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "even", "future", "health".... | EXACT TITLE in childcare_family: "Child protection".
0.500
actagencybuiltdepartmentdevelopmentestablishedfederallawmanagementoperationprogramprovidingprovisionsresourcesourcesupplysurveythroughoutuntilwater
SHARED TOKENS (21): "act", "agency", "built", "department", "development", "established", "federal", "law", "management", "operation", "program", "providing", "provisions", "resource", "source", "supply", "survey", "throughout", "until", "water".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundavailabilitybeganbuildingbuiltcenturyconstructioncreationdesignearlyengineeringflowfunctionsgoverninghealthincorporatedincreaseindustrial
SHARED TOKENS (48): "additional", "application", "around", "availability", "began", "building", "built", "century", "construction", "creation", "design", "early", "engineering", "flow", "functions", "governing", "health", "incorporated", "increase", "industrial".... | EXACT TITLE in water_rights: "Dam". | EXACT TITLE in childcare_family: "Dam".
0.500
Drought ↗ Q43059 EXACT TITLE
affectingagricultureannualavailabilityconditionscostsdirectlydueeconomiceconomyexperiencefoodfuturehealthhistoryincreaseincreasesjulylargerlocal
SHARED TOKENS (31): "affecting", "agriculture", "annual", "availability", "conditions", "costs", "directly", "due", "economic", "economy", "experience", "food", "future", "health", "history", "increase", "increases", "july", "larger", "local".... | EXACT TITLE in water_rights: "Drought".
0.500
adequatechangesdesignedestimatedexperienceformgenerallyidentifyinglegalprimaryprivatepublicstablestandardizedstatustemporaryworkyet
SHARED TOKENS (18): "adequate", "changes", "designed", "estimated", "experience", "form", "generally", "identifying", "legal", "primary", "private", "public", "stable", "standardized", "status", "temporary", "work", "yet". | EXACT TITLE in childcare_family: "Homelessness".
0.500
anotherbodyfacilityindustrialmunicipalon-sitephaseprocessprocessespurposeresultingseparationtreatedtreatmenttypesuseswater
SHARED TOKENS (17): "another", "body", "facility", "industrial", "municipal", "on-site", "phase", "process", "processes", "purpose", "resulting", "separation", "treated", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
adaarmyboisebuiltcanyonchannelcompletedcountiesidahooperatedprimaryrivertreasureupstreamvalleywaterwestern
SHARED TOKENS (17): "ada", "army", "boise", "built", "canyon", "channel", "completed", "counties", "idaho", "operated", "primary", "river", "treasure", "upstream", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.500
administrativecenturycreatecreatescurrentdescribesdevelopmenteconomiceducationessentialgrowthhealthhistoricincreaseinstitutionallandlargerlevelmajormerely
SHARED TOKENS (38): "administrative", "century", "create", "creates", "current", "describes", "development", "economic", "education", "essential", "growth", "health", "historic", "increase", "institutional", "land", "larger", "level", "major", "merely".... | EXACT TITLE in water_rights: "Urbanization".
0.500
acquiredagearoundcentralcenturycollegecostsdescribeddevelopmentearlyeducationeducationalentitiesfederalgoverningincreaselong-termmunicipalpolicypractice
SHARED TOKENS (37): "acquired", "age", "around", "central", "century", "college", "costs", "described", "development", "early", "education", "educational", "entities", "federal", "governing", "increase", "long-term", "municipal", "policy", "practice".... | EXACT TITLE in childcare_family: "Early childhood education".
0.500
agricultureboisecountiesengineeringhistoricidaholevelnationaloperatedprimaryprovidepurposeriverupstreamwaterwestern
SHARED TOKENS (16): "agriculture", "boise", "counties", "engineering", "historic", "idaho", "level", "national", "operated", "primary", "provide", "purpose", "river", "upstream", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.500
Hydrology ↗ Q42250 EXACT TITLE
datadistributiondrainageengineeringmanagementphysicalplanningpolicypreservationqualityrelatedresearchresourcessciencestudywater
SHARED TOKENS (16): "data", "distribution", "drainage", "engineering", "management", "physical", "planning", "policy", "preservation", "quality", "related", "research", "resources", "science", "study", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
agecenterscommunitycoordinationcountiesdesigneddifferentdistrictsearlyeducationeligibleexperienceexperiencesfederalhealthhomeinstructionlegislationlimitedlocally
SHARED TOKENS (38): "age", "centers", "community", "coordination", "counties", "designed", "different", "districts", "early", "education", "eligible", "experience", "experiences", "federal", "health", "home", "instruction", "legislation", "limited", "locally".... | EXACT TITLE in childcare_family: "Early Head Start".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactaffordableannualassetsbillcostcostseconomicestablishedexpandedfederalgeneralhealthhomelimitedlong-termmaintainpolicyprogram
SHARED TOKENS (36): "access", "act", "affordable", "annual", "assets", "bill", "cost", "costs", "economic", "established", "expanded", "federal", "general", "health", "home", "limited", "long-term", "maintain", "policy", "program".... | EXACT TITLE in childcare_family: "Medicaid".
0.500
additionalageauthoritycapacitychangescontextcreatedatadevelopmentearlygeneralincreasesincreasinglyjurisdictionlegallocallymodelpracticeproceedingsprotection
SHARED TOKENS (30): "additional", "age", "authority", "capacity", "changes", "context", "create", "data", "development", "early", "general", "increases", "increasingly", "jurisdiction", "legal", "locally", "model", "practice", "proceedings", "protection".... | EXACT TITLE in childcare_family: "Juvenile court".
0.500
Easement ↗ Q448405 EXACT TITLE
accessamonganotheritselflandlawlimitedownedpropertyprovidingpublicpurposerealrightsroadstated
SHARED TOKENS (16): "access", "among", "another", "itself", "land", "law", "limited", "owned", "property", "providing", "public", "purpose", "real", "rights", "road", "stated". | EXACT TITLE in water_rights: "Easement".
0.500
ageagenciesbeyondcollegecontinuingdevelopmentdifferentdivisiondueeconomiceducationfrequentlygeneralinstitutionalintendedleastoperationprofessionalprogramsprovision
SHARED TOKENS (27): "age", "agencies", "beyond", "college", "continuing", "development", "different", "division", "due", "economic", "education", "frequently", "general", "institutional", "intended", "least", "operation", "professional", "programs", "provision".... | EXACT TITLE in water_rights: "Continuing education". | EXACT TITLE in childcare_family: "Continuing education".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsflowhomeindustriallandlayermajormaterialspressureregionrelatedsourcestudywater
SHARED TOKENS (15): "beyond", "characteristics", "flow", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "related", "source", "study", "water". | EXACT TITLE in water_rights: "Aquifer".
0.500
Disability ↗ Q12131 EXACT TITLE
accessacquiredaroundcategoriescenterscommunitycreateddefinesdescribedifferentdueexperienceframeworkhistoricallyhistoryidentityindividuallawlegallong-term
SHARED TOKENS (36): "access", "acquired", "around", "categories", "centers", "community", "created", "defines", "describe", "different", "due", "experience", "framework", "historically", "history", "identity", "individual", "law", "legal", "long-term".... | EXACT TITLE in childcare_family: "Disability".
0.500
agriculturechangesclassificationcontainingdifferentfoodformhomeindustrialmakingotherwisephysicalpreservationprimaryprocessingreducingrequiredresults
SHARED TOKENS (18): "agriculture", "changes", "classification", "containing", "different", "food", "form", "home", "industrial", "making", "otherwise", "physical", "preservation", "primary", "processing", "reducing", "required", "results". | EXACT TITLE in water_rights: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferentestategeneralintendedlandlawlegalnonprofitownedownershipprivatepropertypublicpurposerealresidentialresources
SHARED TOKENS (23): "acquisition", "business", "commercial", "different", "estate", "general", "intended", "land", "law", "legal", "nonprofit", "owned", "ownership", "private", "property", "public", "purpose", "real", "residential", "resources".... | EXACT TITLE in water_rights: "Real estate". | EXACT TITLE in childcare_family: "Real estate".
0.500
Water treatment ↗ EXACT TITLE
dueflowhealthindustrialmaintenancematerialsprocessprocessesqualityrecreationresourceriversupplysystemstreatmentuseswater
SHARED TOKENS (17): "due", "flow", "health", "industrial", "maintenance", "materials", "process", "processes", "quality", "recreation", "resource", "river", "supply", "systems", "treatment", "uses", "water". | EXACT TITLE in water_rights: "Water treatment".
0.500
assessmentcharacteristicscompliancecontactdeterminesfrequentlygenerallyhealthphysicalqualitysafetysignificantstandardssupplytreatmentwater
SHARED TOKENS (16): "assessment", "characteristics", "compliance", "contact", "determines", "frequently", "generally", "health", "physical", "quality", "safety", "significant", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.500
adaboisedepartmentdistrictdistrictseducationeducationalheadquarteredidahojurisdictionpublicschoolsservessquaresystemwestern
SHARED TOKENS (16): "ada", "boise", "department", "district", "districts", "education", "educational", "headquartered", "idaho", "jurisdiction", "public", "schools", "serves", "square", "system", "western". | EXACT TITLE in childcare_family: "Boise School District".
0.500
Telemetry ↗ Q209867 EXACT TITLE
controlcostdatadigitalequipmentmechanismsmedianetworkoperatephysicalreceiverequiresystemstransfertransferred
SHARED TOKENS (15): "control", "cost", "data", "digital", "equipment", "mechanisms", "media", "network", "operate", "physical", "receive", "require", "systems", "transfer", "transferred". | EXACT TITLE in water_rights: "Telemetry".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessaffordableanothercenterscontextdevelopmentearlyeconomiceducationeducationalessentialfacilityforminstitutionslaborlicensedlong-termorganizationsprofessionalprogram
SHARED TOKENS (31): "access", "affordable", "another", "centers", "context", "development", "early", "economic", "education", "educational", "essential", "facility", "form", "institutions", "labor", "licensed", "long-term", "organizations", "professional", "program".... | EXACT TITLE in childcare_family: "Child care".
0.500
Snake River ↗ Q272074 EXACT TITLE
ageagenciescanyoncentralcenturychannelcommercialconstructioncontrolcreatedflowsheavilyhistoryidaholimitedlowermajornationalpolicyprivate
SHARED TOKENS (31): "age", "agencies", "canyon", "central", "century", "channel", "commercial", "construction", "control", "created", "flows", "heavily", "history", "idaho", "limited", "lower", "major", "national", "policy", "private".... | EXACT TITLE in water_rights: "Snake River".
0.500
administrationbegancomplycreatesdepartmentdesigneddivisioneducationaleligibleentitlementfederalhealthhomejulyleastmaintenanceprogramprovideprovidingreduce
SHARED TOKENS (26): "administration", "began", "comply", "creates", "department", "designed", "division", "educational", "eligible", "entitlement", "federal", "health", "home", "july", "least", "maintenance", "program", "provide", "providing", "reduce".... | EXACT TITLE in childcare_family: "Temporary Assistance for Needy Families".
0.500
businessbusinessescapacitycommercialcustomerexpandedgenerallyhomeofficeoperateoperatedoperatesownerresidentialruralworkzoning
SHARED TOKENS (17): "business", "businesses", "capacity", "commercial", "customer", "expanded", "generally", "home", "office", "operate", "operated", "operates", "owner", "residential", "rural", "work", "zoning". | EXACT TITLE in childcare_family: "Home business".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisconstructiondevelopmentdigitalengineeringequipmentestablishhistorylandlawlegalownershipplanningprofessionalpropertyrequiredresearchsciencestationsstructural
SHARED TOKENS (23): "analysis", "construction", "development", "digital", "engineering", "equipment", "establish", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "required", "research", "science", "stations", "structural".... | EXACT TITLE in water_rights: "Surveying".
0.500
Indeed ↗ EXACT TITLE
additionalallowingaroundbegancentralcomdirectlyemploymentfirmsheadquarteredholdingsindependentrecruitsearchsinglesitestaffingthousandsvertical
SHARED TOKENS (19): "additional", "allowing", "around", "began", "central", "com", "directly", "employment", "firms", "headquartered", "holdings", "independent", "recruit", "search", "single", "site", "staffing", "thousands", "vertical". | EXACT TITLE in childcare_family: "Indeed".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessadequateapplicablechainconditionscontactdevelopmenteconomygeneralgrowthhealthlevellimitedoperatingprovidingpublicrelatedsafetysubjectsystem
SHARED TOKENS (26): "access", "adequate", "applicable", "chain", "conditions", "contact", "development", "economy", "general", "growth", "health", "level", "limited", "operating", "providing", "public", "related", "safety", "subject", "system".... | EXACT TITLE in childcare_family: "Sanitation".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherapplicationapplicationsconditionsdatadefinesdigitaldueeducationevenfacilitieshealthhomeinformationlimitedmanagementphysicalpractice
SHARED TOKENS (32): "access", "administration", "another", "application", "applications", "conditions", "data", "defines", "digital", "due", "education", "even", "facilities", "health", "home", "information", "limited", "management", "physical", "practice".... | EXACT TITLE in childcare_family: "Telehealth".
0.500
actaddressaddressingadministeredagencyarmychangescontrolcoordinationdirectlyfederalformgoverninglawlegislationmaintainmajorownedphysicalprimary
SHARED TOKENS (28): "act", "address", "addressing", "administered", "agency", "army", "changes", "control", "coordination", "directly", "federal", "form", "governing", "law", "legislation", "maintain", "major", "owned", "physical", "primary".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
aroundbuildingcommunitydevelopmentdistinctexperiencehealthmakingmodeloccursoperateoperatingorganizationsspacework
SHARED TOKENS (15): "around", "building", "community", "development", "distinct", "experience", "health", "making", "model", "occurs", "operate", "operating", "organizations", "space", "work". | EXACT TITLE in childcare_family: "Community organization".
0.500
accessadditionalclassroomcommunitydesigneddifferenteducationeducationalequipmentgeneralindividuallevelmaterialsphysicalpracticeprovideprovisionreduceresourceseparate
SHARED TOKENS (22): "access", "additional", "classroom", "community", "designed", "different", "education", "educational", "equipment", "general", "individual", "level", "materials", "physical", "practice", "provide", "provision", "reduce", "resource", "separate".... | EXACT TITLE in childcare_family: "Special education".
0.500
Care work ↗ Q5038877 EXACT TITLE
addressassociatedcentersconditionscostdatadescribeddevelopmentdirectdistributionemploymentformgroupidentifiedinstitutionslaborlowermarketnationaloccurs
SHARED TOKENS (33): "address", "associated", "centers", "conditions", "cost", "data", "described", "development", "direct", "distribution", "employment", "form", "group", "identified", "institutions", "labor", "lower", "market", "national", "occurs".... | EXACT TITLE in childcare_family: "Care work".
0.500
ageanotheraroundbodybuildingcapacitychangescreatesdescribedevelopmentearlyeducationalestablishedidentityincreaseindividualmajorperiodspracticesprocesses
SHARED TOKENS (29): "age", "another", "around", "body", "building", "capacity", "changes", "creates", "describe", "development", "early", "educational", "established", "identity", "increase", "individual", "major", "periods", "practices", "processes".... | EXACT TITLE in childcare_family: "Child development".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agricultureapplicationcentralchangesconditionscontroldirectlydistributiondrainagedueflowformgrowthlandmaintainmanagementnetworkoccursoperationoperations
SHARED TOKENS (37): "agriculture", "application", "central", "changes", "conditions", "control", "directly", "distribution", "drainage", "due", "flow", "form", "growth", "land", "maintain", "management", "network", "occurs", "operation", "operations".... | EXACT TITLE in water_rights: "Irrigation".
0.500
accessactiveaffectsaffordableageagencyanotheravailabilitybeyondcreatedevelopmentdueearlyeconomicenoughestimatedevenfoodfuturegrowth
SHARED TOKENS (42): "access", "active", "affects", "affordable", "age", "agency", "another", "availability", "beyond", "create", "development", "due", "early", "economic", "enough", "estimated", "even", "food", "future", "growth".... | EXACT TITLE in childcare_family: "Food security".
0.500
Franchising ↗ Q171947 EXACT TITLE
anotherbusinesscapitalchaincomplyconditionscontrollingcorporatedirecteconomicexpansionfeesgrowthhighlyindividuallegallicenseslicensingmarketmodel
SHARED TOKENS (32): "another", "business", "capital", "chain", "comply", "conditions", "controlling", "corporate", "direct", "economic", "expansion", "fees", "growth", "highly", "individual", "legal", "licenses", "licensing", "market", "model".... | EXACT TITLE in childcare_family: "Franchising".
0.500
actapplicationdueexpresslyflowflowsgenerallyincreasespermitpointqualityrequirementsrisksurroundinguseswater
SHARED TOKENS (16): "act", "application", "due", "expressly", "flow", "flows", "generally", "increases", "permit", "point", "quality", "requirements", "risk", "surrounding", "uses", "water". | EXACT TITLE in water_rights: "Return flow".
0.500
actclassroomcomprehensivecurrentdepartmentdesignedearlyeducationestablishexpandedfederalhealthnetworkoutsidephysicalprogramrelationshipsrequiringresourcesspace
SHARED TOKENS (21): "act", "classroom", "comprehensive", "current", "department", "designed", "early", "education", "establish", "expanded", "federal", "health", "network", "outside", "physical", "program", "relationships", "requiring", "resources", "space".... | EXACT TITLE in childcare_family: "Head Start (program)".
0.500
actagriculturebeganboisecapacitychangedcompletedconstructiondesignflowshomeidaholaborlawlevelmaterialsnationaloperatedprimaryprovide
SHARED TOKENS (32): "act", "agriculture", "began", "boise", "capacity", "changed", "completed", "construction", "design", "flows", "home", "idaho", "labor", "law", "level", "materials", "national", "operated", "primary", "provide".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
adaboisecanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidahonampapopulationprimaryprogramspublicreportedresidentsserved
SHARED TOKENS (28): "ada", "boise", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public", "reported", "residents", "served".... | EXACT TITLE in water_rights: "College of Western Idaho". | EXACT TITLE in childcare_family: "College of Western Idaho".
0.500
businesscommunityconstraintentitiesfinanceinstitutionlocalnonprofitobtainoperatedoperatesoperationsorganizationsownersprivateprogrampublicpurposeratherreceive
SHARED TOKENS (23): "business", "community", "constraint", "entities", "finance", "institution", "local", "nonprofit", "obtain", "operated", "operates", "operations", "organizations", "owners", "private", "program", "public", "purpose", "rather", "receive".... | EXACT TITLE in childcare_family: "Nonprofit organization".
0.500
aloneamongarmycommunitycostseducationestablishesgeneralheadquarteredinstitutionlongermajornationalofficialone-timeoperatingphysicalpracticeproviderrehabilitation
SHARED TOKENS (25): "alone", "among", "army", "community", "costs", "education", "establishes", "general", "headquartered", "institution", "longer", "major", "national", "official", "one-time", "operating", "physical", "practice", "provider", "rehabilitation".... | EXACT TITLE in childcare_family: "Salvation Army".
0.500
agriculturearoundcapitalcommercialcommunitycostcostsdependdifferentinstitutionallargerpersonnelpolicypracticepressureprovidersprovisionpublicqualityregulation
SHARED TOKENS (29): "agriculture", "around", "capital", "commercial", "community", "cost", "costs", "depend", "different", "institutional", "larger", "personnel", "policy", "practice", "pressure", "providers", "provision", "public", "quality", "regulation".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
affectsagencyapplicationscontainingessentialformgrouphealthlargerlistoccursprimarypropertiesprotectionresearchriskrolesemiconductorsitestherefore
SHARED TOKENS (21): "affects", "agency", "applications", "containing", "essential", "form", "group", "health", "larger", "list", "occurs", "primary", "properties", "protection", "research", "risk", "role", "semiconductor", "sites", "therefore".... | EXACT TITLE in water_rights: "Arsenic".
0.480
amongboisedivisionestablishedidahooperatesprofessionalpublicresearchruralschoolsstatewideuniversityuntil
SHARED TOKENS (14): "among", "boise", "division", "established", "idaho", "operates", "professional", "public", "research", "rural", "schools", "statewide", "university", "until". | EXACT TITLE in water_rights: "University of Idaho".
0.480
Ditch ↗ Q2048319 EXACT TITLE
alongsidearoundchannelconditionscreateddrainagemajorproviderequiredruralsourcethemwaterwhose
SHARED TOKENS (14): "alongside", "around", "channel", "conditions", "created", "drainage", "major", "provide", "required", "rural", "source", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.480
Family court ↗ Q82749 EXACT TITLE
addresscenturychangescreateddecisionsdifferentlawlegalmattersrelationshipsrequirementsrulessupportsystem
SHARED TOKENS (14): "address", "century", "changes", "created", "decisions", "different", "law", "legal", "matters", "relationships", "requirements", "rules", "support", "system". | EXACT TITLE in childcare_family: "Family court".
0.480
Family ↗ Q8436 EXACT TITLE
categoriescommunitycreateeconomicgrouphistoricallyhistoryorganizationsprimarypurposerelatedrelationshipsafetystructure
SHARED TOKENS (14): "categories", "community", "create", "economic", "group", "historically", "history", "organizations", "primary", "purpose", "related", "relationship", "safety", "structure". | EXACT TITLE in childcare_family: "Family".
0.480
certificationcompletelaborlevellicenseoutsideplacementpracticeprofessionalregulatedstudysystemtrainingworking
SHARED TOKENS (14): "certification", "complete", "labor", "level", "license", "outside", "placement", "practice", "professional", "regulated", "study", "system", "training", "working". | EXACT TITLE in water_rights: "Apprenticeship".
0.480
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodecommercialconditionsflowmodeloperatingprogrampublicsourcesurveysystemstext
SHARED TOKENS (14): "beyond", "boundary", "code", "commercial", "conditions", "flow", "model", "operating", "program", "public", "source", "survey", "systems", "text". | EXACT TITLE in water_rights: "MODFLOW".
0.480
anotherassetscapitalformerfundgategoldengrowthindustrialmakesmanagementpartnerprivatesignificant
SHARED TOKENS (14): "another", "assets", "capital", "former", "fund", "gate", "golden", "growth", "industrial", "makes", "management", "partner", "private", "significant". | EXACT TITLE in childcare_family: "Golden Gate Capital".
0.480
commercialdirectlydueindustrialinfrastructureoccursseparateservedservingsewersystemsystemstreatmenturban
SHARED TOKENS (14): "commercial", "directly", "due", "industrial", "infrastructure", "occurs", "separate", "served", "serving", "sewer", "system", "systems", "treatment", "urban". | EXACT TITLE in water_rights: "Sanitary sewer".
0.480
associationcontroldescribedequipmentpressureprocessproducingprofileregulatedrequiredresourcesearchthroughoutwater
SHARED TOKENS (14): "association", "control", "described", "equipment", "pressure", "process", "producing", "profile", "regulated", "required", "resource", "search", "throughout", "water". | EXACT TITLE in water_rights: "Well drilling".
0.460
alongsidecontainsformindustriallandmajorrecreationreportssurroundingtreatmenttypesuseswater
SHARED TOKENS (13): "alongside", "contains", "form", "industrial", "land", "major", "recreation", "reports", "surrounding", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Surface water".
0.460
ageconditionsdependsdirectlyfoodformhealthmaintainmajorphysicalrequiredwaterwork
SHARED TOKENS (13): "age", "conditions", "depends", "directly", "food", "form", "health", "maintain", "major", "physical", "required", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.460
affectsamongaroundcostdifferenteducationevenexperiencehealthplanningreduceresultingthough
SHARED TOKENS (13): "affects", "among", "around", "cost", "different", "education", "even", "experience", "health", "planning", "reduce", "resulting", "though". | EXACT TITLE in childcare_family: "Maternal health".
0.460
accessanotherdescribingestateevenlegalownerpropertyrightsthoughtitleviewwater
SHARED TOKENS (13): "access", "another", "describing", "estate", "even", "legal", "owner", "property", "rights", "though", "title", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.460
Nitrate ↗ Q49916468 EXACT TITLE
absenceapplicationsassociatedcontainingcreationdirecthealthhistoricallypreservationprocessessignificantsourcewater
SHARED TOKENS (13): "absence", "applications", "associated", "containing", "creation", "direct", "health", "historically", "preservation", "processes", "significant", "source", "water". | EXACT TITLE in water_rights: "Nitrate".
0.460
Snowpack ↗ Q18575846 EXACT TITLE
agricultureanimalannualclassificationconditionscontextdifferentphysicalpropertiesprovideresourcestudywater
SHARED TOKENS (13): "agriculture", "animal", "annual", "classification", "conditions", "context", "different", "physical", "properties", "provide", "resource", "study", "water". | EXACT TITLE in water_rights: "Snowpack".
0.440
conditionscontrollingeducationenforcementengineeringfireheavilypracticesreduceresponsesurroundingthem
SHARED TOKENS (12): "conditions", "controlling", "education", "enforcement", "engineering", "fire", "heavily", "practices", "reduce", "response", "surrounding", "them". | EXACT TITLE in childcare_family: "Fire prevention".
0.440
Stormwater ↗ Q1421263 EXACT TITLE
createdemanddirectlylandmajorpopulationreducerelatedresourcetreatmenturbanwater
SHARED TOKENS (12): "create", "demand", "directly", "land", "major", "population", "reduce", "related", "resource", "treatment", "urban", "water". | EXACT TITLE in water_rights: "Stormwater".
0.440
adaboisecanyoncapacitychannelidahoriversystemtreasurevalleywaterwestern
SHARED TOKENS (12): "ada", "boise", "canyon", "capacity", "channel", "idaho", "river", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.420
businessformincreaselong-termpracticesprivateprovidingprovisionpublicqualityrather
SHARED TOKENS (11): "business", "form", "increase", "long-term", "practices", "private", "providing", "provision", "public", "quality", "rather". | EXACT TITLE in childcare_family: "Philanthropy".
0.420
boisedatadistrictdistrictsevenidaholowerpopulationresidentssinglesouth
SHARED TOKENS (11): "boise", "data", "district", "districts", "even", "idaho", "lower", "population", "residents", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
0.420
Workforce ↗ Q13440398 EXACT TITLE
cannotemploymentotherwisepopulationrateresultsstatedtextworkworkforceworking
SHARED TOKENS (11): "cannot", "employment", "otherwise", "population", "rate", "results", "stated", "text", "work", "workforce", "working". | EXACT TITLE in water_rights: "Workforce". | EXACT TITLE in childcare_family: "Workforce".
0.420
annualapplicationapplicationsaroundcapacityconsistentlycontainsdirectevenprimarysource
SHARED TOKENS (11): "annual", "application", "applications", "around", "capacity", "consistently", "contains", "direct", "even", "primary", "source". | EXACT TITLE in water_rights: "Geothermal heating".
0.420
amongcompletecomprehensiveeducationemploymenthistoryindividualprocesspurposerecordsearch
SHARED TOKENS (11): "among", "complete", "comprehensive", "education", "employment", "history", "individual", "process", "purpose", "record", "search". | EXACT TITLE in childcare_family: "Background check".
0.400
communitycoordinationfirmsgeneralhealthlawlegalmanagementsystemtreatment
SHARED TOKENS (10): "community", "coordination", "firms", "general", "health", "law", "legal", "management", "system", "treatment". | EXACT TITLE in childcare_family: "Case management".
0.400
businesscostsemployeekeepmaintainraterecruitmentretaintrainingworkforce
SHARED TOKENS (10): "business", "costs", "employee", "keep", "maintain", "rate", "recruitment", "retain", "training", "workforce". | EXACT TITLE in childcare_family: "Employee retention".
0.400
capacitydeliveriesfeefutureperiodspracticerightssignificanttransferswater
SHARED TOKENS (10): "capacity", "deliveries", "fee", "future", "periods", "practice", "rights", "significant", "transfers", "water". | EXACT TITLE in water_rights: "Water banking".
0.380
Reservoir ↗ Q131681 EXACT TITLE
bodybuildingbuiltcontrollingcreatedformretainingspacewater
SHARED TOKENS (9): "body", "building", "built", "controlling", "created", "form", "retaining", "space", "water". | EXACT TITLE in water_rights: "Reservoir".
0.380
capacitychannelestimatedflowlandmajoroccursrecordwater
SHARED TOKENS (9): "capacity", "channel", "estimated", "flow", "land", "major", "occurs", "record", "water". | EXACT TITLE in water_rights: "Streamflow".
0.380
flowindustrialresourceresourcesriversourcesouthsupplywater
SHARED TOKENS (9): "flow", "industrial", "resource", "resources", "river", "source", "south", "supply", "water". | EXACT TITLE in water_rights: "Water resources".
0.380
agecenturydescribeeducationeducationalhomeinstitutionsoutsidewhose
SHARED TOKENS (9): "age", "century", "describe", "education", "educational", "home", "institutions", "outside", "whose". | EXACT TITLE in childcare_family: "Kindergarten".
0.380
credentialdevelopmentearlyeducationgrowthhomeprofessionalprogramssupport
SHARED TOKENS (9): "credential", "development", "early", "education", "growth", "home", "professional", "programs", "support". | EXACT TITLE in childcare_family: "Child Development Associate".
0.380
differentgenerallylawlegalphysicalriversourcesystemswater
SHARED TOKENS (9): "different", "generally", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in water_rights: "Water right".
0.380
administrationagencyassociateddepartmenteconomicfederalnationalofficeresources
SHARED TOKENS (9): "administration", "agency", "associated", "department", "economic", "federal", "national", "office", "resources". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.360
determinesinvolvedlegalobligationsprocessprocessesrightsshows
SHARED TOKENS (8): "determines", "involved", "legal", "obligations", "process", "processes", "rights", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.360
Preschool ↗ Q1076052 EXACT TITLE
ageearlyeducationeducationaloperatedprimarypublicspace
SHARED TOKENS (8): "age", "early", "education", "educational", "operated", "primary", "public", "space". | EXACT TITLE in childcare_family: "Preschool".
0.360
acquisitionbusinesscontextentitiesgrouplargertransfertreatment
SHARED TOKENS (8): "acquisition", "business", "context", "entities", "group", "larger", "transfer", "treatment". | EXACT TITLE in water_rights: "Consolidation (business)".
0.350
aroundassetsbusinesscapitalcentralfoodgrouphealthmanagementprivate
SHARED TOKENS (10): "around", "assets", "business", "capital", "central", "food", "group", "health", "management", "private". | URL->B (1): https://www.roarkcapital.com/portfolio.
0.340
agriculturebuildingdevelopmentestatelandpurposereal
SHARED TOKENS (7): "agriculture", "building", "development", "estate", "land", "purpose", "real". | EXACT TITLE in water_rights: "Land development".
0.340
builtcenturydevelopmenthistoricmaintainspreservationtwentieth
SHARED TOKENS (7): "built", "century", "development", "historic", "maintains", "preservation", "twentieth". | EXACT TITLE in childcare_family: "Historic preservation".
0.340
agencyboisedepartmentfederalidahoqualityregional
SHARED TOKENS (7): "agency", "boise", "department", "federal", "idaho", "quality", "regional". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.340
ageearlyeducationorganizationsprivateprogramrole
SHARED TOKENS (7): "age", "early", "education", "organizations", "private", "program", "role". | EXACT TITLE in childcare_family: "Pre-kindergarten".
0.340
applicableauthorizesdistrictlandpermituseszoning
SHARED TOKENS (7): "applicable", "authorizes", "district", "land", "permit", "uses", "zoning". | EXACT TITLE in childcare_family: "Special-use permit".
0.340
localmanagementmeasurementprocessesresourcerolewater
SHARED TOKENS (7): "local", "management", "measurement", "processes", "resource", "role", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.340
Boise River ↗ Q891080 EXACT TITLE
boisehighlyidahoriversquareurbanwestern
SHARED TOKENS (7): "boise", "highly", "idaho", "river", "square", "urban", "western". | EXACT TITLE in water_rights: "Boise River".
0.320
drainageoccursprimaryprocessprocesseswater
SHARED TOKENS (6): "drainage", "occurs", "primary", "process", "processes", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.320
Prenatal care ↗ EXACT TITLE
availabilitychangesformhealthreducingthroughout
SHARED TOKENS (6): "availability", "changes", "form", "health", "reducing", "throughout". | EXACT TITLE in childcare_family: "Prenatal care".
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturecreateddescribedesignedformformerhealthmanagementoperatedpracticeregionresourcesystemsthroughoutwater
SHARED TOKENS (15): "agriculture", "created", "describe", "designed", "form", "former", "health", "management", "operated", "practice", "region", "resource", "systems", "throughout", "water".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbuildingcommercialcostsdescribeddevelopmentdueexpansionformgeographicgrowthhighlyindustrialinfrastructurelandplanningpopulationprivateproperty
SHARED TOKENS (28): "agency", "associated", "building", "commercial", "costs", "described", "development", "due", "expansion", "form", "geographic", "growth", "highly", "industrial", "infrastructure", "land", "planning", "population", "private", "property"....
0.300
analysisanotherapplicationsbodybroaderbusinessdataengineeringessentialgeographicindexinformationinstitutionalmanagementoperationsorganizationsphysicalplanningprocessesreal
SHARED TOKENS (26): "analysis", "another", "applications", "body", "broader", "business", "data", "engineering", "essential", "geographic", "index", "information", "institutional", "management", "operations", "organizations", "physical", "planning", "processes", "real"....
0.300
applicationscentralcontrolcreatecreatedequipmentfacilitieshighlyindividualindustrialinsidemaintainmaterialsprocessprocessingreceivereduceresearchsemiconductorsingle
SHARED TOKENS (23): "applications", "central", "control", "create", "created", "equipment", "facilities", "highly", "individual", "industrial", "inside", "maintain", "materials", "process", "processing", "receive", "reduce", "research", "semiconductor", "single"....
0.300
changesconditionsdescribesdistinctearlyfacilityfunctionhealthleastlong-termlongerorganizationsphasereportreportedsectionstablesystemthoughuses
SHARED TOKENS (21): "changes", "conditions", "describes", "distinct", "early", "facility", "function", "health", "least", "long-term", "longer", "organizations", "phase", "report", "reported", "section", "stable", "system", "though", "uses"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothereconomicenforcementgenerallygoverninggovernsjurisdictionlandlawlegalmajorownershipprivatepropertypublicrealrelationshipsrightsrules
SHARED TOKENS (23): "acquisition", "another", "economic", "enforcement", "generally", "governing", "governs", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real", "relationships", "rights", "rules"....
0.300
agriculturebusinessescostcostsdirectdistributionindustrialmanagementmunicipalpracticeprocessreduceregionremainrequiresourcestandardssupplysystemsystems
SHARED TOKENS (24): "agriculture", "businesses", "cost", "costs", "direct", "distribution", "industrial", "management", "municipal", "practice", "process", "reduce", "region", "remain", "require", "source", "standards", "supply", "system", "systems"....
0.300
Adoption ↗ Q180472 KW CROSS HIGH
anothercenturycomprehensivecontractsdesignedgovernedgoverninghistoricallyintendedlegalprocessrequiresrightsspecifiedstatussystemstransfer
SHARED TOKENS (17): "another", "century", "comprehensive", "contracts", "designed", "governed", "governing", "historically", "intended", "legal", "process", "requires", "rights", "specified", "status", "systems", "transfer".
0.300
actadequateadministeredagenciesauthoritycodecomprehensivedependdescribeddesigneddevelopmentdifferentdirectseconomicfederalgrowthlawlegislationmechanismsnational
SHARED TOKENS (31): "act", "adequate", "administered", "agencies", "authority", "code", "comprehensive", "depend", "described", "designed", "development", "different", "directs", "economic", "federal", "growth", "law", "legislation", "mechanisms", "national"....
0.300
accessaffectsconditionscreatesdatademonstratesdescribesdocumentdocumentseducationeducationaleligibleexperiencefederalformgeneralhealthidentifiedindividualinstruction
SHARED TOKENS (34): "access", "affects", "conditions", "creates", "data", "demonstrates", "describes", "document", "documents", "education", "educational", "eligible", "experience", "federal", "form", "general", "health", "identified", "individual", "instruction"....
0.300
applicabledescribeddevelopmenteducationincorporatinginstitutionsintensivemaintainpracticeprofessionalprojectschoolsstudytechnicaltransferable
SHARED TOKENS (15): "applicable", "described", "development", "education", "incorporating", "institutions", "intensive", "maintain", "practice", "professional", "project", "schools", "study", "technical", "transferable".
0.300
accountadditionalagricultureannualboisecenturychangedchangesdatadescribeddifferentdueearlyestimatedexperiencegeneralgenerallyhistoryidahoincrease
SHARED TOKENS (33): "account", "additional", "agriculture", "annual", "boise", "century", "changed", "changes", "data", "described", "different", "due", "early", "estimated", "experience", "general", "generally", "history", "idaho", "increase"....
0.300
accessadditionalageanotherassociatedconnectedcontrolcontrollingdefinesearlyeducationalestimatedexperiencehealthlaborlegallyloweroccursolderoutside
SHARED TOKENS (28): "access", "additional", "age", "another", "associated", "connected", "control", "controlling", "defines", "early", "educational", "estimated", "experience", "health", "labor", "legally", "lower", "occurs", "older", "outside"....
0.300
administrationagealoneassociationconditionscurrentearlyelectricalflowfunctiongeneralleastmaintainprovidepurposerateratherrequiressubjecttreatment
SHARED TOKENS (21): "administration", "age", "alone", "association", "conditions", "current", "early", "electrical", "flow", "function", "general", "least", "maintain", "provide", "purpose", "rate", "rather", "requires", "subject", "treatment"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturebodycontrolsdescribingdevelopmentgeneralgrowthindustrialoccurspointprocessprogramreduceresultingriversourcewater
SHARED TOKENS (17): "agriculture", "body", "controls", "describing", "development", "general", "growth", "industrial", "occurs", "point", "process", "program", "reduce", "resulting", "river", "source", "water".
0.300
Septic tank ↗ Q386300 KW CROSS HIGH
connectedfacilityflowson-siteprimaryprocessesratereduceruralsepticsystemsystemsthereforetreatedtreatment
SHARED TOKENS (15): "connected", "facility", "flows", "on-site", "primary", "processes", "rate", "reduce", "rural", "septic", "system", "systems", "therefore", "treated", "treatment".
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecreateddifferentestatefacilitylandlegallocaloperateotherwiseownerownershipphysicalprivaterealretainrightsroadstatus
SHARED TOKENS (23): "authority", "capable", "created", "different", "estate", "facility", "land", "legal", "local", "operate", "otherwise", "owner", "ownership", "physical", "private", "real", "retain", "rights", "road", "status"....
0.300
codedevelopmentheadquarteredhealthleadershiplocalnetworknonprofitoperatesprogramsprovidingreachesregionalservessupporttitle
SHARED TOKENS (16): "code", "development", "headquartered", "health", "leadership", "local", "network", "nonprofit", "operates", "programs", "providing", "reaches", "regional", "serves", "support", "title".
0.300
actadministeredagechangededucationfederalgeneralindividualinformationlawleastlegislationlevelnationalpracticeprogramprogramsprovideprovisionspublic
SHARED TOKENS (23): "act", "administered", "age", "changed", "education", "federal", "general", "individual", "information", "law", "least", "legislation", "level", "national", "practice", "program", "programs", "provide", "provisions", "public"....
0.300
affectsagriculturebodybuildingcategorychangesconstructioncontrolcontrollingdifferentdrainageflowgenerallylandlocalmakingmanagementoperationspointprincipal
SHARED TOKENS (33): "affects", "agriculture", "body", "building", "category", "changes", "construction", "control", "controlling", "different", "drainage", "flow", "generally", "land", "local", "making", "management", "operations", "point", "principal"....
0.300
actarmyassociateddevelopmentdivisionindexinfrastructurenationalpdfprotectionpublicrequirementsresourcesstructuraltextwater
SHARED TOKENS (16): "act", "army", "associated", "development", "division", "index", "infrastructure", "national", "pdf", "protection", "public", "requirements", "resources", "structural", "text", "water".
0.300
additionalcommercialdistributiondrainagefacilitiesfireflowgenerallyindustrialinstitutionlocallynetworkpointpressureprivateprovideprovidingpublicratherriver
SHARED TOKENS (29): "additional", "commercial", "distribution", "drainage", "facilities", "fire", "flow", "generally", "industrial", "institution", "locally", "network", "point", "pressure", "private", "provide", "providing", "public", "rather", "river"....
0.300
amongassociationboisecanyoncapacitycompletedcontainscountiescreatedcreatesdirectlyedgefederalidaholevellocallowernampanationaloffice
SHARED TOKENS (30): "among", "association", "boise", "canyon", "capacity", "completed", "contains", "counties", "created", "creates", "directly", "edge", "federal", "idaho", "level", "local", "lower", "nampa", "national", "office"....
0.300
actadditionaladministeredbillcategoriesdepartmentdivisioneligibleemployeehighlylaborlawleastmajorprovideprovidingpublicrequiringsignedwork
SHARED TOKENS (21): "act", "additional", "administered", "bill", "categories", "department", "division", "eligible", "employee", "highly", "labor", "law", "least", "major", "provide", "providing", "public", "requiring", "signed", "work"....
0.300
Play therapy ↗ Q1542331 KW CROSS HIGH
accountassessmentbodycodescontextdevelopmentessentialexperiencesgenerallyhealthindividualinstitutionspracticeprocessprofessionalproviderelationshipspecialistssubjecttraining
SHARED TOKENS (21): "account", "assessment", "body", "codes", "context", "development", "essential", "experiences", "generally", "health", "individual", "institutions", "practice", "process", "professional", "provide", "relationship", "specialists", "subject", "training"....
0.300
Social work ↗ Q205398 KW CROSS HIGH
administrationagenciesbegancenturycommunitydevelopmentdirectlyeducationgrouphealthindividualindustriallaborlargerlawmanagementorganizationspolicypracticepressure
SHARED TOKENS (31): "administration", "agencies", "began", "century", "community", "development", "directly", "education", "group", "health", "individual", "industrial", "labor", "larger", "law", "management", "organizations", "policy", "practice", "pressure"....
0.300
Aquifer test ↗ Q446124 KW CROSS HIGH
aroundcharacteristicsdataengineeringflowformerincreasemodelpointpropertiesrealresponseresultssystemwater
SHARED TOKENS (15): "around", "characteristics", "data", "engineering", "flow", "former", "increase", "model", "point", "properties", "real", "response", "results", "system", "water".
0.300
analysisassessmentbroaderbuildingchangescontroldescribingdueengineeringincreaseindividualinfrastructurelevelmanagementpracticepracticesprocessespropertiesprovidingreduce
SHARED TOKENS (28): "analysis", "assessment", "broader", "building", "changes", "control", "describing", "due", "engineering", "increase", "individual", "infrastructure", "level", "management", "practice", "practices", "processes", "properties", "providing", "reduce"....
0.300
addressingconstructioncontrolcreatedesignengineeringhealthindustriallawlicensinglocalmaintainmanagementmunicipalprofessionalpublicqualityrelatedrequirementsrural
SHARED TOKENS (27): "addressing", "construction", "control", "create", "design", "engineering", "health", "industrial", "law", "licensing", "local", "maintain", "management", "municipal", "professional", "public", "quality", "related", "requirements", "rural"....
0.300
builtconnectedcontrolcustomerdatadigitalfeesgroupindividualmanagementmarketingmarketsorganizationsrelatedresultsreviewsearchsitesspacesystems
SHARED TOKENS (21): "built", "connected", "control", "customer", "data", "digital", "fees", "group", "individual", "management", "marketing", "markets", "organizations", "related", "results", "review", "search", "sites", "space", "systems"....
0.300
actaddressingamongdecisionsdepartmentdivisioneconomicemployeegroupidentifiedindividualleadershiporganizationsraterequireresourcessurveytransfersworkersworkforce
SHARED TOKENS (20): "act", "addressing", "among", "decisions", "department", "division", "economic", "employee", "group", "identified", "individual", "leadership", "organizations", "rate", "require", "resources", "survey", "transfers", "workers", "workforce".
0.300
agencyapprovedaroundassessmentbegandepartmenteducationemployeeenforcementfederalindependentinformationjulylegallevellocalmattersnationaloperationpermitting
SHARED TOKENS (29): "agency", "approved", "around", "assessment", "began", "department", "education", "employee", "enforcement", "federal", "independent", "information", "july", "legal", "level", "local", "matters", "national", "operation", "permitting"....
0.300
agriculturearoundcapacitycentralchangesconditionscontextcurrentdemanddevelopmentdifferentdueeconomicenoughexpandingexpansionexperienceflowfunctionfuture
SHARED TOKENS (42): "agriculture", "around", "capacity", "central", "changes", "conditions", "context", "current", "demand", "development", "different", "due", "economic", "enough", "expanding", "expansion", "experience", "flow", "function", "future"....
0.300
accessallowingassociationcoordinationcostsdevelopmentdueeconomicestatefrequentlygeneralgeographicinfrastructureintendedlocalmodelmunicipalnetworkoperateoperated
SHARED TOKENS (43): "access", "allowing", "association", "coordination", "costs", "development", "due", "economic", "estate", "frequently", "general", "geographic", "infrastructure", "intended", "local", "model", "municipal", "network", "operate", "operated"....
0.300
First aid ↗ Q133981 KW CROSS HIGH
associatedearlyequipmentgenerallyguidancehealthindividuallegislationlevelmovepreservationprofessionalprovisionpublicregulationrelationshiprequireresponseriskroad
SHARED TOKENS (26): "associated", "early", "equipment", "generally", "guidance", "health", "individual", "legislation", "level", "move", "preservation", "professional", "provision", "public", "regulation", "relationship", "require", "response", "risk", "road"....
0.300
amongauthorityavailabilitybeganconcentratedconstructiondistrictdistrictsearlyeconomiceconomyincreasejurisdictionlandlocallowermajoroperatingownedplanning
SHARED TOKENS (32): "among", "authority", "availability", "began", "concentrated", "construction", "district", "districts", "early", "economic", "economy", "increase", "jurisdiction", "land", "local", "lower", "major", "operating", "owned", "planning"....
0.300
abandonmentaffectagricultureanalysisanalyzedapplicationboundarycharacteristicsdifferentdueedgehealthlandlegislationmakingmanagementmechanismsmodeloccurson-site
SHARED TOKENS (33): "abandonment", "affect", "agriculture", "analysis", "analyzed", "application", "boundary", "characteristics", "different", "due", "edge", "health", "land", "legislation", "making", "management", "mechanisms", "model", "occurs", "on-site"....
0.300
Respite care ↗ Q7315937 KW CROSS HIGH
amongdescribedexperiencefundhealthhomelong-termmaintainpercentphysicalprimaryprogramsprovidequalityregulatedrelationshipreportedriskstudysupport
SHARED TOKENS (22): "among", "described", "experience", "fund", "health", "home", "long-term", "maintain", "percent", "physical", "primary", "programs", "provide", "quality", "regulated", "relationship", "reported", "risk", "study", "support"....
0.300
affectingamongcapacityconstructioncreatingdemanddirectelectricalinvolvedlandmakingpopulationprincipallyproducesprovideregionremainsresponseriverrole
SHARED TOKENS (25): "affecting", "among", "capacity", "construction", "creating", "demand", "direct", "electrical", "involved", "land", "making", "population", "principally", "produces", "provide", "region", "remains", "response", "river", "role"....
0.300
actaddressingamendedcomprehensivedataestablishestablishedfederalidentifiesinformationlawlegislationnationalofficeprogramspublicresearchrolesupportingtechnical
SHARED TOKENS (21): "act", "addressing", "amended", "comprehensive", "data", "establish", "established", "federal", "identifies", "information", "law", "legislation", "national", "office", "programs", "public", "research", "role", "supporting", "technical"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activebusinesscenturycharacteristicscommercialearlyfacilitiesgenerallygrowthhighlyhomeindependentlargerlibrarymaintainsmaterialsnationalolderplanningproduces
SHARED TOKENS (27): "active", "business", "century", "characteristics", "commercial", "early", "facilities", "generally", "growth", "highly", "home", "independent", "larger", "library", "maintains", "materials", "national", "older", "planning", "produces"....
0.300
actadaamendedbillbusinesschangescharacteristicscostsfinalidentityjulylawnationalprohibitsprotectionprovidepublicrequirementsrequiresrights
SHARED TOKENS (21): "act", "ada", "amended", "bill", "business", "changes", "characteristics", "costs", "final", "identity", "july", "law", "national", "prohibits", "protection", "provide", "public", "requirements", "requires", "rights"....
0.300
actaddressesaddressingadequateagenciesagreementscenturycompliancecontroldesigneddevelopmenteconomicenforcementestablishgrowthintersectsjurisdictionlawlegalmechanisms
SHARED TOKENS (32): "act", "addresses", "addressing", "adequate", "agencies", "agreements", "century", "compliance", "control", "designed", "development", "economic", "enforcement", "establish", "growth", "intersects", "jurisdiction", "law", "legal", "mechanisms"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcommercialflowmeasurementoutsidepracticeprocesspublicregisterrequiredrequirementsresidentialstandardssupplysystemtypeswater
SHARED TOKENS (18): "association", "building", "commercial", "flow", "measurement", "outside", "practice", "process", "public", "register", "required", "requirements", "residential", "standards", "supply", "system", "types", "water".
0.300
administeredadministrativeaffordableagenciesagencyauthoritycentraldepartmentdevelopmentdifferentdirectlydistinctformgenerallyhomeindividuallocalnationalnonprofitoperated
SHARED TOKENS (34): "administered", "administrative", "affordable", "agencies", "agency", "authority", "central", "department", "development", "different", "directly", "distinct", "form", "generally", "home", "individual", "local", "national", "nonprofit", "operated"....
0.300
activeaffectamongassociationcommunitycontextcreateddefinesdevelopersdevelopmenteconomiceducationidentityinstitutionsinvolvedlargerlocalmajorpracticepractices
SHARED TOKENS (32): "active", "affect", "among", "association", "community", "context", "created", "defines", "developers", "development", "economic", "education", "identity", "institutions", "involved", "larger", "local", "major", "practice", "practices"....
0.300
actagenciesagencyaroundauthoritycreateddecisionsdesignedestablishedfederalfinallawnationalpolicyqualityreportsrequirementsrequiresrequiringresponsibility
SHARED TOKENS (23): "act", "agencies", "agency", "around", "authority", "created", "decisions", "designed", "established", "federal", "final", "law", "national", "policy", "quality", "reports", "requirements", "requires", "requiring", "responsibility"....
0.300
accesscannotcharacteristicscontrolcostsdifferentdueessentialfederalfrequentlyinfrastructureinstitutionlocalmaintainsmarketoperatespointprovidingpublicregulation
SHARED TOKENS (29): "access", "cannot", "characteristics", "control", "costs", "different", "due", "essential", "federal", "frequently", "infrastructure", "institution", "local", "maintains", "market", "operates", "point", "providing", "public", "regulation"....
0.300
actaffectanotherapplicationscommercialcurrentdemanddevelopmentfuturegrowthinvolvedlevellocalmakesmanagementmunicipalpopulationpracticespreservingpressure
SHARED TOKENS (27): "act", "affect", "another", "applications", "commercial", "current", "demand", "development", "future", "growth", "involved", "level", "local", "makes", "management", "municipal", "population", "practices", "preserving", "pressure"....
0.300
Building code ↗ Q2333573 KW CROSS HIGH
approvedauthoritybeganbuildingcodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictelectricalestatefacilitygeneralgenerallyhealthintended
SHARED TOKENS (42): "approved", "authority", "began", "building", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "electrical", "estate", "facility", "general", "generally", "health", "intended"....
0.300
affectsbusinesscertificationconsumercreatescustomerdueeconomicentryformfrequentlygeneralgrowthhealthindividuallawleastlicenselicensedlicensing
SHARED TOKENS (43): "affects", "business", "certification", "consumer", "creates", "customer", "due", "economic", "entry", "form", "frequently", "general", "growth", "health", "individual", "law", "least", "license", "licensed", "licensing"....
0.300
actactiveadministeredagenciesarmyauthoritybuildingbusinesscapacityconfirmsconstructioncontrolcreationdeliverdepartmentdesigndirectdirectlydutieseconomy
SHARED TOKENS (58): "act", "active", "administered", "agencies", "army", "authority", "building", "business", "capacity", "confirms", "construction", "control", "creation", "deliver", "department", "design", "direct", "directly", "duties", "economy"....
0.300
acquisitionamongbuiltcenturychangescharacteristicscontextdevelopmentdifferenteducationalexpandedfunctionsidentityindividualmajorphysicalprocessesresearchstudysystems
SHARED TOKENS (21): "acquisition", "among", "built", "century", "changes", "characteristics", "context", "development", "different", "educational", "expanded", "functions", "identity", "individual", "major", "physical", "processes", "research", "study", "systems"....
0.300
adaboisecentralconnectedcontainshistoricidahoitselfnationalpopulationrecreationruralsectionstarvalleywestern
SHARED TOKENS (16): "ada", "boise", "central", "connected", "contains", "historic", "idaho", "itself", "national", "population", "recreation", "rural", "section", "star", "valley", "western".
0.300
Child neglect ↗ Q559562 KW CROSS HIGH
actadequateagedecisionsdefiningdependsdifferentdirectdutieseducationalemploymentestablishedexaminedfederalformhealthlawlegallegallyotherwise
SHARED TOKENS (27): "act", "adequate", "age", "decisions", "defining", "depends", "different", "direct", "duties", "educational", "employment", "established", "examined", "federal", "form", "health", "law", "legal", "legally", "otherwise"....
0.300
Pumping station ↗ KW CROSS HIGH
allowinganotherapplicationscontainingcustomerdemanddesigndesigneddevelopmentdifferentdrainageequipmentessentialfacilitiesinfrastructurelandlevelmanagementmoveplaces
SHARED TOKENS (33): "allowing", "another", "applications", "containing", "customer", "demand", "design", "designed", "development", "different", "drainage", "equipment", "essential", "facilities", "infrastructure", "land", "level", "management", "move", "places"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationcenturyconnectdevelopmentevenexpandedfeefinalfunctionslandlegalobtainownerownersownershipprivatepropertiesproperty
SHARED TOKENS (30): "acquisition", "another", "application", "century", "connect", "development", "even", "expanded", "fee", "final", "functions", "land", "legal", "obtain", "owner", "owners", "ownership", "private", "properties", "property"....
0.300
addressingaffectagricultureanimalcentralchangesconcentrateddevelopmentdirecteconomicfoodlandlocalmajormanagementoperationspointpracticesqualityreport
SHARED TOKENS (27): "addressing", "affect", "agriculture", "animal", "central", "changes", "concentrated", "development", "direct", "economic", "food", "land", "local", "major", "management", "operations", "point", "practices", "quality", "report"....
0.300
changescontactexperienceexperiencesinformationinvolvedlegalnationalprocessprovideprovidersprovidingremainsupportssystemthroughout
SHARED TOKENS (16): "changes", "contact", "experience", "experiences", "information", "involved", "legal", "national", "process", "provide", "providers", "providing", "remain", "supports", "system", "throughout".
0.300
agenciesbuiltconstructiondepartmentsdesigndistinguishengineeringfirmsinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicsectorstructuralsystems
SHARED TOKENS (20): "agencies", "built", "construction", "departments", "design", "distinguish", "engineering", "firms", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private", "professional", "public", "sector", "structural", "systems".
0.300
boisecapacitydesigneddistricthistoricidaholowernampanationalplacesprogramprojectprovideregisterrivertreasurevalleywaterwestern
SHARED TOKENS (19): "boise", "capacity", "designed", "district", "historic", "idaho", "lower", "nampa", "national", "places", "program", "project", "provide", "register", "river", "treasure", "valley", "water", "western".
0.300
actadministrationanalysisanotherassociatedcapacityclientscontactcontrolcreatecustomereducationhealthhomeidentifiedimagesinvolvedlaborlawmanagement
SHARED TOKENS (37): "act", "administration", "analysis", "another", "associated", "capacity", "clients", "contact", "control", "create", "customer", "education", "health", "home", "identified", "images", "involved", "labor", "law", "management"....
0.300
agencycurrentdatadepartmentfederalheadquarteredmajormakespublicregulatoryresearchresourcesresponsibilitysciencespacestudysurveywhosework
SHARED TOKENS (19): "agency", "current", "data", "department", "federal", "headquartered", "major", "makes", "public", "regulatory", "research", "resources", "responsibility", "science", "space", "study", "survey", "whose", "work".
0.300
actadministeredamendedamongcreatedcreatingdirectearlyestablishedfederallaborlawmajornationalolderprogramprogramssignedsignificantsingle
SHARED TOKENS (22): "act", "administered", "amended", "among", "created", "creating", "direct", "early", "established", "federal", "labor", "law", "major", "national", "older", "program", "programs", "signed", "significant", "single"....
0.300
accessaddressagreementsaloneamongassociatedavailabilitychangesconditionscontrolcorporatedescribingeconomichistoryincreasesindividualinstitutionslevellimitedlocal
SHARED TOKENS (41): "access", "address", "agreements", "alone", "among", "associated", "availability", "changes", "conditions", "control", "corporate", "describing", "economic", "history", "increases", "individual", "institutions", "level", "limited", "local"....
0.300
academicsbuildingcommercialcommunitydifferentearlyeducationalexperiencefinalinsideleadershiplibraryorganizationsoutsidepopulationprimaryprogramprogramsrelativelyresearch
SHARED TOKENS (23): "academics", "building", "commercial", "community", "different", "early", "educational", "experience", "final", "inside", "leadership", "library", "organizations", "outside", "population", "primary", "program", "programs", "relatively", "research"....
0.300
authoritybuildingbusinesscapitalcenterscommercialcontainingestatefunctionsintendedlandleastlocalmaintainofficepropertyrealresidentialsignificantspace
SHARED TOKENS (22): "authority", "building", "business", "capital", "centers", "commercial", "containing", "estate", "functions", "intended", "land", "least", "local", "maintain", "office", "property", "real", "residential", "significant", "space"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscenturycompletecompletedconnectedcurrentestablishedformhistoricidahoincreasinglylowermakingownerspointriverseparatevalleywestern
SHARED TOKENS (19): "business", "century", "complete", "completed", "connected", "current", "established", "form", "historic", "idaho", "increasingly", "lower", "making", "owners", "point", "river", "separate", "valley", "western".
🫐 BERRY56 edges
0.280
Legal guardian ↗ Q157509 KW CROSS HIGH
ageanotherauthoritycannotdecisionsdueindividuallegalmakingotherwiseprofessionalpropertypublicthough
SHARED TOKENS (14): "age", "another", "authority", "cannot", "decisions", "due", "individual", "legal", "making", "otherwise", "professional", "property", "public", "though".
0.280
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingcodesconstructiondepartmentdivisionfireincreasesintendedoccurspracticesreduceresultssafetyschools
SHARED TOKENS (14): "building", "codes", "construction", "department", "division", "fire", "increases", "intended", "occurs", "practices", "reduce", "results", "safety", "schools".
0.280
adaboisecanyoncountieshomeidaholargermeridiannampapercentpopulationsectiontreasurevalley
SHARED TOKENS (14): "ada", "boise", "canyon", "counties", "home", "idaho", "larger", "meridian", "nampa", "percent", "population", "section", "treasure", "valley".
0.260
availabilityconsumerfeegeneralinformationoperatorprimaryprocessprovidersregistersinglesitetypes
SHARED TOKENS (13): "availability", "consumer", "fee", "general", "information", "operator", "primary", "process", "providers", "register", "single", "site", "types".
0.260
Payette River ↗ Q3373254 KW CROSS HIGH
divisiondrainageflowsidaholargermajornationalrecreationriversectionsouthsquarevalley
SHARED TOKENS (13): "division", "drainage", "flows", "idaho", "larger", "major", "national", "recreation", "river", "section", "south", "square", "valley".
0.260
agedevelopmentearlyeducationallimitedphysicalreceiveresourcesrisksupportsupportssystemthem
SHARED TOKENS (13): "age", "development", "early", "educational", "limited", "physical", "receive", "resources", "risk", "support", "supports", "system", "them".
0.260
boiseconsumercreateddatademandidahomajormarketownedsemiconductorservedsouthuntil
SHARED TOKENS (13): "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "owned", "semiconductor", "served", "south", "until".
0.260
Sugar beet ↗ Q151964 EXACT TITLE
containsgroupwhose
SHARED TOKENS (3): "contains", "group", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.260
agencyassociationidaho
SHARED TOKENS (3): "agency", "association", "idaho". | EXACT TITLE in water_rights: "Idaho State Bar".
0.260
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturedifferenteconomyfarmsfoodidaholandprocessingproducesrepresentsrolesectorsignificant
SHARED TOKENS (13): "agriculture", "different", "economy", "farms", "food", "idaho", "land", "processing", "produces", "represents", "role", "sector", "significant".
0.260
capitalconsumerprivate
SHARED TOKENS (3): "capital", "consumer", "private". | EXACT TITLE in childcare_family: "Sycamore Partners".
0.240
actamendedchaptercodedevelopmentfederallawlegislationpurposeregulationtitlewater
SHARED TOKENS (12): "act", "amended", "chapter", "code", "development", "federal", "law", "legislation", "purpose", "regulation", "title", "water".
0.240
Maize ↗ Q11575 KW CROSS HIGH
alongsideanimalannualcommercialcontainsessentialfoodmajorproducesthroughouttreatmentuses
SHARED TOKENS (12): "alongside", "animal", "annual", "commercial", "contains", "essential", "food", "major", "produces", "throughout", "treatment", "uses".
0.240
Kinship care ↗ Q5595400 KW CROSS HIGH
experiencehomeincreaseinvolvedlegalmaintainplacementreducerelatedrelationshipschoolssystem
SHARED TOKENS (12): "experience", "home", "increase", "involved", "legal", "maintain", "placement", "reduce", "related", "relationship", "schools", "system".
0.240
Trinity Health ↗ KW CROSS HIGH
comprehensivecontinuingfacilitieshealthhomeidahonetworkoperatesoperatingsouthsupportsystem
SHARED TOKENS (12): "comprehensive", "continuing", "facilities", "health", "home", "idaho", "network", "operates", "operating", "south", "support", "system".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
aroundsouth
SHARED TOKENS (2): "around", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.220
businessbusinessescategoriescategorycodedirectoryduefunctioninformationsearchsection
SHARED TOKENS (11): "business", "businesses", "categories", "category", "code", "directory", "due", "function", "information", "search", "section".
0.220
demanddistributionduefireflowpressuresignificantsuppliessystemsystemswater
SHARED TOKENS (11): "demand", "distribution", "due", "fire", "flow", "pressure", "significant", "supplies", "system", "systems", "water".
0.220
controldistinctgoverninglawownershippropertyqualityrelatedresourceresourceswater
SHARED TOKENS (11): "control", "distinct", "governing", "law", "ownership", "property", "quality", "related", "resource", "resources", "water".
0.220
additionalagencieshealthhomeindividualinstitutionallong-termratherrequiredresidentialsupport
SHARED TOKENS (11): "additional", "agencies", "health", "home", "individual", "institutional", "long-term", "rather", "required", "residential", "support".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in water_rights: "Subdivision". | EXACT TITLE in childcare_family: "Subdivision".
0.210
Abandon ↗ Q397584 EXACT TITLE
abandonment
SHARED TOKENS (1): "abandonment". | EXACT TITLE in water_rights: "Abandon". | EXACT TITLE in childcare_family: "Abandon".
0.210
idaho
SHARED TOKENS (1): "idaho". | EXACT TITLE in childcare_family: "Frank R. Gooding".
0.200
amongdetermineslandlawownershippossesspropertyrightssystemwater
SHARED TOKENS (10): "among", "determines", "land", "law", "ownership", "possess", "property", "rights", "system", "water".
0.200
Volunteering ↗ Q188844 KW CROSS HIGH
actcommunityeducationgroupindividuallaborprovideresponsetrainingwork
SHARED TOKENS (10): "act", "community", "education", "group", "individual", "labor", "provide", "response", "training", "work".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
forfeiture
EXACT TITLE in water_rights: "Forfeit".
0.200
allowingcontactscustomerdesigneddistinctinformationmarketingprimaryprocessshare
SHARED TOKENS (10): "allowing", "contacts", "customer", "designed", "distinct", "information", "marketing", "primary", "process", "share".
0.200
actcreatesemploymentlaborlawlegislationprohibitssignedstandardswork
SHARED TOKENS (10): "act", "creates", "employment", "labor", "law", "legislation", "prohibits", "signed", "standards", "work".
0.180
activearoundeligiblegrouplistlocallyorganizationsstaffwhose
SHARED TOKENS (9): "active", "around", "eligible", "group", "list", "locally", "organizations", "staff", "whose".
0.180
distributionformmanagementpracticessignificantthereforethousandsthroughoutwater
SHARED TOKENS (9): "distribution", "form", "management", "practices", "significant", "therefore", "thousands", "throughout", "water".
0.180
aroundchangedcontainsexpandedmajorriversouthsouthwestwestern
SHARED TOKENS (9): "around", "changed", "contains", "expanded", "major", "river", "south", "southwest", "western".
0.180
allowingdesigneddirectlynetworkoperatedsystemsystemstypeswater
SHARED TOKENS (9): "allowing", "designed", "directly", "network", "operated", "system", "systems", "types", "water".
0.180
industriallegalmerelyownershippurposerightssourcesystemwater
SHARED TOKENS (9): "industrial", "legal", "merely", "ownership", "purpose", "rights", "source", "system", "water".
0.180
Child abuse ↗ Q167191 KW CROSS HIGH
actdifferenthomeorganizationsphysicalrequirementsresultsschoolstherefore
SHARED TOKENS (9): "act", "different", "home", "organizations", "physical", "requirements", "results", "schools", "therefore".
0.180
Water table ↗ Q3342272 KW CROSS HIGH
flowhistoriclayerslevellowermaterialspressureuntilwater
SHARED TOKENS (9): "flow", "historic", "layers", "level", "lower", "materials", "pressure", "until", "water".
0.180
Pediatrics ↗ Q123028 KW CROSS HIGH
agecentersgeneralpracticerequiresresearchresourcesuntilwork
SHARED TOKENS (9): "age", "centers", "general", "practice", "requires", "research", "resources", "until", "work".
0.180
aroundcreatingdueequipmenthighlylandsectionsystemswater
SHARED TOKENS (9): "around", "creating", "due", "equipment", "highly", "land", "section", "systems", "water".
0.160
actfederalgovernsjurisdictionlawplacementproceedingsresulting
SHARED TOKENS (8): "act", "federal", "governs", "jurisdiction", "law", "placement", "proceedings", "resulting".
0.160
customerdecisionsexperienceformprofessionalpurchasingreviewsites
SHARED TOKENS (8): "customer", "decisions", "experience", "form", "professional", "purchasing", "review", "sites".
0.160
ageduelawlegallyreportrequiredrisksubject
SHARED TOKENS (8): "age", "due", "law", "legally", "report", "required", "risk", "subject".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahonampapopulationruralwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "nampa", "population", "rural", "western".
0.160
caldwellcanyondistrictextendsheadquarteredidaholandnampa
SHARED TOKENS (8): "caldwell", "canyon", "district", "extends", "headquartered", "idaho", "land", "nampa".
0.140
adaboisecenturyidahomunicipalpopulationseparate
SHARED TOKENS (7): "ada", "boise", "century", "idaho", "municipal", "population", "separate".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahokunapercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "percent", "population".
0.140
establishedfoodidahomakingpopulationregionsource
SHARED TOKENS (7): "established", "food", "idaho", "making", "population", "region", "source".
0.140
coveringeducationgeneralindividualprogramprogramstraining
SHARED TOKENS (7): "covering", "education", "general", "individual", "program", "programs", "training".
0.120
actapprovedbilllawpublicsigned
SHARED TOKENS (6): "act", "approved", "bill", "law", "public", "signed".
0.120
educationexperiencesgrouppracticesprogramsresidential
SHARED TOKENS (6): "education", "experiences", "group", "practices", "programs", "residential".
0.120
demanddescribephysicalpracticesupplieswater
SHARED TOKENS (6): "demand", "describe", "physical", "practice", "supplies", "water".
0.120
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherbuiltperiodsprovideriverwater
SHARED TOKENS (6): "another", "built", "periods", "provide", "river", "water".
0.120
Unemployment ↗ Q41171 KW CROSS HIGH
ageemploymentrateratherspecifiedwork
SHARED TOKENS (6): "age", "employment", "rate", "rather", "specified", "work".
0.120
agencycontinuingdepartmentfederalmanagementworking
SHARED TOKENS (6): "agency", "continuing", "department", "federal", "management", "working".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
Single parent ↗ Q1204559 KW CROSS HIGH
abandonmentalonepartnersinglesupport
SHARED TOKENS (5): "abandonment", "alone", "partner", "single", "support".
0.100
ownershipprivatepropertypublicresources
SHARED TOKENS (5): "ownership", "private", "property", "public", "resources".
0.100
finalidahoincorporatedjulyuntil
SHARED TOKENS (5): "final", "idaho", "incorporated", "july", "until".
◈ Frequently Asked Questions
Water Rights × Childcare Family — Treasure Valley
HAIKU · HIGH GATE
How do water allocation decisions by Ada County affect childcare facility operations in Boise?
Water rights determinations made through Ada County administrative law directly impact operational costs for childcare centers across Boise, particularly those serving families in real estate development zones where water availability fluctuates. Childcare providers in Meridian and Eagle must factor irrigation rights and domestic water access into facility planning, as water scarcity increases operational expenses that facilities pass to families.
What role does Boise State University play in researching water rights impacts on Treasure Valley families?
Boise State University's research programs examine how water rights policies in Ada County and Canyon County influence family housing costs and childcare accessibility across the Treasure Valley population. University scholars document how water availability near Nampa, Caldwell, and Star affects residential development patterns where young families seek affordable childcare services.
How do real estate development water requirements in Canyon County influence childcare home availability?
Canyon County real estate development projects require substantial water allocations under Idaho water law, reducing available domestic water for residential childcare homes in Caldwell and Nampa. Family childcare providers operating home-based programs must compete with development water claims, affecting the number of licensed facilities available to county residents.
What administrative law processes connect water permits to childcare licensing in Ada County?
Ada County administrative divisions coordinate water rights permits with childcare facility licensing requirements, as centers in Boise, Eagle, and Meridian must demonstrate adequate water access to meet state childcare program standards. The division of administrative oversight ensures that water availability directly influences whether childcare facilities can obtain and maintain operational licenses in the county.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Water Rights × Childcare Family 12 QID bridges 251 edges 6,644 ext links 2026-07-17 23:55:18 UTC 39d939ee2445e2c0
Water Rights corridor ↗ Childcare Family corridor ↗ Childcare Family × Water Rights ↗ boisestandard.org/standard ↗
Parent Corridors
Water Rights × All Other Verticals