—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Water Rights ↔ relates to ↔ Cleaning Services

22 Wikipedia bridge articles confirmed in both vertical ledgers. 271 deterministic cross-vertical edges. 7,199 external source links harvested. Every edge provenance-stamped. Every claim auditable.

22 QID Bridge Articles
271 Cross Edges
7,199 External Sources
313 Wikipedia Articles
22 🌲 Evergreen
200 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Water Rights
× Cleaning Services
QID Bridge Articles
22
confirmed Wikipedia overlap
Total Cross Edges
271
External Sources Harvested
7,199
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Zoning
score: 1.0000  ·  type: exact_title_cross  ·  27 shared tokens
QID Bridge Titles (20)
ZoningStormwaterFood processingReal estateClean Water ActSanitary sewerTreasure ValleyIdaho LegislatureUnited States Environmental Protection AgencyGroundwater pollutionBoise RiverBoise, IdahoNampa, IdahoAda County, IdahoKuna, IdahoStar, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, IdahoMiddleton, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanadalandcanyondifferentgovernmentlocalurbantreatmentwaterhomemakingformindustrialsystemsdirectlymajor
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 23:55:25 UTC
Content Hash
856a672d6cb5eb48
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
22 BRIDGES
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in water_rights (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (27): "allowing", "building", "determine", "developed", "different", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations", "regulatory", "residential".... | EXACT TITLE in water_rights: "Zoning". | EXACT TITLE in cleaning_services: "Zoning".
allowingbuildingdeterminedevelopeddifferentformgoverngovernmentgrowthindustriallandland-uselocalplacesplanningpolicypropertyregulationsregulatoryresidentialrulesshapesinglesystemsurbanuseszoning
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Inclusionary zoning refers to policies to increase the number of housing units within a development that are affordable to low and middle-income households. These policies can be mandatory as part of performance zoning or based on voluntary incentives, such as allowing greater density of development. Overlay zoning An overlay zone is a zoning district that overlaps one or more zoning districts to address a particular concern or feature of that area, such as wetlands, historic buildings or transit-oriented development. Overlay zoning has the advantage of providing targeted regulation to address a specific issue, such as a natural hazard, without having to significantly rewrite an existing zoning ordinance.
The United Kingdom does not use zoning as a technique for controlling land use. British land use control began its modern phase after the Town and Country Planning Act of 1947. Rather than dividing municipal maps into land use zones, English planning law places all development under the control of local and regional governments, effectively abolishing the ability to develop land by-right. However, existing development allows land use by-right as long as the use does not constitute a change in the type of land use. A property owner must apply to change land use type of any existing building, and such changes must be consistent with the local and regional land use plans. Development control or planning control is the element of the United Kingdom's system of town and country planning through which local government regulates land use and new building. There are 421 Local Planning Authorities (LPAs) in the United Kingdom. Generally they are the local borough or district council or a unitary authority. They each use a discretionary "plan-led system" whereby development plans are formed and the public consulted. Subsequent development requires planning permission, which will be granted or refused with reference to the development plan as a material consideration. The plan does not provide specific guidance on what type of buildings will be allowed in a given location, rather it provides general principles for development and goals for the management of urban change. Because planning committees (made up of directly elected local councillors) or in some cases planning officers themselves (via delegated decisions) have discretion on each application for development or change of use made, the system is considered a 'discretionary' one. Planning applications can differ greatly in scale, from airports and new towns to minor modifications to individual houses. In order to prevent local authorities from being overwhelmed by high volumes of small-scale applications from individual householders, a separate system of permitted development has been introduced. Permitted development rules are largely form-based, but in the absence of zoning, are applied at the national level. Examples include allowing a two-storey extension up to three metres at the rear of a property, extensions up to 50% of the original width at each side, and certain types of outbuildings in the garden, provided that no more than 50% of the land area is built over. These are appropriately sized for a typical three bedroom semi-detached property, but must be applied across a wide variety of housing types, from small terraces, to larger detached properties and manor houses. In August 2020, the UK Government published a consultation document called Planning for the Future. The proposals hinted at a move toward zoning in England, with areas given a Growth, Renewal or Protected designation, with the possibility of "sub-areas within each category", although the document did not elaborate on what the details of these might have been.
Stormwater
Q1421263 EXACT TITLE 1.000
QID OVERLAP: Q1421263 in water_rights (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (21): "become", "carrying", "create", "demand", "developed", "directly", "land", "large", "major", "population", "related", "resource", "runoff", "stored", "storm", "stormwater", "surface", "treatment", "urban", "volume".... | EXACT TITLE in water_rights: "Stormwater". | EXACT TITLE in cleaning_services: "Stormwater".
becomecarryingcreatedemanddevelopeddirectlylandlargemajorpopulationrelatedresourcerunoffstoredstormstormwatersurfacetreatmenturbanvolumewater
Stormwater, also written storm water, is water that originates from precipitation (storm), including heavy rain and meltwater from hail and snow. Stormwater can soak into the soil (infiltrate) and become groundwater, be stored on depressed land surface in ponds and puddles, evaporate back into the atmosphere, or contribute to surface runoff. Most runoff is conveyed directly as surface water to nearby streams, rivers or other large water bodies (wetlands, lakes and oceans) without treatment. In natural landscapes, such as forests, soil absorbs much of the stormwater. Plants also reduce stormwater by improving infiltration, intercepting precipitation as it falls, and by taking up water through their roots. In developed environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Stormwater creation of sinkhole collapses An example of urban stormwater creating a sinkhole collapse is the February 25, 2002 Dishman Lane collapse in Bowling Green, Kentucky where a sinkhole suddenly dropped the road under four traveling vehicles. The nine-month repair of the Dishman Lane collapse cost a million dollars but there remains the potential for future problems. In undisturbed areas with natural subsurface (karst) drainage, soil and rock fragments choke karst openings, thereby being a self-limitation to the growth of openings. The undisturbed karst drainage system becomes balanced with the climate so it can drain the water produced by most storms. However, problems occur when the landscape is altered by urban development. In urban areas with natural subsurface karst drainage there are no surface streams for the increased stormwater from impervious surfaces such as roofs, parking lots, and streets to receive drainage. Instead, the stormwater enters the subsurface drainage system by moving down through the ground. When the subsurface water flow becomes great enough to transport soil and rock fragments, the karst openings grow rapidly. Where karst openings are roofed by supportive (competent) limestone, there frequently is no surface warning that an opening has grown so large it will suddenly collapse catastrophically. It is recommended that land-use planning agencies avoid karst areas when considering new development projects.
environments, such as cities, unmanaged stormwater can create two major issues: one related to the volume and timing of runoff (flooding) and the other related to potential contaminants the water is carrying (water pollution). In addition to the pollutants carried in stormwater runoff, urban runoff is being recognized as a cause of pollution in its own right. Stormwater is also an important resource as human population and demand for water grow, particularly in arid and drought-prone climates.
Food processing
Q627371 EXACT TITLE 1.000
QID OVERLAP: Q627371 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (18): "agriculture", "changes", "classification", "different", "environmental", "food", "form", "forms", "home", "impact", "industrial", "making", "methods", "otherwise", "physical", "required", "turns", "waste". | EXACT TITLE in water_rights: "Food processing".
agriculturechangesclassificationdifferentenvironmentalfoodformformshomeimpactindustrialmakingmethodsotherwisephysicalrequiredturnswaste
ods used in the making of convenience foods. Some food processing methods play important roles in reducing food waste and improving food preservation, thus reducing the total environmental impact of agriculture and improving food security. Food Processing Levels (FPL) are defined according to physical and chemical changes occurring during food treatments. FPL are required in processed food classifications, such as the Nova classification, to categorise processed foods according to their FPL for different purposes. Primary food processing is necessary to make most foods edible while secondary food processing turns ingredients into familiar foods, such as bread.
Food processing level Food processing level (FPL) is a parameter used for grouping of food processing according to physical and (bio)chemical changes taking place in food materials during processing. Definition of the extent of processing benefits from the use of an ordinal level of measurement. Arbitrary grouping of processed food using nominal scales, such as extent of change, nature of change, raw material sources, ingredients used, place of processing, purpose of processing, traditional, novel and other type of treatments is often criticised. Ranking of food processing at an ordinal scale at any stage from food production in agriculture to eating by consumer describes the extent of food processing using the order of the different levels of processing. Processed food classifications often identify processing as a criterion for the grouping of processed foods. Some processed food classifications, such as the Nova classification, emphasise the role of processing in the development of obesity and noncommunicable diseases.
Tertiary food processing Tertiary food processing is the commercial production of what is commonly called processed food. It covers further processing of multiple ingredients in the manufacturing of fabricated foods, such as the ultra-processed foods category of the Nova classification. Many of these are ready-to-eat or heat-and-serve foods, such as frozen meals and re-heated airline meals. Food processing level Food processing level (FPL) is a parameter used for grouping of food processing according to physical and (bio)chemical changes taking place in food materials during processing. Definition of the extent of processing benefits from the use of an ordinal level of measurement. Arbitrary grouping of processed food using nominal scales, such as extent of change, nature of change, raw material sources, ingredients used, place of processing, purpose of processing, traditional, novel and other type of treatments is often criticised. Ranking of food processing at an ordinal scale at any stage from food production in agriculture to eating by consumer describes the extent of food processing using the order of the different levels of processing. Processed food classifications often identify processing as a criterion for the grouping of processed foods. Some processed food classifications, such as the Nova classification, emphasise the role of processing in the development of obesity and noncommunicable diseases.
R
Q684740 EXACT TITLE 1.000
QID OVERLAP: Q684740 in water_rights (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (21): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "government", "land", "law", "legal", "means", "owned", "ownership", "private", "property", "public", "real", "residential", "status".... | EXACT TITLE in water_rights: "Real estate". | EXACT TITLE in cleaning_services: "Real estate".
acquisitionbusinesscommercialdifferententityestategeneralgovernmentlandlawlegalmeansownedownershipprivatepropertypublicrealresidentialstatuswater
lic. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S. state. History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes.
ats, jewelry, furniture, tools, and the rolling stock of a farm and farm animals. The term real estate includes any land and buildings under private ownership, public (state) ownership or commercial (business) ownership. The purpose or usage of the real estate in question may differ from its ownership status. The property may be for residential or commercial use, used by the state, government or the general public. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S.
History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes. Internet real estate as a concept began with the first appearance of real estate platforms on the World Wide Web (www) and occurred in 1999. Residential real estate Residential real estate may contain either a single-family or multifamily structure that is available for occupation or for non-business purposes. Residences can be classified by how they are connected to neighbouring residences and land. Different types of housing tenure can be used for the same physical type. For example, connected residences might be owned by a single entity and leased out, or owned separately with an agreement covering the relationship between units and common areas and concerns. According to the Congressional Research Service, in 2021, 65% of homes in the U.S.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (30): "act", "address", "addressing", "changes", "clean", "contamination", "control", "coordination", "directly", "environmental", "federal", "form", "governing", "law", "maintain", "major", "modern", "owned", "physical", "protection".... | EXACT TITLE in water_rights: "Clean Water Act".
actaddressaddressingchangescleancontaminationcontrolcoordinationdirectlyenvironmentalfederalformgoverninglawmaintainmajormodernownedphysicalprotectionprovidingprovisionsqualityregulationsresourcethoughtreatmentwastewaterwaterwaters
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Sanitary sewer
Q1805497 EXACT TITLE 1.000
QID OVERLAP: Q1805497 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (22): "commercial", "directly", "disposal", "drains", "industrial", "infrastructure", "municipalities", "occurs", "runoff", "separate", "served", "serving", "sewer", "storm", "stormwater", "surface", "system", "systems", "treatment", "urban".... | EXACT TITLE in water_rights: "Sanitary sewer".
commercialdirectlydisposaldrainsindustrialinfrastructuremunicipalitiesoccursrunoffseparateservedservingsewerstormstormwatersurfacesystemsystemstreatmenturbanwastewaterwaters
A sanitary sewer is an underground pipe or tunnel system for transporting sewage from houses and commercial buildings (but not stormwater) to a sewage treatment plant or disposal. Sanitary sewers are a type of gravity sewer and are part of an overall system called a "sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
In the developed world, sewers are pipes from buildings to one or more levels of larger underground trunk mains, which transport the sewage to sewage treatment facilities. Vertical pipes, usually made of precast concrete, called manholes, connect the mains to the surface. Depending upon site application and use, these vertical pipes can be cylindrical, eccentric, or concentric. The manholes are used for access to the sewer pipes for inspection and maintenance, and as a means to vent sewer gases. They also facilitate vertical and horizontal angles in otherwise straight pipelines. Pipes conveying sewage from an individual building to a common gravity sewer line are called laterals. Branch sewers typically run under streets receiving laterals from buildings along that street and discharge by gravity into trunk sewers at manholes. Larger cities may have sewers called interceptors, receiving flow from multiple trunk sewers. Design and sizing of sanitary sewers considers the population to be served over the anticipated life of the sewer, per capita wastewater production, and flow peaking from timing of daily routines. Minimum sewer diameters are often specified to prevent blockage by solid materials flushed down toilets; gradients may be selected to maintain flow velocities generating sufficient turbulence to minimize solids deposition within the sewer. Commercial and industrial wastewater flows are also considered, but diversion of surface runoff to storm drains eliminates wet weather flow peaks of inefficient combined sewers. Force mains A force main or rising main is a pumped sewer that may be necessary where gravity sewers serve areas at lower elevations than the sewage treatment plant, or distant areas at similar elevations. A lift station is a sewer sump that lifts accumulated sewage to a higher elevation. They may also be used to prime an inverted siphon used to cross underneath rivers or other obstructions. The pump may discharge to another gravity sewer or directly to a treatment plant. Force mains are typically constructed of welded steel or HDPE jointed to resist pressures within the pipe.
sewage system" or sewerage. Sanitary sewers serving industrial areas may also carry industrial wastewater. In municipalities served by sanitary sewers, separate storm drains may convey surface runoff directly to surface waters. An advantage of sanitary sewer systems is that they avoid combined sewer overflows. Sanitary sewers are typically much smaller in diameter than combined sewers which also transport urban runoff. Backups of raw sewage can occur if excessive stormwater inflow or groundwater infiltration occurs due to leaking joints, defective pipes etc.
Treasure Valley
Q7836726 EXACT TITLE 0.900
QID OVERLAP: Q7836726 in water_rights (tier:evergreen) and cleaning_services (tier:evergreen). | SHARED TOKENS (10): "association", "boise", "idaho", "land", "local", "metropolitan", "region", "treasure", "valley", "western". | EXACT TITLE in water_rights: "Treasure Valley". | EXACT TITLE in cleaning_services: "Treasure Valley".
associationboiseidaholandlocalmetropolitanregiontreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Idaho Legislature
Q4256974 EXACT TITLE 0.880
QID OVERLAP: Q4256974 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (9): "boise", "data", "districts", "divided", "even", "government", "idaho", "population", "single". | EXACT TITLE in water_rights: "Idaho Legislature".
boisedatadistrictsdividedevengovernmentidahopopulationsingle
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (29): "around", "department", "education", "employee", "energy", "enforcement", "environmental", "federal", "government", "independent", "information", "january", "legal", "level", "local", "matters", "measures", "monitoring", "national", "operation"....
arounddepartmenteducationemployeeenergyenforcementenvironmentalfederalgovernmentindependentinformationjanuarylegallevellocalmattersmeasuresmonitoringnationaloperationpermittingprogramsproposedprotectionpublicregionalresearchspecialistsstandards
ent, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
President Joe Biden appointed Michael S. Regan to be administrator in 2021. Regan began serving on March 11, 2021. In October 2021 EPA announced its "PFAS Strategic Roadmap." PFASs are organofluorine chemical compounds referred to as "forever chemicals". The roadmap is a "whole-of-EPA" strategy and the agency will consider the full life cycle of PFAS, including preventing PFAS from entering the environment, holding polluters accountable, and remediation of contaminated sites. It also will include drinking water monitoring and risk assessment for PFOA and PFOS in biosolids (processed sewage sludge used as fertilizer). In December 2021 EPA issued new greenhouse gas standards for passenger cars and light trucks. The standards, which will reduce climate pollution and improve public health, became effective for the 2023 vehicle model year. In March 2022 the Biden administration allowed California to again set stricter auto emissions standards. In August 2022 the EPA was allotted a listed ~$53.216 billion in funding pursuant to the Inflation Reduction Act (IRA). The EPA listed 24 total initiatives, the most notable among them being greenhouse gas reduction and monitoring, a superfund petroleum tax, replacing current heavy-duty vehicles with zero-emission vehicles, and a methane incentive program. On February 3, 2023, more than 100 train cars were derailed in East Palestine, and around half of those cars containing chemicals like butyl acrylate, vinyl chloride, and ethylhexyl acrylate. Subsequently, the chemicals combusted into a flame being seen from miles around and the fumes filled the air with residents reporting animals falling ill and a burning sensation in their eyes and nose. The EPA monitered the situation and experts recommended that local residents take part in the EPA's at-home air screening. On April 21, 2023, the White House implemented the Justice40 Initiative as part of its broader effort to improve equality in minority communities. The goal of Justice40 is to make sure that 40 percent of the benefits from major federal investments go to communities that have been ignored. These investments include climate programs, clean energy projects, and efforts to reduce pollution. Justice40 changed the way federal agencies planned their programs and worked with each other. It guided how they identified disadvantaged communities and how they decided where money and support should go. For the EPA, this meant adjusting some of its grant programs and technical assistance, so they clearly supported Justice40’s goals and showed that the benefits were reaching the communities that needed them most. In March 2024, EPA published regulations for tailpipe emissions standards that accelerate the transition to electric vehicles (EVs). The standards require at least two-thirds of all new cars sold in the United States to be zero-emissions vehicles by 2032, in order to reduce air pollution and climate change. The agency projected that the regulations would cut emissions by 7 billion metric tons, or 56% of 2026 levels, by 2032. In April 2024, EPA finalized new standards for power plant carbon emissions, projecting cuts of 65,000 tons by 2028 and 1.38 billion tons by 2047. The agency also issued final drinking water standards for six PFAS compounds. In December, 2024 the EPA announced it approved California's plan to end the sale of gasoline-only vehicles by 2035. EPA Administrator Michael Regan granted a waiver under the Clean Air Act to California to implement the plan which was first announced in 2020. It required that by 2035 at least 80% of new cars sold be electric and up to 20% plug-in hybrid models.
Chemical approval, manufacture and usage EPA regulates pesticides under the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) and the Food Quality Protection Act. The agency assesses, registers, regulates, and regularly reevaluates all pesticides legally sold in the United States. A few challenges this program faces are transforming toxicity testing, screening pesticides for endocrine disruptors, and regulating biotechnology and nanotechnology. EPA approves and regulates new chemicals issuing "safety reviews". TSCA required EPA to create and maintain a national inventory of all existing chemicals in U.S. commerce. When the act was passed in 1976, there were more than 60,000 chemicals on the market that had never been comprehensively cataloged. To do so, the EPA developed and implemented procedures that have served as a model for Canada, Japan, and the European Union. For the inventory, the EPA also established a baseline for new chemicals that the agency should be notified about before being commercially manufactured. Today, this rule keeps the EPA updated on volumes, uses, and exposures of around 7,000 of the highest-volume chemicals via industry reporting. The Toxics Release Inventory (TRI) is a resource established by the Emergency Planning and Community Right-to-Know Act specifically for the public to learn about toxic chemical releases and pollution prevention activities reported by industrial and federal facilities. TRI data support informed decision-making by communities, government agencies, companies, and others. Annually, the agency collects data from more than 20,000 facilities.
Groundwater pollution
Q20113712 QID OVERLAP 0.800
QID OVERLAP: Q20113712 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (35): "affect", "agriculture", "analysis", "application", "boundary", "characteristics", "contamination", "damage", "different", "edge", "health", "land", "making", "management", "means", "mechanisms", "methods", "model", "monitoring", "occurs"....
affectagricultureanalysisapplicationboundarycharacteristicscontaminationdamagedifferentedgehealthlandmakingmanagementmeansmechanismsmethodsmodelmonitoringoccursproducesprotectionpublicqualityrathersitesuppliessurfacesystemstherefore+5
undwater and surface water are complex. For example, many rivers and lakes are fed by groundwater. This means that damage to groundwater aquifers e.g. by fracking or over abstraction, could therefore affect the rivers and lakes that rely on it. Saltwater intrusion into coastal aquifers is an example of such interactions. Prevention methods include: applying the precautionary principle, groundwater quality monitoring, land zoning for groundwater protection, locating on-site sanitation systems correctly and applying legislation.
Arsenic and fluoride have been recognized by the World Health Organization (WHO) as the most serious inorganic contaminants in drinking-water on a worldwide basis. Inorganic arsenic is the most common type of arsenic in soil and water. The metalloid arsenic can occur naturally in groundwater, as seen most frequently in Asia, including in China, India and Bangladesh. In the Ganges Plain of northern India and Bangladesh, severe contamination of groundwater by naturally occurring arsenic affects 25% of water wells in the shallower of two regional aquifers. Groundwater in these areas is also contaminated by the use of arsenic-based pesticides. Arsenic in groundwater can also be present where there are mining operations or mine waste dumps that will leach arsenic. Natural fluoride in groundwater is of growing concern as deeper groundwater is being used, "with more than 200 million people at risk of drinking water with elevated concentrations." Fluoride can especially be released from acidic volcanic rocks and dispersed volcanic ash when water hardness is low.
Metals Several trace metals occur naturally in certain rock formations and can enter in the environment from natural processes such as weathering. However, industrial activities such as mining, metallurgy, solid waste disposal, paint and enamel works, etc. can lead to elevated concentrations of toxic metals including lead, cadmium and chromium. These contaminants have the potential to make their way into groundwater. The migration of metals (and metalloids) in groundwater will be affected by several factors, in particular by chemical reactions which determine the partitioning of contaminants among different phases and species.
Boise River
Q891080 EXACT TITLE 0.800
QID OVERLAP: Q891080 in water_rights (tier:evergreen) and cleaning_services (tier:branch). | SHARED TOKENS (5): "boise", "drains", "idaho", "urban", "western". | EXACT TITLE in water_rights: "Boise River".
boisedrainsidahourbanwestern
The Boise River is a 102-mile-long (164 km) tributary of the Snake River in the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Boise, Idaho
Q35775 QID OVERLAP 0.780
QID OVERLAP: Q35775 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (14): "ada", "boise", "capital", "counties", "home", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "population", "treasure", "valley".
adaboisecapitalcountieshomeidaholevellocallymajormanufacturingmetropolitanpopulationtreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "footprint", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "university", "western".
boisecanyoncollegefootprinthomeidahomeridianmetropolitannampanorthwestpopulationuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in water_rights (tier:branch) and cleaning_services (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "except", "home", "idaho", "jurisdiction", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitalexcepthomeidahojurisdictionlocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Star, Idaho
Q1516815 QID OVERLAP 0.660
QID OVERLAP: Q1516815 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (8): "ada", "boise", "canyon", "idaho", "metropolitan", "population", "schools", "star".
adaboisecanyonidahometropolitanpopulationschoolsstar
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in water_rights (tier:branch) and cleaning_services (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
boisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Middleton, Idaho
Q1517595 QID OVERLAP 0.620
QID OVERLAP: Q1517595 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
boisecanyonidahometropolitannampapopulation
Middleton is a city in Canyon County, Idaho, United States. The population amounted to 9,091 at the 2021 census estimate, up from 5,524 at the 2010 census and 2,978 in 2000. It is part of the Boise City–Nampa, Idaho Metropolitan Statistical Area. History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
History Middleton was named for its location midway between Old Fort Boise and Keeney’s Ferry, serving as a resting point for travelers en route to the ferry. In its early years along the Oregon Trail, it had a stage station, a post office established in 1866, and a water-powered grist mill built in 1871. The Ward Massacre occurred near the area in 1854. Middleton is the oldest settlement in Canyon County, with its land first parceled out in 1863 by William N. Montgomery. In 1872, flooding of the Boise River created a new channel that left the town isolated on an island. As a result, the settlement was relocated to a new site after 1880. Middleton was incorporated as a city in 1910, although its certificate of incorporation was not issued until 1971. In September 1942, Franklin D. Roosevelt's Attorney General Francis Biddle , revoked the second-class mailing rights of the Boise Valley Herald, a small weekly newspaper based in Middleton for criticizing U.S involvement in World War II and Internment of Japanese Americans, it was taken down for broader wartime dissent and perceived undermining of national policy during The War.
Transportation The city is served by State Highway 44. It connects to Interstate 84 at exit 25, three miles (5 km) to the west; the city of Star is six miles (10 km) to the east on SH-44. Education The majority of Middleton is in the Middleton School District 134.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
adaboiseidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
Idaho Supreme Court
Q5987471 QID OVERLAP 0.520
QID OVERLAP: Q5987471 in water_rights (tier:branch) and cleaning_services (tier:branch). | SHARED TOKENS (2): "building", "idaho".
buildingidaho
he Idaho Supreme Court are binding on all other Idaho state courts. The only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
Video coverage The Idaho Supreme Court first permitted live video and audio coverage from its chambers in late 1978. See also Courts of Idaho References External links Idaho State Judiciary Idaho Architecture Project.org - Idaho Supreme Court building American Courthouses – Idaho Supreme Court building
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
249 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP249 edges
🌲 EVERGREEN1 edges
0.650
adaboisebuiltbureauconstructioncontroldirectlydownstreamearlyfederalformsfullidaholeveloperatingoperationalpowerprivatesouthernutility
SHARED TOKENS (21): "ada", "boise", "built", "bureau", "construction", "control", "directly", "downstream", "early", "federal", "forms", "full", "idaho", "level", "operating", "operational", "power", "private", "southern", "utility".... | URL->A (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
🌿 BRANCH199 edges
0.500
amongboiseclassifieddivisionestablishedidahomainoperatesproductionprofessionalpublicresearchschoolsstatewideuniversity
SHARED TOKENS (15): "among", "boise", "classified", "division", "established", "idaho", "main", "operates", "production", "professional", "public", "research", "schools", "statewide", "university". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherbroadconstructioncontaminationcreatecreateddeepenvironmentalleastmethodsmodernrequiresitesourcesstructuresupplysurfacesurroundingtreatment
SHARED TOKENS (22): "access", "another", "broad", "construction", "contamination", "create", "created", "deep", "environmental", "least", "methods", "modern", "require", "site", "sources", "structure", "supply", "surface", "surrounding", "treatment".... | EXACT TITLE in water_rights: "Well". | EXACT TITLE in cleaning_services: "Well".
0.500
alongsideenergyformindustriallandlargemajorrecreationreportsresultsurfacesurroundingtreatmenttypesuseswastewaterwaterwaters
SHARED TOKENS (18): "alongside", "energy", "form", "industrial", "land", "large", "major", "recreation", "reports", "result", "surface", "surrounding", "treatment", "types", "uses", "wastewater", "water", "waters". | EXACT TITLE in water_rights: "Surface water".
0.500
anothercurrentdifferentenergyenoughevenformslevelmakingprocessratesinglestablethoughtreated
SHARED TOKENS (15): "another", "current", "different", "energy", "enough", "even", "forms", "level", "making", "process", "rate", "single", "stable", "though", "treated". | EXACT TITLE in water_rights: "Radionuclide".
0.500
aroundbuildingbuiltconstructioncoversdesigndomesticeconomicfacilitiesindustrialinfrastructuremaintenancepercentplanningprocesswork
SHARED TOKENS (16): "around", "building", "built", "construction", "covers", "design", "domestic", "economic", "facilities", "industrial", "infrastructure", "maintenance", "percent", "planning", "process", "work". | EXACT TITLE in water_rights: "Construction". | EXACT TITLE in cleaning_services: "Construction".
0.500
Land use ↗ Q1165944 EXACT TITLE
anotherbuiltcategoriescategorychangesclassificationcoverdatadescribedirectlyenvironmentenvironmentalimpactlandland-usemajormanagementmethodsmonitoringpractices
SHARED TOKENS (26): "another", "built", "categories", "category", "changes", "classification", "cover", "data", "describe", "directly", "environment", "environmental", "impact", "land", "land-use", "major", "management", "methods", "monitoring", "practices".... | EXACT TITLE in water_rights: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturearoundbasinboisecapitaldistinctdividedearlyeconomygeographicidahoinsteadisolatedlandmanufacturingmethodsnationalnorthwestofficialpopulation
SHARED TOKENS (25): "agriculture", "around", "basin", "boise", "capital", "distinct", "divided", "early", "economy", "geographic", "idaho", "instead", "isolated", "land", "manufacturing", "methods", "national", "northwest", "official", "population".... | EXACT TITLE in water_rights: "Idaho". | EXACT TITLE in cleaning_services: "Idaho".
0.500
anotherbasinboundariescommonlydrainageengineeringenvironmentallandplacesrathersinglesurfacesystemthoughwater
SHARED TOKENS (15): "another", "basin", "boundaries", "commonly", "drainage", "engineering", "environmental", "land", "places", "rather", "single", "surface", "system", "though", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.500
additionalapplicationsboundariesbuiltcapacityconditionsdepartmentenergyformationindustrialoccurspowerprocessesratespacestoredsupplywater
SHARED TOKENS (18): "additional", "applications", "boundaries", "built", "capacity", "conditions", "department", "energy", "formation", "industrial", "occurs", "power", "processes", "rate", "space", "stored", "supply", "water". | EXACT TITLE in water_rights: "Geothermal energy".
0.500
applicationbuildingcodecodescurrentdamagedepartmentevenfacilitiesfirelawlocalmeasuresoperatorsownerspersonnelproductionprotectionrelatedresearch
SHARED TOKENS (21): "application", "building", "code", "codes", "current", "damage", "department", "even", "facilities", "fire", "law", "local", "measures", "operators", "owners", "personnel", "production", "protection", "related", "research".... | EXACT TITLE in cleaning_services: "Fire protection".
0.500
anothercommonlyconnectedcontaminationdesigndevelopeddistributiondrainsenergyengineeringgoverninglocalmainplacesqualitysolidsuppliessurfacesystemsystems
SHARED TOKENS (22): "another", "commonly", "connected", "contamination", "design", "developed", "distribution", "drains", "energy", "engineering", "governing", "local", "main", "places", "quality", "solid", "supplies", "surface", "system", "systems".... | EXACT TITLE in water_rights: "Hydrogeology".
0.500
associationbecomebureaubusinessbusinessescodeconsumerscustomerevenincorporatedindependentlylocalmarketingmarketplacematerialsoperatingorganizationspolicypracticesprivate
SHARED TOKENS (25): "association", "become", "bureau", "business", "businesses", "code", "consumers", "customer", "even", "incorporated", "independently", "local", "marketing", "marketplace", "materials", "operating", "organizations", "policy", "practices", "private".... | EXACT TITLE in cleaning_services: "Better Business Bureau".
0.500
additionalbudgetscenterscommercialcontrolledcreateddevelopeddifferentdisposaleconomicembeddedenergyenvironmentenvironmentalexistingfoodhealthindustrialitselflarge
SHARED TOKENS (48): "additional", "budgets", "centers", "commercial", "controlled", "created", "developed", "different", "disposal", "economic", "embedded", "energy", "environment", "environmental", "existing", "food", "health", "industrial", "itself", "large".... | EXACT TITLE in cleaning_services: "Waste management".
0.500
affectalonebeyondbuildingcodecodesconditionscontroldemanddependdesigndirectdirectlydistributionenergyenvironmentequipmentgenerallyhealthimpact
SHARED TOKENS (45): "affect", "alone", "beyond", "building", "code", "codes", "conditions", "control", "demand", "depend", "design", "direct", "directly", "distribution", "energy", "environment", "equipment", "generally", "health", "impact".... | EXACT TITLE in cleaning_services: "Ventilation (architecture)".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturebecomecapacitycentralcleancommonlyconstructingdeepdischargedisposaldistributionenvironmentalformformationindustriallandlevellossmajormunicipal
SHARED TOKENS (36): "agriculture", "become", "capacity", "central", "clean", "commonly", "constructing", "deep", "discharge", "disposal", "distribution", "environmental", "form", "formation", "industrial", "land", "level", "loss", "major", "municipal".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamongassociationauthoritybureauconstructioncontractscreateddepartmentestablishedfederallandlawmaintenancemajormeridiannationalprogramprojectprovisions
SHARED TOKENS (27): "act", "among", "association", "authority", "bureau", "construction", "contracts", "created", "department", "established", "federal", "land", "law", "maintenance", "major", "meridian", "national", "program", "project", "provisions".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
Corporation ↗ Q167037 EXACT TITLE
actboardbusinesscapacityclassifiedcontrolcorporatedifferentdividedearlyentitiesentityestablishedgenerallyincorporatedinsteadjurisdictionlawlegallimited
SHARED TOKENS (36): "act", "board", "business", "capacity", "classified", "control", "corporate", "different", "divided", "early", "entities", "entity", "established", "generally", "incorporated", "instead", "jurisdiction", "law", "legal", "limited".... | EXACT TITLE in cleaning_services: "Corporation".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessacquisitionamongaroundbecomebeyondbusinesscapitalcareerchannelconnectionscreatedesignexpandedfirmsinformationlistlistingsnetworkonline
SHARED TOKENS (32): "access", "acquisition", "among", "around", "become", "beyond", "business", "capital", "career", "channel", "connections", "create", "design", "expanded", "firms", "information", "list", "listings", "network", "online".... | EXACT TITLE in cleaning_services: "LinkedIn".
0.500
Laundry ↗ Q852100 EXACT TITLE
buildingbusinesscommercialdifferentfacilityfunctionhistoryhomeindustrialitselfmethodsneedoutsideplaceresidenceutilitywork
SHARED TOKENS (17): "building", "business", "commercial", "different", "facility", "function", "history", "home", "industrial", "itself", "methods", "need", "outside", "place", "residence", "utility", "work". | EXACT TITLE in cleaning_services: "Laundry".
0.500
Wastewater ↗ Q336191 EXACT TITLE
anotherapplicationscombinationcommercialcommonlydomesticindustrialmunicipalprocessesrunoffsewerstormsurfacewastewastewaterwater
SHARED TOKENS (16): "another", "applications", "combination", "commercial", "commonly", "domestic", "industrial", "municipal", "processes", "runoff", "sewer", "storm", "surface", "waste", "wastewater", "water". | EXACT TITLE in water_rights: "Wastewater". | EXACT TITLE in cleaning_services: "Wastewater".
0.500
actbecomebuiltbureaudepartmentestablishedfederalgovernmentlawmanagementoperationpowerprogramprovidingprovisionsresourcesalestoragesupplythroughout
SHARED TOKENS (22): "act", "become", "built", "bureau", "department", "established", "federal", "government", "law", "management", "operation", "power", "program", "providing", "provisions", "resource", "sale", "storage", "supply", "throughout".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
Nitrate ↗ Q49916468 EXACT TITLE
absenceapplicationscomponentsdirectenergyenvironmentfocusedhealthmanufacturingmeansmodernprocessesproductionrunoffsourceswater
SHARED TOKENS (16): "absence", "applications", "components", "direct", "energy", "environment", "focused", "health", "manufacturing", "means", "modern", "processes", "production", "runoff", "sources", "water". | EXACT TITLE in water_rights: "Nitrate".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationaroundavailabilitybuildingbuiltclassifiedcleanconstructiondesigndevelopeddownstreamearlyengineeringfunctionsgoverninghealthincorporatedindustrialland
SHARED TOKENS (39): "additional", "application", "around", "availability", "building", "built", "classified", "clean", "construction", "design", "developed", "downstream", "early", "engineering", "functions", "governing", "health", "incorporated", "industrial", "land".... | EXACT TITLE in water_rights: "Dam". | EXACT TITLE in cleaning_services: "Dam".
0.500
Fire ↗ Q3196 EXACT TITLE
agricultureanimalanotherbecomecontaminationdamagedependdirectlyenoughfireformgrowthhistoryhomelandlossmajormanagephysicalprocess
SHARED TOKENS (33): "agriculture", "animal", "another", "become", "contamination", "damage", "depend", "directly", "enough", "fire", "form", "growth", "history", "home", "land", "loss", "major", "manage", "physical", "process".... | EXACT TITLE in water_rights: "Fire". | EXACT TITLE in cleaning_services: "Fire".
0.500
additionalbroaderbusinesscommercialdomesticexceptfocusedhealthindustrialinstitutionalinstitutionslargemaintenancemanagemanagementoccupationalphysicalprivateprocessesproviding
SHARED TOKENS (26): "additional", "broader", "business", "commercial", "domestic", "except", "focused", "health", "industrial", "institutional", "institutions", "large", "maintenance", "manage", "management", "occupational", "physical", "private", "processes", "providing".... | EXACT TITLE in cleaning_services: "Housekeeping".
0.500
Hepatitis B ↗ Q6853 EXACT TITLE
anotheraroundbecomecannotcontactdevelopedfullhealthmainmethodsnationalpopulationpracticesprogramspublicrapidreceiveregionrequirerequired
SHARED TOKENS (25): "another", "around", "become", "cannot", "contact", "developed", "full", "health", "main", "methods", "national", "population", "practices", "programs", "public", "rapid", "receive", "region", "require", "required".... | EXACT TITLE in cleaning_services: "Hepatitis B".
0.500
Drought ↗ Q43059 EXACT TITLE
agricultureavailabilitybasinbecomeconditionsdirectlyeconomiceconomyenvironmentalexperiencefoodhealthhistoryimpactincreasedincreaseslargelocallossperiod
SHARED TOKENS (31): "agriculture", "availability", "basin", "become", "conditions", "directly", "economic", "economy", "environmental", "experience", "food", "health", "history", "impact", "increased", "increases", "large", "local", "loss", "period".... | EXACT TITLE in water_rights: "Drought".
0.500
appropriateconnectingentryequipmenthealthlimitedmaintenancenamesoccupationalplanprecautionsqualitysafetyspacestoragetrainingworkers
SHARED TOKENS (17): "appropriate", "connecting", "entry", "equipment", "health", "limited", "maintenance", "names", "occupational", "plan", "precautions", "quality", "safety", "space", "storage", "training", "workers". | EXACT TITLE in cleaning_services: "Confined space".
0.500
additionaladministrativeappliescannotcategoriesconditionscontrolcontrolscreatedesignelectricalemployeeengineeringenvironmentequipmentframeworkhealthitemsmeasuresmechanism
SHARED TOKENS (37): "additional", "administrative", "applies", "cannot", "categories", "conditions", "control", "controls", "create", "design", "electrical", "employee", "engineering", "environment", "equipment", "framework", "health", "items", "measures", "mechanism".... | EXACT TITLE in cleaning_services: "Personal protective equipment".
0.500
anotherdisposaldomesticenvironmentfacilityimpactindustrialmainmunicipalperformsprocessprocessesresultingtreatedtreatmenttypesuseswastewastewaterwater
SHARED TOKENS (20): "another", "disposal", "domestic", "environment", "facility", "impact", "industrial", "main", "municipal", "performs", "process", "processes", "resulting", "treated", "treatment", "types", "uses", "waste", "wastewater", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
Disinfectant ↗ Q73984 EXACT TITLE
buildingcleanconcentratedcontactcoursesdifferentformformsfrequentlygenerallymethodsphysicalprocesssimultaneouslysurfacesurfacestreatmenttypeswastewastewater
SHARED TOKENS (21): "building", "clean", "concentrated", "contact", "courses", "different", "form", "forms", "frequently", "generally", "methods", "physical", "process", "simultaneously", "surface", "surfaces", "treatment", "types", "waste", "wastewater".... | EXACT TITLE in cleaning_services: "Disinfectant".
0.500
administrativebecomecharacterizedclassifiedcreatecreatescurrentdescribesdevelopedeconomiceducationenvironmentalgrowthhealthimpactincreasedinstitutionallandlevelmajor
SHARED TOKENS (42): "administrative", "become", "characterized", "classified", "create", "creates", "current", "describes", "developed", "economic", "education", "environmental", "growth", "health", "impact", "increased", "institutional", "land", "level", "major".... | EXACT TITLE in water_rights: "Urbanization".
0.500
becomecommonlycomponentsconnectedconsumersdesigneconomyengineeringequipmentindustrialinsteadlaborlargemanufacturingmaterialsprocessproducingproductionsalesemiconductor
SHARED TOKENS (22): "become", "commonly", "components", "connected", "consumers", "design", "economy", "engineering", "equipment", "industrial", "instead", "labor", "large", "manufacturing", "materials", "process", "producing", "production", "sale", "semiconductor".... | EXACT TITLE in water_rights: "Manufacturing". | EXACT TITLE in cleaning_services: "Manufacturing".
0.500
cleancreateemployeeformformsindustrialmediamethodsprocessesrequiresolidsurfacesurfacesuseswaste
SHARED TOKENS (15): "clean", "create", "employee", "form", "forms", "industrial", "media", "methods", "processes", "require", "solid", "surface", "surfaces", "uses", "waste". | EXACT TITLE in cleaning_services: "Dry-ice blasting".
0.500
Hydrology ↗ Q42250 EXACT TITLE
basindatadistributiondrainageengineeringenvironmentalmanagementmethodsphysicalplanningpolicypractitionerqualityrelatedresearchsurfacewater
SHARED TOKENS (17): "basin", "data", "distribution", "drainage", "engineering", "environmental", "management", "methods", "physical", "planning", "policy", "practitioner", "quality", "related", "research", "surface", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
actadditionalbudgetbureaucodecreateddecadedepartmentenforcementfederalgenerallygovernmenthistoryincreaseslargelawmainofficeoperationalpercent
SHARED TOKENS (29): "act", "additional", "budget", "bureau", "code", "created", "decade", "department", "enforcement", "federal", "generally", "government", "history", "increases", "large", "law", "main", "office", "operational", "percent".... | EXACT TITLE in cleaning_services: "Internal Revenue Service".
0.500
Cleaner ↗ Q1760141 EXACT TITLE
aroundbuildingcleandomesticfacilityindustrialmaintenancemanagersoperatorotherwiseplacespublicschoolssitespacewhosework
SHARED TOKENS (17): "around", "building", "clean", "domestic", "facility", "industrial", "maintenance", "managers", "operator", "otherwise", "places", "public", "schools", "site", "space", "whose", "work". | EXACT TITLE in cleaning_services: "Cleaner".
0.500
agenciesbroadbudgetbureaubusinessesconditionscoordinationcurrentdatadepartmenteconomicfederalgovernmentlaborlocalmaintainmajormanagementneedoffice
SHARED TOKENS (29): "agencies", "broad", "budget", "bureau", "businesses", "conditions", "coordination", "current", "data", "department", "economic", "federal", "government", "labor", "local", "maintain", "major", "management", "need", "office".... | EXACT TITLE in cleaning_services: "Bureau of Labor Statistics".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondcharacteristicsclassifiedenvironmentformationhomeindustriallandlayermajormaterialspressureregionrelatedsolidwater
SHARED TOKENS (16): "beyond", "characteristics", "classified", "environment", "formation", "home", "industrial", "land", "layer", "major", "materials", "pressure", "region", "related", "solid", "water". | EXACT TITLE in water_rights: "Aquifer".
0.500
Logistics ↗ Q177777 EXACT TITLE
acquiringanotherequipmentfacilityfoodinformationitemsmanagementmaterialsmodeloperationalphysicalplanningproductionprofessionalpublicrelatedresourcesupplytogether
SHARED TOKENS (21): "acquiring", "another", "equipment", "facility", "food", "information", "items", "management", "materials", "model", "operational", "physical", "planning", "production", "professional", "public", "related", "resource", "supply", "together".... | EXACT TITLE in cleaning_services: "Logistics".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativeboardbuiltbusinessclassclientsdepartmentdepartmentsdirectearlyeconomyenvironmentequipmentfacilitiesfacilityfoodformfunction
SHARED TOKENS (46): "access", "additional", "administrative", "board", "built", "business", "class", "clients", "department", "departments", "direct", "early", "economy", "environment", "equipment", "facilities", "facility", "food", "form", "function".... | EXACT TITLE in cleaning_services: "Hotel".
0.500
Water treatment ↗ EXACT TITLE
advancedappropriatecomponentsdevelopedenergyenvironmentenvironmentalhealthincreasedindustrialmaintenancematerialsmethodsprocessprocessesqualityreceivingrecreationresourcespecific
SHARED TOKENS (25): "advanced", "appropriate", "components", "developed", "energy", "environment", "environmental", "health", "increased", "industrial", "maintenance", "materials", "methods", "process", "processes", "quality", "receiving", "recreation", "resource", "specific".... | EXACT TITLE in water_rights: "Water treatment".
0.500
characteristicscompliancecontactdeterminesfrequentlygenerallyhealthimpactphysicalqualityreferencesafetystandardssupplytreatmentwater
SHARED TOKENS (16): "characteristics", "compliance", "contact", "determines", "frequently", "generally", "health", "impact", "physical", "quality", "reference", "safety", "standards", "supply", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.500
Telemetry ↗ Q209867 EXACT TITLE
commonlycontroldataequipmentinstructionsmechanismsmediamodernmonitoringneednetworkoperatephysicalpowerreceivereceivingrequiresystems
SHARED TOKENS (18): "commonly", "control", "data", "equipment", "instructions", "mechanisms", "media", "modern", "monitoring", "need", "network", "operate", "physical", "power", "receive", "receiving", "require", "systems". | EXACT TITLE in water_rights: "Telemetry".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciesbasincanyoncentralchannelcommercialconstructioncontrolcreateddevelopeddownstreamdrainshistoryidaholargelimitedmajornationalnorthwestpolicy
SHARED TOKENS (31): "agencies", "basin", "canyon", "central", "channel", "commercial", "construction", "control", "created", "developed", "downstream", "drains", "history", "idaho", "large", "limited", "major", "national", "northwest", "policy".... | EXACT TITLE in water_rights: "Snake River".
0.500
Insurance ↗ Q43183 EXACT TITLE
anotherclaimclaimsconditionsdamageentityestablishedfeeformhealthlargelossmanagementmeansownershippolicyprotectprotectionrequiredrisk
SHARED TOKENS (21): "another", "claim", "claims", "conditions", "damage", "entity", "established", "fee", "form", "health", "large", "loss", "management", "means", "ownership", "policy", "protect", "protection", "required", "risk".... | EXACT TITLE in cleaning_services: "Insurance".
0.500
businessbusinessescapacitycommercialconnectionscustomerexpandedgenerallyhomeincreasedofficeoperateoperatesownerregulationsresidentialstreetworkzoning
SHARED TOKENS (19): "business", "businesses", "capacity", "commercial", "connections", "customer", "expanded", "generally", "home", "increased", "office", "operate", "operates", "owner", "regulations", "residential", "street", "work", "zoning". | EXACT TITLE in cleaning_services: "Home business".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescomponentsconstructionengineeringenvironmentequipmentestablishformsgovernmenthistorylandlawlegalmapsownershipplanningprofessionalpropertyrequired
SHARED TOKENS (26): "analysis", "boundaries", "components", "construction", "engineering", "environment", "equipment", "establish", "forms", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "professional", "property", "required".... | EXACT TITLE in water_rights: "Surveying".
0.500
Contract ↗ Q93288 EXACT TITLE
applyboundarybusinesscategorycodecommercialcontractsdifferentdistinctdocumentenforcementframeworkgeneralgenerallyindependentlawlegalmajormodernnational
SHARED TOKENS (31): "apply", "boundary", "business", "category", "code", "commercial", "contracts", "different", "distinct", "document", "enforcement", "framework", "general", "generally", "independent", "law", "legal", "major", "modern", "national".... | EXACT TITLE in water_rights: "Contract". | EXACT TITLE in cleaning_services: "Contract".
0.500
Indeed ↗ Q1045367 EXACT TITLE
additionalallowingapplyaroundbecomecareercentralcomdirectlyemploymentfirmsindependentjobslistingsrecruitsinglesitestoragevertical
SHARED TOKENS (19): "additional", "allowing", "apply", "around", "become", "career", "central", "com", "directly", "employment", "firms", "independent", "jobs", "listings", "recruit", "single", "site", "storage", "vertical". | EXACT TITLE in cleaning_services: "Indeed".
0.500
amongboisebusinessclassifiedcollegedivisioneducationengineeringhealthidahoindependentprogramprogramspublicreportedresearchuniversity
SHARED TOKENS (17): "among", "boise", "business", "classified", "college", "division", "education", "engineering", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "university". | EXACT TITLE in water_rights: "Boise State University". | EXACT TITLE in cleaning_services: "Boise State University".
0.500
cannotcleanconsumercreatesdifferentformindustrialpowerpressureprocessesrapidratesinglespecializedsurfacesurfacessystemsvolumewater
SHARED TOKENS (19): "cannot", "clean", "consumer", "creates", "different", "form", "industrial", "power", "pressure", "processes", "rapid", "rate", "single", "specialized", "surface", "surfaces", "systems", "volume", "water". | EXACT TITLE in cleaning_services: "Pressure washing".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddeepdevelopeddirectlydischargedistributiondownstreamdrainageenvironmentalformfullgrowth
SHARED TOKENS (50): "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "deep", "developed", "directly", "discharge", "distribution", "downstream", "drainage", "environmental", "form", "full", "growth".... | EXACT TITLE in water_rights: "Irrigation".
0.500
authoritybusinessescapableconstructioncontractsdirecteconomiceconomygovernmentgrowthlocalorganizationspracticesprivateprocessprocurementproducespublicqualityregulate
SHARED TOKENS (27): "authority", "businesses", "capable", "construction", "contracts", "direct", "economic", "economy", "government", "growth", "local", "organizations", "practices", "private", "process", "procurement", "produces", "public", "quality", "regulate".... | EXACT TITLE in cleaning_services: "Government procurement".
0.500
becomecareerclassroomcreatesdevelopeddocumentsemployeeenvironmentequipmentexistingexperienceformgrowthinstructionsmanagemanagementmaterialsperformancepracticalprocess
SHARED TOKENS (26): "become", "career", "classroom", "creates", "developed", "documents", "employee", "environment", "equipment", "existing", "experience", "form", "growth", "instructions", "manage", "management", "materials", "performance", "practical", "process".... | EXACT TITLE in cleaning_services: "On-the-job training".
0.500
associationcontaminationcontractorscontrolenvironmentequipmentmanagemodernmonitoringpressureprocessproducingprofileprotectregulatedrequiredresourcesourcessurfacethroughout
SHARED TOKENS (21): "association", "contamination", "contractors", "control", "environment", "equipment", "manage", "modern", "monitoring", "pressure", "process", "producing", "profile", "protect", "regulated", "required", "resource", "sources", "surface", "throughout".... | EXACT TITLE in water_rights: "Well drilling".
0.500
Agriculture ↗ Q11451 EXACT TITLE
agricultureanimalaroundbroaderbusinessescreateddamagedirectenvironmentalfoodincreasedindependentlyindustriallandlargeleastlevellossmajormaterials
SHARED TOKENS (27): "agriculture", "animal", "around", "broader", "businesses", "created", "damage", "direct", "environmental", "food", "increased", "independently", "industrial", "land", "large", "least", "level", "loss", "major", "materials".... | EXACT TITLE in water_rights: "Agriculture". | EXACT TITLE in cleaning_services: "Agriculture".
0.500
acquisitionadministrationassetsbuildingbusinesscapitalcommercialcontrolequipmentestatehomeindustrialinformationinspectionlandmaintainmaintenancemanagemanagementmove
SHARED TOKENS (37): "acquisition", "administration", "assets", "building", "business", "capital", "commercial", "control", "equipment", "estate", "home", "industrial", "information", "inspection", "land", "maintain", "maintenance", "manage", "management", "move".... | EXACT TITLE in cleaning_services: "Property management".
0.500
actapplicationcleandischargeenterexpresslygenerallyincreasesinsteadneedperiodpermitqualityrequirementsrisksourcessuppliedsurfacesurroundinguses
SHARED TOKENS (21): "act", "application", "clean", "discharge", "enter", "expressly", "generally", "increases", "instead", "need", "period", "permit", "quality", "requirements", "risk", "sources", "supplied", "surface", "surrounding", "uses".... | EXACT TITLE in water_rights: "Return flow".
0.500
Mold ↗ Q159341 EXACT TITLE
classifiedconnecteddamagefoodformformationgenerallygrowthlargemakingmaterialsnetworkproductionpropertyresultshapesinglespecificstructuresurface
SHARED TOKENS (21): "classified", "connected", "damage", "food", "form", "formation", "generally", "growth", "large", "making", "materials", "network", "production", "property", "result", "shape", "single", "specific", "structure", "surface".... | EXACT TITLE in cleaning_services: "Mold".
0.500
actagricultureboardboisebureaucapacityconstructiondesignhomeidahoincreasedlaborlawlevelmaterialsnationalpowerresourceresultingspace
SHARED TOKENS (24): "act", "agriculture", "board", "boise", "bureau", "capacity", "construction", "design", "home", "idaho", "increased", "labor", "law", "level", "materials", "national", "power", "resource", "resulting", "space".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
adaboardboisecanyoncareercollegecountieseducationidaholargenampapopulationprogramspublicreportedservedsoutherntechnicalthroughouttreasure
SHARED TOKENS (23): "ada", "board", "boise", "canyon", "career", "college", "counties", "education", "idaho", "large", "nampa", "population", "programs", "public", "reported", "served", "southern", "technical", "throughout", "treasure".... | EXACT TITLE in water_rights: "College of Western Idaho". | EXACT TITLE in cleaning_services: "College of Western Idaho".
0.500
Hospital ↗ Q16917 EXACT TITLE
additionaladministrativecategoriescentersclassifieddepartmentdepartmentsdirectemergencyequipmentestablishedfacilitiesfacilityfirefoundingfunctionsgeneralgenerallygovernmenthealth
SHARED TOKENS (45): "additional", "administrative", "categories", "centers", "classified", "department", "departments", "direct", "emergency", "equipment", "established", "facilities", "facility", "fire", "founding", "functions", "general", "generally", "government", "health".... | EXACT TITLE in cleaning_services: "Hospital".
0.500
Ergonomics ↗ Q1750812 EXACT TITLE
amongapplicationappliescurrentdatadesignengineeringequipmentexperiencehealthindustrialmethodsperformanceprocessesresearchsafetyspecificsystemsystemsusers
SHARED TOKENS (20): "among", "application", "applies", "current", "data", "design", "engineering", "equipment", "experience", "health", "industrial", "methods", "performance", "processes", "research", "safety", "specific", "system", "systems", "users". | EXACT TITLE in cleaning_services: "Ergonomics".
0.500
anotherapplicableauthoritybuildingbuiltcertificatechangescodescommercialcomplianceconstructiondepartmentdocumentevidencegenerallygovernmentindustrialjurisdictionlawlocal
SHARED TOKENS (30): "another", "applicable", "authority", "building", "built", "certificate", "changes", "codes", "commercial", "compliance", "construction", "department", "document", "evidence", "generally", "government", "industrial", "jurisdiction", "law", "local".... | EXACT TITLE in cleaning_services: "Certificate of occupancy".
0.500
Asbestos ↗ Q104085 EXACT TITLE
aroundbuildingcommonlyconditionsconstructioncreateelectricalevidencehealthperiodphysicalprocessesproducingpropertiesrelatedresultsafetytypes
SHARED TOKENS (18): "around", "building", "commonly", "conditions", "construction", "create", "electrical", "evidence", "health", "period", "physical", "processes", "producing", "properties", "related", "result", "safety", "types". | EXACT TITLE in cleaning_services: "Asbestos".
0.500
addressagenciesauthorizationbusinessdepartmentsdeterminesgovernmentjurisdictionlicenselicenseslocalmunicipalitiesoperateoperatingpermitsphysicalrequiredrequiressingle
SHARED TOKENS (19): "address", "agencies", "authorization", "business", "departments", "determines", "government", "jurisdiction", "license", "licenses", "local", "municipalities", "operate", "operating", "permits", "physical", "required", "requires", "single". | EXACT TITLE in cleaning_services: "Business license".
0.500
agriculturearoundcapitalcommercialdependdifferentenergyinstitutionallargepersonnelpolicypressureproviderspublicqualityregulationseparatesupplysurroundingsystem
SHARED TOKENS (23): "agriculture", "around", "capital", "commercial", "depend", "different", "energy", "institutional", "large", "personnel", "policy", "pressure", "providers", "public", "quality", "regulation", "separate", "supply", "surrounding", "system".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
applicationsclassifiedcombinationcontaminationdetermineenvironmentalformformshealthlistoccursproductionpropertiesproposedprotectionresearchrisksemiconductorsitestherefore
SHARED TOKENS (21): "applications", "classified", "combination", "contamination", "determine", "environmental", "form", "forms", "health", "list", "occurs", "production", "properties", "proposed", "protection", "research", "risk", "semiconductor", "sites", "therefore".... | EXACT TITLE in water_rights: "Arsenic".
0.480
conditionsdamageeducationemergencyenforcementengineeringenvironmentfiremeasuresmethodspracticesresponsesurroundingthem
SHARED TOKENS (14): "conditions", "damage", "education", "emergency", "enforcement", "engineering", "environment", "fire", "measures", "methods", "practices", "response", "surrounding", "them". | EXACT TITLE in cleaning_services: "Fire prevention".
0.480
Upholstery ↗ Q1123578 EXACT TITLE
animalapplicablebuildingcoveringcoversdesigndomesticlayermakesmaterialsprovidingthoughuseswork
SHARED TOKENS (14): "animal", "applicable", "building", "covering", "covers", "design", "domestic", "layer", "makes", "materials", "providing", "though", "uses", "work". | EXACT TITLE in cleaning_services: "Upholstery".
0.480
conditionsdependsdirectlyenvironmentalfoodformhealthmaintainmajorphysicalrequiredsuppliedwaterwork
SHARED TOKENS (14): "conditions", "depends", "directly", "environmental", "food", "form", "health", "maintain", "major", "physical", "required", "supplied", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.480
Angi ↗ Q85741689 EXACT TITLE
contractorsdevelopeddirectoryhomeincorporatedjanuarylistlocalmodelownedplansreviewsuserswork
SHARED TOKENS (14): "contractors", "developed", "directory", "home", "incorporated", "january", "list", "local", "model", "owned", "plans", "reviews", "users", "work". | EXACT TITLE in cleaning_services: "Angi".
0.480
beyondclassifiedcontactdevelopeddirectlyfunctiongrowthinsteadmainmediaresponsesurfacesthoughtypes
SHARED TOKENS (14): "beyond", "classified", "contact", "developed", "directly", "function", "growth", "instead", "main", "media", "response", "surfaces", "though", "types". | EXACT TITLE in cleaning_services: "Antimicrobial".
0.480
classificationconstructiondefinesdesigngeneralindustriallegalmoveplatformpowerratherregulationspecializedstandards
SHARED TOKENS (14): "classification", "construction", "defines", "design", "general", "industrial", "legal", "move", "platform", "power", "rather", "regulation", "specialized", "standards". | EXACT TITLE in cleaning_services: "Powered industrial truck".
0.480
Easement ↗ Q448405 EXACT TITLE
accessamonganotherenteritselflandlawlimitedownedpropertyprovidingpublicrealroad
SHARED TOKENS (14): "access", "among", "another", "enter", "itself", "land", "law", "limited", "owned", "property", "providing", "public", "real", "road". | EXACT TITLE in water_rights: "Easement".
0.480
alonebusinessentityleastlegalownedownerownersprocessresidenceseparatespecificsubjectwork
SHARED TOKENS (14): "alone", "business", "entity", "least", "legal", "owned", "owner", "owners", "process", "residence", "separate", "specific", "subject", "work". | EXACT TITLE in cleaning_services: "Sole proprietorship".
0.480
Fungicide ↗ Q193237 EXACT TITLE
activeagriculturearoundcontactcontroldamageformlocallymethodsmoveprotectqualityresultingsurface
SHARED TOKENS (14): "active", "agriculture", "around", "contact", "control", "damage", "form", "locally", "methods", "move", "protect", "quality", "resulting", "surface". | EXACT TITLE in cleaning_services: "Fungicide".
0.460
accessanotherdescribingestateevenlegalnamesownerpropertyspecificthoughviewwater
SHARED TOKENS (13): "access", "another", "describing", "estate", "even", "legal", "names", "owner", "property", "specific", "though", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.460
apprenticeshipboundariescertificationlaborlevellicenseoutsideperiodpractitionersprofessionalregulatedsystemtraining
SHARED TOKENS (13): "apprenticeship", "boundaries", "certification", "labor", "level", "license", "outside", "period", "practitioners", "professional", "regulated", "system", "training". | EXACT TITLE in water_rights: "Apprenticeship". | EXACT TITLE in cleaning_services: "Apprenticeship".
0.460
Warehouse ↗ Q181623 EXACT TITLE
agriculturebuildingbusinessescomponentsdirectlyfacilityfunctionindustriallargemanufacturingmaterialsproductionstored
SHARED TOKENS (13): "agriculture", "building", "businesses", "components", "directly", "facility", "function", "industrial", "large", "manufacturing", "materials", "production", "stored". | EXACT TITLE in cleaning_services: "Warehouse".
0.440
Ditch ↗ Q2048319 EXACT TITLE
alongsidearoundchannelcommonlyconditionscreateddrainagemajorrequiredthemwaterwhose
SHARED TOKENS (12): "alongside", "around", "channel", "commonly", "conditions", "created", "drainage", "major", "required", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.440
adaboisebuiltbureaucanyonchannelcountiesidahotreasurevalleywaterwestern
SHARED TOKENS (12): "ada", "boise", "built", "bureau", "canyon", "channel", "counties", "idaho", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.440
MODFLOW ↗ Q6716996 EXACT TITLE
beyondboundarycodecommercialconditionsdefinedevelopedmodeloperatingprogrampublicsystems
SHARED TOKENS (12): "beyond", "boundary", "code", "commercial", "conditions", "define", "developed", "model", "operating", "program", "public", "systems". | EXACT TITLE in water_rights: "MODFLOW".
0.440
applicationapplicationsaroundboundariescapacitycolddirectenergyevenformationsurfacetarget
SHARED TOKENS (12): "application", "applications", "around", "boundaries", "capacity", "cold", "direct", "energy", "even", "formation", "surface", "target". | EXACT TITLE in water_rights: "Geothermal heating".
0.440
Snowpack ↗ Q18575846 EXACT TITLE
agricultureanimalclassificationconditionscoverdifferentformationimpactphysicalpropertiesresourcewater
SHARED TOKENS (12): "agriculture", "animal", "classification", "conditions", "cover", "different", "formation", "impact", "physical", "properties", "resource", "water". | EXACT TITLE in water_rights: "Snowpack".
0.440
Hepatitis C ↗ Q154869 EXACT TITLE
accessamongcontactearlyequipmentfoodperiodrequirerisksidetreatmentwater
SHARED TOKENS (12): "access", "among", "contact", "early", "equipment", "food", "period", "require", "risk", "side", "treatment", "water". | EXACT TITLE in cleaning_services: "Hepatitis C".
0.440
contactcontrolequipmenthealthmeanspracticesprecautionsriskrulesthemthereforetreated
SHARED TOKENS (12): "contact", "control", "equipment", "health", "means", "practices", "precautions", "risk", "rules", "them", "therefore", "treated". | EXACT TITLE in cleaning_services: "Universal precautions".
0.420
Reservoir ↗ Q131681 EXACT TITLE
buildingbuiltcreateddrainsexistingformpowerretainingspacestoragewater
SHARED TOKENS (11): "building", "built", "created", "drains", "existing", "form", "power", "retaining", "space", "storage", "water". | EXACT TITLE in water_rights: "Reservoir".
0.420
adaboisecanyoncapacitychannelidahosystemtreasurevalleywaterwestern
SHARED TOKENS (11): "ada", "boise", "canyon", "capacity", "channel", "idaho", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.420
amongappliesclaimeducationemploymenthistorymethodsplaceprocessreferenceverify
SHARED TOKENS (11): "among", "applies", "claim", "education", "employment", "history", "methods", "place", "process", "reference", "verify". | EXACT TITLE in cleaning_services: "Background check".
0.400
Dairy ↗ Q637776 EXACT TITLE
buildingdescribedescribesfoodplaceprocessesproducesproductionstoredworkers
SHARED TOKENS (10): "building", "describe", "describes", "food", "place", "processes", "produces", "production", "stored", "workers". | EXACT TITLE in cleaning_services: "Dairy".
0.400
damageenvironmenthealthlocalmaterialsnationalproducesregulatedsourceswaste
SHARED TOKENS (10): "damage", "environment", "health", "local", "materials", "national", "produces", "regulated", "sources", "waste". | EXACT TITLE in cleaning_services: "Hazardous waste".
0.400
capacitychanneldischargelandmajoroccursrunoffsurfacevolumewater
SHARED TOKENS (10): "capacity", "channel", "discharge", "land", "major", "occurs", "runoff", "surface", "volume", "water". | EXACT TITLE in water_rights: "Streamflow".
0.400
Wheat ↗ Q15645384 EXACT TITLE
arounddemandfoodgenerallandmajormakingpopulationproductionquality
SHARED TOKENS (10): "around", "demand", "food", "general", "land", "major", "making", "population", "production", "quality". | EXACT TITLE in water_rights: "Wheat".
0.400
boisedepartmentenvironmentalfederalgovernmentidahomainqualityregionalregulations
SHARED TOKENS (10): "boise", "department", "environmental", "federal", "government", "idaho", "main", "quality", "regional", "regulations". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.400
agricultureboisebureaucountiesengineeringidaholevelnationalwaterwestern
SHARED TOKENS (10): "agriculture", "boise", "bureau", "counties", "engineering", "idaho", "level", "national", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.380
controlsmakingoccurspersonnelprecautionsprotectionrequiredsurfacestraining
SHARED TOKENS (9): "controls", "making", "occurs", "personnel", "precautions", "protection", "required", "surfaces", "training". | EXACT TITLE in cleaning_services: "Fall protection".
0.380
differentgenerallylawlegalphysicalsurfacesystemsuserswater
SHARED TOKENS (9): "different", "generally", "law", "legal", "physical", "surface", "systems", "users", "water". | EXACT TITLE in water_rights: "Water right".
0.380
deepdrainageenvironmentalmethodsoccursprocessprocessessurfacewater
SHARED TOKENS (9): "deep", "drainage", "environmental", "methods", "occurs", "process", "processes", "surface", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.380
Cleaning ↗ EXACT TITLE
differentenvironmentenvironmentalmethodsoccursprocessprotectionsafetyuses
SHARED TOKENS (9): "different", "environment", "environmental", "methods", "occurs", "process", "protection", "safety", "uses". | EXACT TITLE in cleaning_services: "Cleaning".
0.380
Maid ↗ Q833860 EXACT TITLE
alongsidecategorydevelopeddomesticemploymentremainurbanwesternwork
SHARED TOKENS (9): "alongside", "category", "developed", "domestic", "employment", "remain", "urban", "western", "work". | EXACT TITLE in cleaning_services: "Maid".
0.360
determinesevidencelegalobligationsprocessprocessesreviewsshows
SHARED TOKENS (8): "determines", "evidence", "legal", "obligations", "process", "processes", "reviews", "shows". | EXACT TITLE in water_rights: "Adjudication".
0.360
changescommonlydamageinsteadprocessresultshapewater
SHARED TOKENS (8): "changes", "commonly", "damage", "instead", "process", "result", "shape", "water". | EXACT TITLE in cleaning_services: "Dry cleaning".
0.360
localmanagementopenprocessesresourcesurfacesurfaceswater
SHARED TOKENS (8): "local", "management", "open", "processes", "resource", "surface", "surfaces", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.360
Smoke ↗ Q130768 EXACT TITLE
combinationcommonlycontroldamageotherwisesignalssolidtogether
SHARED TOKENS (8): "combination", "commonly", "control", "damage", "otherwise", "signals", "solid", "together". | EXACT TITLE in cleaning_services: "Smoke".
0.360
Pesticide ↗ Q131656 EXACT TITLE
accountcontrolgeneralotherwisepropertyprotectprotectiontarget
SHARED TOKENS (8): "account", "control", "general", "otherwise", "property", "protect", "protection", "target". | EXACT TITLE in cleaning_services: "Pesticide".
0.340
Virucide ↗ Q3560867 EXACT TITLE
categorydifferentenoughlistoutsidephysicalsurface
SHARED TOKENS (7): "category", "different", "enough", "list", "outside", "physical", "surface". | EXACT TITLE in cleaning_services: "Virucide".
0.340
Detergent ↗ Q334637 EXACT TITLE
applicationcomponentsexperiencemainpropertiesthemwater
SHARED TOKENS (7): "application", "components", "experience", "main", "properties", "them", "water". | EXACT TITLE in cleaning_services: "Detergent".
0.340
industrialresourcesourcessupplysurfacewastewaterwater
SHARED TOKENS (7): "industrial", "resource", "sources", "supply", "surface", "wastewater", "water". | EXACT TITLE in water_rights: "Water resources".
0.340
HIV ↗ Q15787 EXACT TITLE
contactdirectlevelmechanismsresearchsystemtreatment
SHARED TOKENS (7): "contact", "direct", "level", "mechanisms", "research", "system", "treatment". | EXACT TITLE in water_rights: "HIV". | EXACT TITLE in cleaning_services: "HIV".
0.340
commonlydesignplanningpressurequalitysupplysystem
SHARED TOKENS (7): "commonly", "design", "planning", "pressure", "quality", "supply", "system". | EXACT TITLE in water_rights: "Duct (flow)". | EXACT TITLE in cleaning_services: "Duct (flow)".
0.340
Glassdoor ↗ Q15954148 EXACT TITLE
currentemploymentindependentoperateownerrecruitreviews
SHARED TOKENS (7): "current", "employment", "independent", "operate", "owner", "recruit", "reviews". | EXACT TITLE in cleaning_services: "Glassdoor".
0.330
animalcontaminationdisposalindustrialmaterialsregulatedrequiretreatmentwaste
SHARED TOKENS (9): "animal", "contamination", "disposal", "industrial", "materials", "regulated", "require", "treatment", "waste". | URL->B (1): https://www.osha.gov/laws-regs/regulations/standardnumber/1910/1910.1030.
0.320
agriculturebuildingestatelandlandscapereal
SHARED TOKENS (6): "agriculture", "building", "estate", "land", "landscape", "real". | EXACT TITLE in water_rights: "Land development".
0.320
Hoarding ↗ Q1343347 EXACT TITLE
acquisitionactcommonlyitemsotherwisespace
SHARED TOKENS (6): "acquisition", "act", "commonly", "items", "otherwise", "space". | EXACT TITLE in cleaning_services: "Hoarding".
0.320
Bactericide ↗ Q804539 EXACT TITLE
physicalpropertiessolelystructuresurfacesurfaces
SHARED TOKENS (6): "physical", "properties", "solely", "structure", "surface", "surfaces". | EXACT TITLE in cleaning_services: "Bactericide".
0.320
administrationdepartmenteconomicfederalnationaloffice
SHARED TOKENS (6): "administration", "department", "economic", "federal", "national", "office". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.320
Restaurant ↗ Q11707 EXACT TITLE
businessfoodgenerallyservedservessingle
SHARED TOKENS (6): "business", "food", "generally", "served", "serves", "single". | EXACT TITLE in cleaning_services: "Restaurant".
0.320
damagefireprocesspropertystructuralwater
SHARED TOKENS (6): "damage", "fire", "process", "property", "structural", "water". | EXACT TITLE in cleaning_services: "Disaster restoration".
0.300
anotherapplicationconditionsconstructioncontainedcreatedependdisposalenvironmentalgenerallyhealthimpactlandmaterialsmediamunicipalphysicalpressureprogramprograms
SHARED TOKENS (28): "another", "application", "conditions", "construction", "contained", "create", "depend", "disposal", "environmental", "generally", "health", "impact", "land", "materials", "media", "municipal", "physical", "pressure", "program", "programs"....
0.300
associationconsumerdesigngrowthindependentlyintegratedlawlicensedmakingmarketpowerproducingproductionrapidresearchsemiconductorsingle
SHARED TOKENS (17): "association", "consumer", "design", "growth", "independently", "integrated", "law", "licensed", "making", "market", "power", "producing", "production", "rapid", "research", "semiconductor", "single".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
becomebuildingcharacterizedcommercialcoreenvironmentenvironmentalexistingexpansionformgeographicgrowthincreasedindustrialinfrastructurejobslandlargelossmodern
SHARED TOKENS (33): "become", "building", "characterized", "commercial", "core", "environment", "environmental", "existing", "expansion", "form", "geographic", "growth", "increased", "industrial", "infrastructure", "jobs", "land", "large", "loss", "modern"....
0.300
Facility management ↗ KW CROSS HIGH
buildingcommonlydefineselectricalfacilitiesfacilitymaintenancemanagementoperationsplanningrequirementssitesspacestandardssupportsystemsystemsthem
SHARED TOKENS (18): "building", "commonly", "defines", "electrical", "facilities", "facility", "maintenance", "management", "operations", "planning", "requirements", "sites", "space", "standards", "support", "system", "systems", "them".
0.300
analysisanotherapplicationsbroaderbusinessdataengineeringgeographicinformationinstitutionalintegratedmanagemanagementmethodsopenoperationsorganizationsphysicalplanningprocedures
SHARED TOKENS (28): "analysis", "another", "applications", "broader", "business", "data", "engineering", "geographic", "information", "institutional", "integrated", "manage", "management", "methods", "open", "operations", "organizations", "physical", "planning", "procedures"....
0.300
Bleach ↗ Q11587 KW CROSS HIGH
activecapableconditionscontactcontroldamageequipmentfoodgenerallyhealthindustrialmakingmaterialsnicheplacesprocessprocessespropertiesreleasesrequired
SHARED TOKENS (23): "active", "capable", "conditions", "contact", "control", "damage", "equipment", "food", "generally", "health", "industrial", "making", "materials", "niche", "places", "process", "processes", "properties", "releases", "required"....
0.300
advancedapplicationscentralcleancomponentscontaminationcontrolcreatecreatedenvironmentequipmentfacilitiesindustrialintegratedlargemaintainmanufacturingmaterialsmodernneed
SHARED TOKENS (29): "advanced", "applications", "central", "clean", "components", "contamination", "control", "create", "created", "environment", "equipment", "facilities", "industrial", "integrated", "large", "maintain", "manufacturing", "materials", "modern", "need"....
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanotherdevelopeddividedeconomicenforcementenvironmentalgenerallygoverninggovernsjurisdictionlandlawlegalmajorownershipprivatepropertypublicreal
SHARED TOKENS (24): "acquisition", "another", "developed", "divided", "economic", "enforcement", "environmental", "generally", "governing", "governs", "jurisdiction", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real"....
0.300
adaboisecanyoncommonlycountieshomeidahomainmeridianmetropolitannampanorthwestpercentpopulationsectiontreasurevalley
SHARED TOKENS (17): "ada", "boise", "canyon", "commonly", "counties", "home", "idaho", "main", "meridian", "metropolitan", "nampa", "northwest", "percent", "population", "section", "treasure", "valley".
0.300
advancedagriculturebusinessescombinationdirectdistributionenvironmentalindustrialmanagementmunicipalprocessregionremainrequirestandardsstormwatersupplysurfacesystemsystems
SHARED TOKENS (25): "advanced", "agriculture", "businesses", "combination", "direct", "distribution", "environmental", "industrial", "management", "municipal", "process", "region", "remain", "require", "standards", "stormwater", "supply", "surface", "system", "systems"....
0.300
bureaubusinessbusinessescurrentdatadepartmentdepartmentseconomiceconomyfederalfiregovernmentinformationinfrastructurelocalmaintainmakingoccursplanpopulation
SHARED TOKENS (26): "bureau", "business", "businesses", "current", "data", "department", "departments", "economic", "economy", "federal", "fire", "government", "information", "infrastructure", "local", "maintain", "making", "occurs", "plan", "population"....
0.300
actagenciesauthoritycodedependdifferentdirectseconomicfederalgrowthlawmeansmechanismsnationalprohibitsprotectprovisionsregulationsrequiresrules
SHARED TOKENS (23): "act", "agencies", "authority", "code", "depend", "different", "directs", "economic", "federal", "growth", "law", "means", "mechanisms", "national", "prohibits", "protect", "provisions", "regulations", "requires", "rules"....
0.300
amongclassifiedcontactcontaminationcontroldeterminedirectlyevenhealthidentifiedmeansprecautionsratherthoughtypesworkers
SHARED TOKENS (16): "among", "classified", "contact", "contamination", "control", "determine", "directly", "even", "health", "identified", "means", "precautions", "rather", "though", "types", "workers".
0.300
actadministrationappliesapplycoverenvironmentalfederalfoodlawprivateprotectionprovidingpublicqualityregulatedrequiredservedstandardssupplierssystem
SHARED TOKENS (22): "act", "administration", "applies", "apply", "cover", "environmental", "federal", "food", "law", "private", "protection", "providing", "public", "quality", "regulated", "required", "served", "standards", "suppliers", "system"....
0.300
administrationadministrativeagenciesanotherbuiltchangescontrolcreateddivisioneconomiceducationenforcementenvironmentenvironmentalexpandedgenerallygoverninggovernmentitselflaw
SHARED TOKENS (32): "administration", "administrative", "agencies", "another", "built", "changes", "control", "created", "division", "economic", "education", "enforcement", "environment", "environmental", "expanded", "generally", "governing", "government", "itself", "law"....
0.300
accountadditionalagricultureboisechangesdatadifferentearlyexperiencegeneralgenerallyhistoryidahoincreasedincreasesjanuaryleastmakesmodelnampa
SHARED TOKENS (27): "account", "additional", "agriculture", "boise", "changes", "data", "different", "early", "experience", "general", "generally", "history", "idaho", "increased", "increases", "january", "least", "makes", "model", "nampa"....
0.300
consumerdatadifferentdocumentenvironmentalgeneralhealthinformationinsteadinstructionsnamesnationaloccupationalproceduresrequirementsrisksafetysheetstandardized
SHARED TOKENS (19): "consumer", "data", "different", "document", "environmental", "general", "health", "information", "instead", "instructions", "names", "national", "occupational", "procedures", "requirements", "risk", "safety", "sheet", "standardized".
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessadditionalaffectaroundconditionseconomiceconomyestablishedfacilitiesgeneralhealthhistoryinformationmaintenancemeansmechanismoccupationalorganizationsphysicalpolicies
SHARED TOKENS (33): "access", "additional", "affect", "around", "conditions", "economic", "economy", "established", "facilities", "general", "health", "history", "information", "maintenance", "means", "mechanism", "occupational", "organizations", "physical", "policies"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsdescribingenvironmentenvironmentalgeneralgrowthincreasedindustrialmainoccurspoliciesprocessprogramresultresultingrunoffsourcessurfacewastewater
SHARED TOKENS (21): "agriculture", "controls", "describing", "environment", "environmental", "general", "growth", "increased", "industrial", "main", "occurs", "policies", "process", "program", "result", "resulting", "runoff", "sources", "surface", "wastewater"....
0.300
actagenciesappropriateauthoritycomplianceconsumerscontrolenvironmentenvironmentalexpandedfederalframeworkgoverninghealthlawprocessproofprotectprotectionregulated
SHARED TOKENS (23): "act", "agencies", "appropriate", "authority", "compliance", "consumers", "control", "environment", "environmental", "expanded", "federal", "framework", "governing", "health", "law", "process", "proof", "protect", "protection", "regulated"....
0.300
careercollegeeconomiceducationeducationalformsgenerallevelmethodsnamesplacerelatedschoolsspecializedspecifictechnicaltraining
SHARED TOKENS (17): "career", "college", "economic", "education", "educational", "forms", "general", "level", "methods", "names", "place", "related", "schools", "specialized", "specific", "technical", "training".
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecreateddifferentestatefacilityfullgovernmentinsteadlandlegallocalmainoperateotherwiseownerownershipphysicalprivatereal
SHARED TOKENS (27): "authority", "capable", "created", "different", "estate", "facility", "full", "government", "instead", "land", "legal", "local", "main", "operate", "otherwise", "owner", "ownership", "physical", "private", "real"....
0.300
actadministrationcodecoldconditionscreatedenvironmentfederalgoverninggovernmenthealthinstitutelaborlawmainnationaloccupationalprivatesafety
SHARED TOKENS (19): "act", "administration", "code", "cold", "conditions", "created", "environment", "federal", "governing", "government", "health", "institute", "labor", "law", "main", "national", "occupational", "private", "safety".
0.300
associationavailabilitybusinessbusinessescertificatecharacteristicscorporatedifferentdistinctdocumententityformfoundingincorporatedinsteadlegallicenselimitedoperatingoperations
SHARED TOKENS (33): "association", "availability", "business", "businesses", "certificate", "characteristics", "corporate", "different", "distinct", "document", "entity", "form", "founding", "incorporated", "instead", "legal", "license", "limited", "operating", "operations"....
0.300
controlleddesignentirepowersystem
SHARED TOKENS (5): "controlled", "design", "entire", "power", "system". | EXACT TITLE in cleaning_services: "Exhaust system".
0.300
accessactadministrationbusinessbusinessescapitalcentersconnectcontractsdirectoryeconomiceconomyfederalgovernmentindependentjanuaryjobsleastmaintainmaking
SHARED TOKENS (26): "access", "act", "administration", "business", "businesses", "capital", "centers", "connect", "contracts", "directory", "economic", "economy", "federal", "government", "independent", "january", "jobs", "least", "maintain", "making"....
0.300
agriculturebecomebuildingcategorychangesconstructioncontaminationcontrolcumulativedifferentdrainagegenerallylandlargelocalmakingmanagementoperationsqualityregulate
SHARED TOKENS (35): "agriculture", "become", "building", "category", "changes", "construction", "contamination", "control", "cumulative", "different", "drainage", "generally", "land", "large", "local", "making", "management", "operations", "quality", "regulate"....
0.300
actadministersauthorizationdivisionenvironmentalimprovementsinfrastructurenationalnetpdfprotectionpublicreferencerequirementsstructuralwater
SHARED TOKENS (16): "act", "administers", "authorization", "division", "environmental", "improvements", "infrastructure", "national", "net", "pdf", "protection", "public", "reference", "requirements", "structural", "water".
0.300
additionalbasincommercialcomponentsconnectionsconsumersdistributiondownstreamdrainagefacilitiesfiregenerallyindustriallocallyneednetworkpressureprivateprovidingpublic
SHARED TOKENS (30): "additional", "basin", "commercial", "components", "connections", "consumers", "distribution", "downstream", "drainage", "facilities", "fire", "generally", "industrial", "locally", "need", "network", "pressure", "private", "providing", "public"....
0.300
amongassociationboisebureaucanyoncapacitycountiescreatedcreatesdirectlyedgefederalformationidaholevellocalnampanationalofficeopen
SHARED TOKENS (29): "among", "association", "boise", "bureau", "canyon", "capacity", "counties", "created", "creates", "directly", "edge", "federal", "formation", "idaho", "level", "local", "nampa", "national", "office", "open"....
0.300
analysisbroaderbuildingchangescontroldescribingengineeringimpactincreasedinfrastructurelandscapelevelmanagemanagementmeasuresmethodspracticesprocessespropertiesproviding
SHARED TOKENS (28): "analysis", "broader", "building", "changes", "control", "describing", "engineering", "impact", "increased", "infrastructure", "landscape", "level", "manage", "management", "measures", "methods", "practices", "processes", "properties", "providing"....
0.300
Sugar beet ↗ Q151964 EXACT TITLE
classifiedcoldproductiontogetherwhose
SHARED TOKENS (5): "classified", "cold", "production", "together", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.300
Dentistry ↗ Q12128 KW CROSS HIGH
affectcallscommonlyconditionsevidencefocusedhistoryinstitutionsmanagementmodernpracticespractitionerprivaterequireresearchtreatmentwaterwork
SHARED TOKENS (18): "affect", "calls", "commonly", "conditions", "evidence", "focused", "history", "institutions", "management", "modern", "practices", "practitioner", "private", "require", "research", "treatment", "water", "work".
0.300
addressingappliesbroadconstructioncontrolcreatedesigndisposalengineeringenvironmentenvironmentalfocusedhealthimpactindustriallawlicensinglocalmaintainmanagement
SHARED TOKENS (38): "addressing", "applies", "broad", "construction", "control", "create", "design", "disposal", "engineering", "environment", "environmental", "focused", "health", "impact", "industrial", "law", "licensing", "local", "maintain", "management"....
0.300
affectanotherappropriatechangesconditionscontaminationcontrolcumulativeformformsimpactincreasedindustrialinfrastructuremainmanagementplanspowerrequiresresource
SHARED TOKENS (31): "affect", "another", "appropriate", "changes", "conditions", "contamination", "control", "cumulative", "form", "forms", "impact", "increased", "industrial", "infrastructure", "main", "management", "plans", "power", "requires", "resource"....
0.300
affectclaimclaimscoverscreateddamageevenexpresslygenerallegallossmodernotherwisepoliciespolicyprotectprotectionratherriskrule
SHARED TOKENS (24): "affect", "claim", "claims", "covers", "created", "damage", "even", "expressly", "general", "legal", "loss", "modern", "otherwise", "policies", "policy", "protect", "protection", "rather", "risk", "rule"....
0.300
agriculturearoundcapacitycentralchangesconditionscurrentdemanddifferenteconomicenoughenvironmentalexpansionexperiencefunctioninformationinfrastructureleastlocalmanagement
SHARED TOKENS (35): "agriculture", "around", "capacity", "central", "changes", "conditions", "current", "demand", "different", "economic", "enough", "environmental", "expansion", "experience", "function", "information", "infrastructure", "least", "local", "management"....
0.300
amongcreateddamageeconomicemployeeemploymentformgeneralgenerallyhealthlimitedlossoutsideplaceplansprovidingresultsystemworkers
SHARED TOKENS (19): "among", "created", "damage", "economic", "employee", "employment", "form", "general", "generally", "health", "limited", "loss", "outside", "place", "plans", "providing", "result", "system", "workers".
0.300
Child care ↗ Q1455871 KW CROSS HIGH
accessadvancedanotherappropriatebroadcenterscorecoversearlyeconomiceducationeducationalfacilityfocusedformincreasedinstitutionslaborlicensedorganizations
SHARED TOKENS (31): "access", "advanced", "another", "appropriate", "broad", "centers", "core", "covers", "early", "economic", "education", "educational", "facility", "focused", "form", "increased", "institutions", "labor", "licensed", "organizations"....
0.300
Ammonia ↗ Q4087 KW CROSS HIGH
agriculturearoundbuildingclassifieddamagedirectlyenergyevenformformsindustrialoccurspressureprocessproductionprovidingroadservingstablesystems
SHARED TOKENS (22): "agriculture", "around", "building", "classified", "damage", "directly", "energy", "even", "form", "forms", "industrial", "occurs", "pressure", "process", "production", "providing", "road", "serving", "stable", "systems"....
0.300
accessactappropriateclassificationcreatedcurrentdataemployeeenforcementfederalfullhealthmakingprecautionsprocessprotectionregulationregulationsrelatedrequired
SHARED TOKENS (26): "access", "act", "appropriate", "classification", "created", "current", "data", "employee", "enforcement", "federal", "full", "health", "making", "precautions", "process", "protection", "regulation", "regulations", "related", "required"....
0.300
animalcapablecharacteristicscontactcontaineddisposaldistinctemergencyenvironmentenvironmentalfacilitiesgeneralhealthhomeindustrialmaterialsoperatingrequireresearchresult
SHARED TOKENS (26): "animal", "capable", "characteristics", "contact", "contained", "disposal", "distinct", "emergency", "environment", "environmental", "facilities", "general", "health", "home", "industrial", "materials", "operating", "require", "research", "result"....
0.300
amongcapacitycleanconstructioncreatingdemanddirectelectricalenergyenvironmentalimpactincreasedlandlargelossmakingpopulationpowerprincipallyproduces
SHARED TOKENS (28): "among", "capacity", "clean", "construction", "creating", "demand", "direct", "electrical", "energy", "environmental", "impact", "increased", "land", "large", "loss", "making", "population", "power", "principally", "produces"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
activeappropriatebusinesscatalogcharacteristicscommercialdevelopedearlyfacilitiesgenerallygrowthhomeimprovementsindependentlargemaintainsmaterialsmodernnationalopen
SHARED TOKENS (32): "active", "appropriate", "business", "catalog", "characteristics", "commercial", "developed", "early", "facilities", "generally", "growth", "home", "improvements", "independent", "large", "maintains", "materials", "modern", "national", "open"....
0.300
actadaamendedbroadbusinesschangescharacteristicsjanuarylawnationalprohibitsprotectionpublicrequirementsrequires
SHARED TOKENS (15): "act", "ada", "amended", "broad", "business", "changes", "characteristics", "january", "law", "national", "prohibits", "protection", "public", "requirements", "requires".
0.300
actadministrationamongbuildingcenterscontrolcreateddepartmentdistinctdivisionengineeringfederalfunctionsgovernmenthealthindustrialinformationinstituteintegratedmaking
SHARED TOKENS (34): "act", "administration", "among", "building", "centers", "control", "created", "department", "distinct", "division", "engineering", "federal", "functions", "government", "health", "industrial", "information", "institute", "integrated", "making"....
0.300
actaddressingagenciescleancomplianceconcerningcontroleconomicenergyenforcementenvironmentenvironmentalestablishgrowthimpactintersectsjurisdictionlawlegalloss
SHARED TOKENS (36): "act", "addressing", "agencies", "clean", "compliance", "concerning", "control", "economic", "energy", "enforcement", "environment", "environmental", "establish", "growth", "impact", "intersects", "jurisdiction", "law", "legal", "loss"....
0.300
amongconnectscontroldepartmentexpandedhealthincreasedinfrastructurelocalmeasuresmonitoringpracticalprotectionpublicratherrelatedsafetystaffsystem
SHARED TOKENS (19): "among", "connects", "control", "department", "expanded", "health", "increased", "infrastructure", "local", "measures", "monitoring", "practical", "protection", "public", "rather", "related", "safety", "staff", "system".
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcharacterizedcommercialdeterminemanufacturingmodernoutsideprocesspublicregisterrequiredrequirementsresidentialstandardssuppliedsupplysystemtypesvolume
SHARED TOKENS (21): "association", "building", "characterized", "commercial", "determine", "manufacturing", "modern", "outside", "process", "public", "register", "required", "requirements", "residential", "standards", "supplied", "supply", "system", "types", "volume"....
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adaboisecommercialdepartmentfacilityfirefunctionsgeneralidahonationaloperatesprotectionreceiverequiringsupportuseswestern
SHARED TOKENS (17): "ada", "boise", "commercial", "department", "facility", "fire", "functions", "general", "idaho", "national", "operates", "protection", "receive", "requiring", "support", "uses", "western".
0.300
administersagriculturebudgetcommercialcurrentdepartmentdirectlyfederalfoodgovernmentnationalproductionprogramprogramsreportssafetyservedtogether
SHARED TOKENS (18): "administers", "agriculture", "budget", "commercial", "current", "department", "directly", "federal", "food", "government", "national", "production", "program", "programs", "reports", "safety", "served", "together".
0.300
accountadvancedapplicationaroundavailabilitybusinessesconnectedconstructiondemanddesigndevelopeddifferentdischargedrainageenergyenvironmentevenindustriallandlarge
SHARED TOKENS (45): "account", "advanced", "application", "around", "availability", "businesses", "connected", "construction", "demand", "design", "developed", "different", "discharge", "drainage", "energy", "environment", "even", "industrial", "land", "large"....
0.300
actagenciesapplyaroundauthoritycreatedenvironmentenvironmentalestablishedfederalgovernmentimpactjanuarylawnationalpoliciespolicyproposedqualityreports
SHARED TOKENS (24): "act", "agencies", "apply", "around", "authority", "created", "environment", "environmental", "established", "federal", "government", "impact", "january", "law", "national", "policies", "policy", "proposed", "quality", "reports"....
0.300
accesscannotcharacteristicscharacterizedcleancontroldifferentdisposalenergyentityfederalformsfrequentlygovernmentinfrastructurelargelocalmaintainsmarketmodern
SHARED TOKENS (37): "access", "cannot", "characteristics", "characterized", "clean", "control", "different", "disposal", "energy", "entity", "federal", "forms", "frequently", "government", "infrastructure", "large", "local", "maintains", "market", "modern"....
0.300
actaffectanotherapplicationscommercialcoverscurrentdamagedemandgrowthimprovementsincreasedlevellocallossmakesmanagemanagementmanufacturingmunicipal
SHARED TOKENS (32): "act", "affect", "another", "applications", "commercial", "covers", "current", "damage", "demand", "growth", "improvements", "increased", "level", "local", "loss", "makes", "manage", "management", "manufacturing", "municipal"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactualadditionaladministrationagenciesauthorizesbusinesscannotcleancombinationcontrolscreateddamagedepartmentdetermineearlyeligibleenvironmentenvironmental
SHARED TOKENS (56): "acquisition", "act", "actual", "additional", "administration", "agencies", "authorizes", "business", "cannot", "clean", "combination", "controls", "created", "damage", "department", "determine", "early", "eligible", "environment", "environmental"....
0.300
buildingconsiderationscontroldesignelectricalenergyenvironmentalimpactmaintenanceoperatingperformancequalityregulatesystemswater
SHARED TOKENS (15): "building", "considerations", "control", "design", "electrical", "energy", "environmental", "impact", "maintenance", "operating", "performance", "quality", "regulate", "systems", "water".
0.300
Nursing home ↗ Q837142 KW CROSS HIGH
associationdifferentemergencyfacilitiesfacilityhomeinstitutionsneedoccupationalphysicalprivatepublicrequireresidentialseniorshort-termstaff
SHARED TOKENS (17): "association", "different", "emergency", "facilities", "facility", "home", "institutions", "need", "occupational", "physical", "private", "public", "require", "residential", "senior", "short-term", "staff".
0.300
actactiveagenciesauthoritybudgetbuildingbusinesscapacitycleancomponentsconfirmsconstructioncontroldamagedepartmentdesigndirectdirectlyeconomyenergy
SHARED TOKENS (56): "act", "active", "agencies", "authority", "budget", "building", "business", "capacity", "clean", "components", "confirms", "construction", "control", "damage", "department", "design", "direct", "directly", "economy", "energy"....
0.300
actadministrationapplyassetsauthorizationbusinessbusinessescertificationclassifiedgovernmenthomeinspectionlargelicensemeasuresmethodsnetoperateoperationsorganizations
SHARED TOKENS (29): "act", "administration", "apply", "assets", "authorization", "business", "businesses", "certification", "classified", "government", "home", "inspection", "large", "license", "measures", "methods", "net", "operate", "operations", "organizations"....
0.300
appliescomplycontaminationdescribesdischargedisposalenvironmentfacilitiesfoodindustrialmanufacturingmaterialsmunicipalpowerpreservingprocessprocessesproductionregulationssewer
SHARED TOKENS (28): "applies", "comply", "contamination", "describes", "discharge", "disposal", "environment", "facilities", "food", "industrial", "manufacturing", "materials", "municipal", "power", "preserving", "process", "processes", "production", "regulations", "sewer"....
0.300
Odor ↗ Q485537 EXACT TITLE
describefoodfrequentlygenerallysystem
SHARED TOKENS (5): "describe", "food", "frequently", "generally", "system". | EXACT TITLE in cleaning_services: "Odor".
0.300
actadministrationconditionsdepartmenteducationemploymentestablishedfederalfirmhealthlaborlawoccupationalprovidingregulationsregulatorysafetystandardstraining
SHARED TOKENS (19): "act", "administration", "conditions", "department", "education", "employment", "established", "federal", "firm", "health", "labor", "law", "occupational", "providing", "regulations", "regulatory", "safety", "standards", "training".
0.300
adabasinboisecentralconnectedidahoitselfmetropolitannationalpopulationrecreationsectionstarvalleywestern
SHARED TOKENS (15): "ada", "basin", "boise", "central", "connected", "idaho", "itself", "metropolitan", "national", "population", "recreation", "section", "star", "valley", "western".
0.300
Pumping station ↗ KW CROSS HIGH
allowinganotherapplicationscustomerdemanddesigndifferentdrainageenergyenvironmentalequipmentfacilitiesfootprintinfrastructurelandlevelmanagementmodernmonitoringmove
SHARED TOKENS (34): "allowing", "another", "applications", "customer", "demand", "design", "different", "drainage", "energy", "environmental", "equipment", "facilities", "footprint", "infrastructure", "land", "level", "management", "modern", "monitoring", "move"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
anotherbusinesscapitalcomplyconditionscorporatedirecteconomicentityexpansiongrowthlargelegallicenseslicensingmarketmeansmodelobligationsowned
SHARED TOKENS (28): "another", "business", "capital", "comply", "conditions", "corporate", "direct", "economic", "entity", "expansion", "growth", "large", "legal", "licenses", "licensing", "market", "means", "model", "obligations", "owned"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationcommonlyconnectevenexpandedfeefullfunctionsgovernmentimpactincreasedlandlegalmunicipalitiesobtainownerownersownership
SHARED TOKENS (31): "acquisition", "another", "application", "commonly", "connect", "even", "expanded", "fee", "full", "functions", "government", "impact", "increased", "land", "legal", "municipalities", "obtain", "owner", "owners", "ownership"....
0.300
addressingaffectagricultureanimalcentralchangesconcentratedcontaminationdirectdischargedownstreameconomicenterenvironmentenvironmentalfoodimpactlandlargelocal
SHARED TOKENS (34): "addressing", "affect", "agriculture", "animal", "central", "changes", "concentrated", "contamination", "direct", "discharge", "downstream", "economic", "enter", "environment", "environmental", "food", "impact", "land", "large", "local"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontrolexpansionfinancefirmfirmsgeneralinsteadlimitedmanagementoperationalotherwiseownershipprivatepublicrather
SHARED TOKENS (23): "active", "business", "capital", "category", "changes", "control", "expansion", "finance", "firm", "firms", "general", "instead", "limited", "management", "operational", "otherwise", "ownership", "private", "public", "rather"....
0.300
Domestic worker ↗ Q54128 KW CROSS HIGH
appliescategorycommonlydevelopeddomesticemploymenthomelargelimitedmaintenancemanagementoccupationalperformsperiodplaceprovidingregulatedresidencesubjectsystem
SHARED TOKENS (24): "applies", "category", "commonly", "developed", "domestic", "employment", "home", "large", "limited", "maintenance", "management", "occupational", "performs", "period", "place", "providing", "regulated", "residence", "subject", "system"....
0.300
agenciesbuiltcomponentsconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsfocusedgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalplaceprivate
SHARED TOKENS (24): "agencies", "built", "components", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "focused", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "place", "private"....
0.300
boisebureaucapacitycomponentsidahonampanationalplaceplacesprogramprojectregistertreasurevalleywaterwestern
SHARED TOKENS (16): "boise", "bureau", "capacity", "components", "idaho", "nampa", "national", "place", "places", "program", "project", "register", "treasure", "valley", "water", "western".
0.300
Maize ↗ Q11575 KW CROSS HIGH
alongsideanimalbecomecommercialfoodincreasedmainmajormodernproducesproductionsouthernthroughouttreatmentuses
SHARED TOKENS (15): "alongside", "animal", "become", "commercial", "food", "increased", "main", "major", "modern", "produces", "production", "southern", "throughout", "treatment", "uses".
0.300
currentdatadepartmentfederalgovernmentlandscapemajormakesmapspublicregulatoryresearchspacewhosework
SHARED TOKENS (15): "current", "data", "department", "federal", "government", "landscape", "major", "makes", "maps", "public", "regulatory", "research", "space", "whose", "work".
0.300
administersadministrationbuildingcarryingconditionscoverdepartmentdepartmentsdirectlyeconomicemploymentfederalgoverninggovernmenthealthhistorylaboroccupationalregulationsreports
SHARED TOKENS (24): "administers", "administration", "building", "carrying", "conditions", "cover", "department", "departments", "directly", "economic", "employment", "federal", "governing", "government", "health", "history", "labor", "occupational", "regulations", "reports"....
0.300
accessaddressalonealteramongavailabilitybasinbecomebroadchangesconditionscontrolcorporatedescribingeconomicgovernmenthistoryincreasesinsteadinstitutions
SHARED TOKENS (40): "access", "address", "alone", "alter", "among", "availability", "basin", "become", "broad", "changes", "conditions", "control", "corporate", "describing", "economic", "government", "history", "increases", "instead", "institutions"....
0.300
acquiringactassumebuildingcommercialconstructioncontractorscreatesdesigndeterminedifferenteconomicenvironmentalestateexistinggrowthjobslandmanagemarketing
SHARED TOKENS (38): "acquiring", "act", "assume", "building", "commercial", "construction", "contractors", "creates", "design", "determine", "different", "economic", "environmental", "estate", "existing", "growth", "jobs", "land", "manage", "marketing"....
0.300
adaboisebuildingcapitalcareerconstructiondepartmentdesignfederalfirmformationgovernmenthomeidahomaterialsnationalplacesregisterservedstar
SHARED TOKENS (22): "ada", "boise", "building", "capital", "career", "construction", "department", "design", "federal", "firm", "formation", "government", "home", "idaho", "materials", "national", "places", "register", "served", "star"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businessconnectedcurrentestablishedformidahoimprovementsincreasinglymakingmodernownersseparateterritoryvalleywestern
SHARED TOKENS (15): "business", "connected", "current", "established", "form", "idaho", "improvements", "increasingly", "making", "modern", "owners", "separate", "territory", "valley", "western".
🫐 BERRY49 edges
0.280
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturecreateddeepdescribeformhealthmanagementmethodsregionresourcesouthernsystemsthroughoutwater
SHARED TOKENS (14): "agriculture", "created", "deep", "describe", "form", "health", "management", "methods", "region", "resource", "southern", "systems", "throughout", "water".
0.280
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingcodescommonlyconstructiondepartmentdivisionfireimpactincreasesmeasuresoccurspracticessafetyschools
SHARED TOKENS (14): "building", "codes", "commonly", "construction", "department", "division", "fire", "impact", "increases", "measures", "occurs", "practices", "safety", "schools".
0.280
damagehomeofficewater
SHARED TOKENS (4): "damage", "home", "office", "water". | EXACT TITLE in cleaning_services: "Stanley Steemer".
0.280
Septic tank ↗ Q386300 KW CROSS HIGH
commonlyconnecteddomesticenvironmentfacilityprocessesratesystemsystemsthereforetreatedtreatmentwastewastewater
SHARED TOKENS (14): "commonly", "connected", "domestic", "environment", "facility", "processes", "rate", "system", "systems", "therefore", "treated", "treatment", "waste", "wastewater".
0.280
comonlinerentalshort-term
SHARED TOKENS (4): "com", "online", "rental", "short-term". | EXACT TITLE in cleaning_services: "Short-term rental".
0.280
Aquifer test ↗ Q446124 KW CROSS HIGH
applyaroundboundariescharacteristicsdataengineeringinsteadmodelmonitoringpropertiesrealresponsesystemwater
SHARED TOKENS (14): "apply", "around", "boundaries", "characteristics", "data", "engineering", "instead", "model", "monitoring", "properties", "real", "response", "system", "water".
0.280
applicationsdomesticindustrialuses
SHARED TOKENS (4): "applications", "domestic", "industrial", "uses". | EXACT TITLE in cleaning_services: "Steam cleaning".
0.280
capacityfeestoragewater
SHARED TOKENS (4): "capacity", "fee", "storage", "water". | EXACT TITLE in water_rights: "Water banking".
0.280
contactdirectenergyequipmentidentifyingisolatedlawmaintenancepowerrepairrequiressafetysourceswork
SHARED TOKENS (14): "contact", "direct", "energy", "equipment", "identifying", "isolated", "law", "maintenance", "power", "repair", "requires", "safety", "sources", "work".
0.260
methodsprocesswater
SHARED TOKENS (3): "methods", "process", "water". | EXACT TITLE in cleaning_services: "Carpet cleaning".
0.260
associationidahointegrated
SHARED TOKENS (3): "association", "idaho", "integrated". | EXACT TITLE in water_rights: "Idaho State Bar".
0.260
contaminationdemanddistributionfiremainpressureprotectsourcesstoragesuppliessystemsystemswater
SHARED TOKENS (13): "contamination", "demand", "distribution", "fire", "main", "pressure", "protect", "sources", "storage", "supplies", "system", "systems", "water".
0.260
catalogcodecommonlydisposalfooditemsmunicipalmunicipalitiespublicseparatelysolidsourceswaste
SHARED TOKENS (13): "catalog", "code", "commonly", "disposal", "food", "items", "municipal", "municipalities", "public", "separately", "solid", "sources", "waste".
0.240
actappliesclaimcreatesemploymentexemptionlaborlawproductionprohibitsstandardswork
SHARED TOKENS (12): "act", "applies", "claim", "creates", "employment", "exemption", "labor", "law", "production", "prohibits", "standards", "work".
0.220
adaboisedecadegovernmentidahomainmetropolitanmunicipalpopulationseparatestreet
SHARED TOKENS (11): "ada", "boise", "decade", "government", "idaho", "main", "metropolitan", "municipal", "population", "separate", "street".
0.220
Alfalfa ↗ Q156106 EXACT TITLE
aroundcommonly
SHARED TOKENS (2): "around", "commonly". | EXACT TITLE in water_rights: "Alfalfa".
0.220
controldistinctgoverninglawownershippropertyqualityregulationsrelatedresourcewater
SHARED TOKENS (11): "control", "distinct", "governing", "law", "ownership", "property", "quality", "regulations", "related", "resource", "water".
0.200
subdivision
EXACT TITLE in water_rights: "Subdivision".
0.200
Abandon ↗ Q397584 EXACT TITLE
abandonabandonedabandonment
EXACT TITLE in water_rights: "Abandon".
0.200
Payette River ↗ Q3373254 KW CROSS HIGH
basincumulativedivisiondrainageidahomajornationalrecreationsectionvalley
SHARED TOKENS (10): "basin", "cumulative", "division", "drainage", "idaho", "major", "national", "recreation", "section", "valley".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
forfeiture
EXACT TITLE in water_rights: "Forfeit".
0.200
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturedifferenteconomyfoodidaholandproducesproductionrepresentssale
SHARED TOKENS (10): "agriculture", "different", "economy", "food", "idaho", "land", "produces", "production", "represents", "sale".
0.200
amongclassifiedcontactequipmenthealthmaterialsoccupationalpressureriskseparately
SHARED TOKENS (10): "among", "classified", "contact", "equipment", "health", "materials", "occupational", "pressure", "risk", "separately".
0.200
Waste collection ↗ KW CROSS HIGH
disposalfacilitymanagementmaterialsmunicipalprocessprogramsolidtreatmentwaste
SHARED TOKENS (10): "disposal", "facility", "management", "materials", "municipal", "process", "program", "solid", "treatment", "waste".
0.180
allowingdirectlynetworkplacesurfacesystemsystemstypeswater
SHARED TOKENS (9): "allowing", "directly", "network", "place", "surface", "system", "systems", "types", "water".
0.180
fullindustriallegalmerelyownershipperiodsystemuserswater
SHARED TOKENS (9): "full", "industrial", "legal", "merely", "ownership", "period", "system", "users", "water".
0.180
accesscommercialequipmentincreasinglylicensingprocessesregulationsstructuralwork
SHARED TOKENS (9): "access", "commercial", "equipment", "increasingly", "licensing", "processes", "regulations", "structural", "work".
0.160
distributionformmanagementpracticessurfacethereforethroughoutwater
SHARED TOKENS (8): "distribution", "form", "management", "practices", "surface", "therefore", "throughout", "water".
0.160
amongdetermineslandlawownershippropertysystemwater
SHARED TOKENS (8): "among", "determines", "land", "law", "ownership", "property", "system", "water".
0.160
aroundbasinbureauexpandedmajornorthwestsouthernwestern
SHARED TOKENS (8): "around", "basin", "bureau", "expanded", "major", "northwest", "southern", "western".
0.160
actdisposalfederalgoverninglawresourcesolidwaste
SHARED TOKENS (8): "act", "disposal", "federal", "governing", "law", "resource", "solid", "waste".
0.160
basindemanddescribeenvironmentalphysicalsuppliessurfacewater
SHARED TOKENS (8): "basin", "demand", "describe", "environmental", "physical", "supplies", "surface", "water".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "western".
0.160
electricalenergyengineeringfacilitylandscapemanagementprovidertransportation
SHARED TOKENS (8): "electrical", "energy", "engineering", "facility", "landscape", "management", "provider", "transportation".
0.160
actamendedcodefederallawpowerregulationwater
SHARED TOKENS (8): "act", "amended", "code", "federal", "law", "power", "regulation", "water".
0.160
Water table ↗ Q3342272 KW CROSS HIGH
actualdefinedependentlevelmaterialspressuresurfacewater
SHARED TOKENS (8): "actual", "define", "dependent", "level", "materials", "pressure", "surface", "water".
0.160
aroundcreatingequipmentlandlargesectionsystemswater
SHARED TOKENS (8): "around", "creating", "equipment", "land", "large", "section", "systems", "water".
0.140
affectdevelopedgenerallyhealthmaterialsprecautionsrisk
SHARED TOKENS (7): "affect", "developed", "generally", "health", "materials", "precautions", "risk".
0.140
establishedfoodidahomakingpopulationregionsouthern
SHARED TOKENS (7): "established", "food", "idaho", "making", "population", "region", "southern".
0.120
coversidaholandmajornorthwestsouthern
SHARED TOKENS (6): "covers", "idaho", "land", "major", "northwest", "southern".
0.120
examinationhistoryidahonorthwestsouthernwestern
SHARED TOKENS (6): "examination", "history", "idaho", "northwest", "southern", "western".
0.120
Kitchen hood ↗ Q1164342 KW CROSS HIGH
combinationcommercialfirehomeoutsidesystem
SHARED TOKENS (6): "combination", "commercial", "fire", "home", "outside", "system".
0.120
broadcategoryestatefoodplanningreal
SHARED TOKENS (6): "broad", "category", "estate", "food", "planning", "real".
0.120
Clothes dryer ↗ Q496334 KW CROSS HIGH
becomeitemslossmaintainneedspace
SHARED TOKENS (6): "become", "items", "loss", "maintain", "need", "space".
0.120
Mildew ↗ Q1220207 KW CROSS HIGH
distinctformgenerallygrowthrelatedsurfaces
SHARED TOKENS (6): "distinct", "form", "generally", "growth", "related", "surfaces".
0.100
boisehealthidahoregionalsystem
SHARED TOKENS (5): "boise", "health", "idaho", "regional", "system".
0.100
Lateral canal ↗ Q6495566 KW CROSS HIGH
anotherbuiltconstructingexistingwater
SHARED TOKENS (5): "another", "built", "constructing", "existing", "water".
0.100
actinsteadlandsitewaste
SHARED TOKENS (5): "act", "instead", "land", "site", "waste".
0.100
departmentfederalgovernmentmanagementprotect
SHARED TOKENS (5): "department", "federal", "government", "management", "protect".
◈ Frequently Asked Questions
Water Rights × Cleaning Services — Treasure Valley
HAIKU · HIGH GATE
Do commercial cleaning services in Boise need water rights permits to operate?
Commercial cleaning operations in Ada County that draw water from the Boise River or groundwater sources must comply with Idaho's water rights allocation system managed under state law. The Ada County zoning and sanitary sewer departments coordinate with water rights holders to ensure cleaning service providers have lawful access to water supplies for their operations.
How do stormwater regulations affect cleaning service runoff in the Treasure Valley?
Cleaning services operating in Boise, Nampa, and Kuna must manage stormwater discharge under local stormwater permits that prevent contaminated water from entering the Boise River and groundwater aquifers. The United States Environmental Protection Agency enforces Clean Water Act standards that apply to industrial and commercial cleaning operations across Ada County.
Can food processing facilities use the same water sources as commercial cleaning services in the Treasure Valley?
Food processing operations and commercial cleaning services in Idaho's Treasure Valley compete for water allocations under the same state water rights system, though food processing has distinct treatment and sanitary sewer requirements. The Idaho Legislature has established different regulatory pathways for these uses, meaning a single water source may serve food processing while cleaning services access separate groundwater or municipal supplies in Boise and Ada County.
What happens when cleaning services cause groundwater pollution in Nampa?
Groundwater pollution from cleaning services in Nampa or surrounding areas triggers enforcement actions under the Clean Water Act and Idaho's groundwater protection statutes, with oversight from both local Ada County authorities and the United States Environmental Protection Agency. Cleaning service operators face liability for contamination that affects existing water rights holders who depend on aquifers for residential or agricultural use.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Water Rights × Cleaning Services 22 QID bridges 271 edges 7,199 ext links 2026-07-17 23:55:25 UTC 373fdc419e46fe97
Water Rights corridor ↗ Cleaning Services corridor ↗ Cleaning Services × Water Rights ↗ boisestandard.org/standard ↗
Parent Corridors
Water Rights × All Other Verticals