—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nonprofits Community ↔ relates to ↔ Substance Use Recovery

22 Wikipedia bridge articles confirmed in both vertical ledgers. 278 deterministic cross-vertical edges. 7,426 external source links harvested. Every edge provenance-stamped. Every claim auditable.

22 QID Bridge Articles
278 Cross Edges
7,426 External Sources
308 Wikipedia Articles
22 🌲 Evergreen
212 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nonprofits Community
× Substance Use Recovery
QID Bridge Articles
22
confirmed Wikipedia overlap
Total Cross Edges
278
External Sources Harvested
7,426
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  25 shared tokens
QID Bridge Titles (20)
Boise State UniversityFamily therapyIdahoCase managementSupportive housingTreasure ValleyDomestic violenceSocial workContinuing educationAffordable housingNonprofit organizationNampa, IdahoTransitional housingSouthwestern IdahoChild protectionHousing FirstCivil Rights Act of 1968Boise, IdahoAda County, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
boiseidahopeoplepopulationmetropolitanhealthfamilycommunityhomeeducationchildrendevelopmentdifferentfamiliessupportindividualshousinglocalgovernmentsocial
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:29:05 UTC
Content Hash
cb16f23a7ee31557
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
22 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "arts", "boise", "business", "college", "colleges", "compete", "division", "education", "fiscal", "graduate", "health", "idaho", "independent", "institution", "master", "member", "program", "programs".... | URL->A (1): https://boisestate.edu/. | EXACT TITLE in nonprofits_community: "Boise State University". | EXACT TITLE in substance_use_recovery: "Boise State University".
activityamongartsboisebusinesscollegecollegescompetedivisioneducationfiscalgraduatehealthidahoindependentinstitutionmastermemberprogramprogramspublicresearchschoolteamsuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
F
Q870449 EXACT TITLE 1.000
QID OVERLAP: Q870449 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (34): "benefits", "children", "clients", "clinicians", "counseling", "defined", "development", "different", "direct", "early", "families", "family", "human", "individual", "influence", "involving", "long-term", "marriage", "members", "parents".... | EXACT TITLE in nonprofits_community: "Family therapy".
benefitschildrenclientsclinicianscounselingdefineddevelopmentdifferentdirectearlyfamiliesfamilyhumanindividualinfluenceinvolvinglong-termmarriagemembersparentsparticipationpeopleproblempsychologyrelatedrelationshipsschoolsstudysupportsupportive+4
erapy have in common a belief that, regardless of the origin of the problem, and regardless of whether the clients consider it an "individual" or "family" issue, involving families in solutions often benefits clients. This involvement of families is commonly accomplished by their direct participation in the therapy session. The skills of the family therapist thus include the ability to influence conversations in a way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
History and theoretical frameworks Formal interventions with families to help individuals and families experiencing various kinds of problems have been a part of many cultures, probably throughout history. These interventions have sometimes involved formal procedures or rituals, and often included the extended family as well as non-kin members of the community (see, for example, Ho'oponopono). Following the emergence of specialization in various societies, these interventions were often conducted by particular members of a community—for example, a tribal chief, priest, physician, and so on—usually as an ancillary function. Family therapy as a distinct professional practice within Western cultures can be argued to have had its origins in the social work movements of the 19th century in the United Kingdom and the United States. As a branch of psychotherapy, its roots can be traced somewhat later to the early 20th century with the emergence of the child guidance movement and marriage counseling. The formal development of family therapy dates from the 1940s and early 1950s with the founding in 1942 of the American Association of Marriage Counselors (the precursor of the AAMFT), and through the work of various independent clinicians and groups—in the United Kingdom (John Bowlby at the Tavistock Clinic), the United States (Donald deAvila Jackson, John Elderkin Bell, Nathan Ackerman, Christian Midelfort, Theodore Lidz, Lyman Wynne, Murray Bowen, Carl Whitaker, Virginia Satir, Ivan Boszormenyi-Nagy), and in Hungary, D.L.P. Liebermann—who began seeing family members together for observation or therapy sessions. There was initially a strong influence from psychoanalysis (most of the early founders of the field had psychoanalytic backgrounds) and social psychiatry, and later from behaviorism and behavior therapy—and significantly, these clinicians began to articulate various theories about the nature and functioning of the family as an entity that was more than a mere aggregation of individuals. The movement received an important boost starting in the early 1950s through the work of anthropologist Gregory Bateson and colleagues—Jay Haley, Donald deAvila Jackson, John Weakland, William Fry, and later, Virginia Satir, Ivan Boszormenyi-Nagy, Paul Watzlawick and others—at Palo Alto in the United States, who introduced ideas from cybernetics and general systems theory into social psychology and psychotherapy, focusing in particular on the role of communication. This approach eschewed the traditional focus on individual psychology and historical factors—that involve so-called linear causation and content—and emphasized instead feedback and homeostatic mechanisms and "rules" in here-and-now interactions—so-called circular causation and process—that were thought to maintain or exacerbate problems, whatever the original cause(s). This group was also influenced significantly by the work of US psychiatrist, hypnotherapist, and brief therapist Milton H. Erickson—especially his innovative use of strategies for change, such as paradoxical directives. The members of the Bateson Project (like the founders of a number of other schools of family therapy, including Carl Whitaker, Murray Bowen, and Ivan Boszormenyi-Nagy) had a particular interest in the possible psychosocial causes and treatment of schizophrenia, especially in terms of the putative "meaning" and "function" of signs and symptoms within the family system. The research of psychiatrists and psychoanalysts Lyman Wynne and Theodore Lidz on communication deviance and roles (e.g., pseudo-mutuality, pseudo-hostility, schism, and skew) in families of people with schizophrenia also became influential with systems-communications-oriented theorists and therapists. A related theme—applying to dysfunction and psychopathology more generally—was that of the "identified patient" or "presenting problem" as a manifestation of or surrogate for the family's (or even society's) problems. By the mid-1960s, a number of distinct schools of family therapy had emerged. From the groups that were most strongly influenced by cybernetics and systems theory there came Mental Research Institute brief therapy, strategic therapy, Salvador Minuchin's structural family therapy and the model proposed by Mara Selvini Palazzoli (i.e., the Milan systems model). Partly in reaction to some aspects of these systemic models came the experiential approaches of Virginia Satir and Carl Whitaker, which downplayed theoretical constructs and emphasized subjective experience and unexpressed feelings (including the subconscious), authentic communication, spontaneity, creativity, total therapist engagement, and often included the extended family. Concurrently, intergenerational therapies by Murray Bowen, Ivan Boszormenyi-Nagy, James Framo, and Norman Paul emerged. They proposed different theories on the intergenerational transmission of health and dysfunction, usually involving three generations in therapy or through "homework" and "journeys home." Psychodynamic family therapy—which, more than any other school of family therapy, deals directly with individual psychology and the unconscious mind in the context of current relationships—continued to develop through a number of groups that were influenced by the ideas and methods of Nathan Ackerman, the British school of object relations theory, and John Bowlby's work on attachment theory. Multiple-family group therapy, a precursor of psychoeducational family intervention, emerged, in part, as a pragmatic alternative form of intervention—especially as an adjunct to the treatment of serious mental illnesses with significant biological underpinnings, such as schizophrenia—and represented something of a conceptual challenge to some of the systemic (and thus potentially "family-blaming") paradigms of pathogenesis that were implicit in many of the dominant models of family therapy. The late 1960s and early 1970s saw the development of network therapy (which bears some resemblance to traditional practices such as Ho'oponopono) by Ross Speck and Carolyn Attneave, and the emergence of behavioral marital therapy (renamed behavioral couples therapy in the 1990s) and behavioral family therapy as models in their own right. By the late 1970s, the weight of clinical experience—especially in the treatment of serious mental disorders—had led to revisions of several of the original models and a moderation of earlier stridency and theoretical purism. There were the beginnings of a general softening of the strict demarcations between schools, with moves toward rapprochement, integration, and eclecticism—although there was, nevertheless, some hardening of positions within some schools. These trends were reflected in and influenced by lively debates within the field and critiques from various sources, including feminism and post-modernism, that reflected in part the cultural and political tenor of the times, and which foreshadowed the emergence (in the 1980s and 1990s) of the various post-systems constructivist and social constructionist approaches. While there was still debate within the field about whether, or to what degree, the systemic-constructivist and medical-biological paradigms were necessarily antithetical to each other (see also anti-psychiatry; biopsychosocial model), there was a growing willingness and tendency on the part of family therapists to work in multi-modal clinical partnerships with other members of the helping and medical professions. From the mid-1980s to the present, the field has been marked by a diversity of approaches that partly reflect the original schools, but which also draw on other theories and methods from individual psychotherapy and elsewhere—these approaches and sources include: brief therapy, structural therapy, constructivist approaches (e.g., Milan systems, post-Milan/collaborative/conversational, and reflective), bringforthist approach (e.g., Karl Tomm's IPscope model and Interventive interviewing), solution focused brief therapy, narrative therapy, a range of cognitive behavioral therapy approaches, psychodynamic and object relations approaches, attachment and emotionally focused therapy, intergenerational approaches, network therapy, and multisystemic therapy (MST). Multicultural, intercultural, and integrative approaches are being developed, with Vincenzo Di Nicola weaving a synthesis of family therapy and transcultural psychiatry in his model of cultural family therapy, A Stranger in The Family: Culture, Families, and Therapy. Many practitioners claim to be eclectic, using techniques from several areas, depending upon their own inclinations and/or the needs of the client(s), and there is a growing movement toward a single "generic" family therapy that seeks to incorporate the best of the accumulated knowledge in the field and which can be adapted to many different contexts. Nonetheless, there are still a significant number of therapists who adhere more or less strictly to a particular, or limited number of, approach(es). The liberation-based healing framework for family therapy offers a complete paradigm shift for working with families while addressing the intersections of race, class, gender identity, sexual orientation, and other socio-political identity markers. This theoretical approach and praxis is informed by critical pedagogy, feminism, critical race theory, and decolonizing theory. It necessitates an understanding of the ways colonization, cisheteronormativity, patriarchy, white supremacy and other systems of domination impact individuals, families and communities and centers the need to disrupt the status quo in how power operates. Traditional Western models of family therapy have historically ignored these dimensions, and when white, male privilege has been critiqued, largely by feminist theory practitioners, it has often been to the benefit of middle-class, white women's experiences. While an understanding of intersectionality is of particular significance in working with families with violence, a liberatory framework examines how power, privilege and oppression operate within and across all relationships. Liberatory practices are based on the principles of critical consciousness, accountability, and empowerment. These principles guide not only the content of therapeutic work with clients but also the supervisory and training processes for therapists.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "approximately", "around", "boise", "capital", "contains", "distinct", "early", "gem", "idaho", "largest", "national", "official", "organized", "people", "population", "restricted", "sector", "separate", "significant", "small".... | EXACT TITLE in nonprofits_community: "Idaho". | EXACT TITLE in substance_use_recovery: "Idaho".
approximatelyaroundboisecapitalcontainsdistinctearlygemidaholargestnationalofficialorganizedpeoplepopulationrestrictedsectorseparatesignificantsmallsuppliestechnologyuseswashingtonwestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
C
Q5048341 EXACT TITLE 1.000
QID OVERLAP: Q5048341 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (16): "appropriate", "care", "case", "community", "coordination", "general", "health", "individuals", "law", "legal", "management", "medical", "plans", "specific", "system", "treatment". | EXACT TITLE in nonprofits_community: "Case management". | EXACT TITLE in substance_use_recovery: "Case management".
appropriatecarecasecommunitycoordinationgeneralhealthindividualslawlegalmanagementmedicalplansspecificsystemtreatment
Case management (mental health), a specific approach for the coordination of community mental health services Case management (US health system), a specific term used in the health care system of the United States of America Medical case management, a general term referring to the facilitation of treatment plans to assure the appropriate medical care is provided to disabled, ill or injured individuals Legal case management, a set of management approaches for law firms or courts
S
Q7644625 EXACT TITLE 1.000
QID OVERLAP: Q7644625 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (15): "active", "community", "departments", "different", "families", "funding", "health", "homelessness", "housing", "individuals", "people", "professional", "stable", "supportive", "work". | EXACT TITLE in nonprofits_community: "Supportive housing". | EXACT TITLE in substance_use_recovery: "Supportive housing".
activecommunitydepartmentsdifferentfamiliesfundinghealthhomelessnesshousingindividualspeopleprofessionalstablesupportivework
Supportive housing is a combination of housing and services intended as a cost-effective way to help people live more stable, productive lives, and is an active "community services and funding" stream across the United States. It was developed by different professional academics and US governmental departments that supported housing.
Benefits of supportive housing for specific populations groups Supportive housing proposes to be a comprehensive solution to a problem rather than a band-aid fix (such as a shelter). While many of those who stay in the shelter system remain in or return to the system for extended periods of time, a much higher percentage of those who are placed in supportive housing remain housed on a more permanent basis. This idea is also referred to as the Housing First model, an approach to combating chronic homelessness by providing homes upfront and offering help for illnesses and addictions. The concept turns the traditional model, which typically requires sobriety (or prerequisites that can be used for enhanced services before a person can get housing), upside down. Research has shown that coupling permanent housing with supportive services is highly effective at maintaining housing stability, as well as helps improve health outcomes and decreases the use of publicly funded institutions. A review of the impact of these services found that they can improve health outcomes among chronically homeless individuals, including positive changes in self-reported mental health status, substance use, and overall well-being. In the Collaborative Initiative to Help End Chronic Homelessness (CICH), participants who had been homeless for an average of eight years were immediately placed into permanent housing. The CICH evaluation reported that 95% of those individuals were in independent housing after 12 months. A study of homeless people in New York City with serious mental illness found that providing supportive housing to the individuals directly resulted in a 60% decrease in emergency shelter use for clients, as well as decreases in the use of public medical and mental health services and city jails and state prisons. Another study in Seattle in 2009 found that moving "people with chronic alcoholism" into supportive housing resulted in a 33% decline in alcohol use for clients. There is significant support for the contention that supportive housing also costs less than other systems where its tenant base may reside, such as jails, hospitals, mental health facilities, and even shelters. Research on the overall costs to the taxpayer of supportive housing has consistently found the costs to the taxpayer to be about the same or lower than the alternative of a chronically homeless person sleeping in a shelter. The CICH evaluation showed that average costs for healthcare and treatment were reduced by about half, which the largest decline associated with inpatient hospital care. The use of supportive housing has been shown to be cost-effective, resulting in reductions in the use of shelter, ambulance, police/jail, health care, emergency room, behavior health, and other service costs. For example, one 2016 report identified studies documenting that these services can reduce health care costs, emergency department visits, and length of stays in psychiatric hospitals. The Denver Housing First Collaborative documented that the annual cost of supportive housing for a chronically homeless individual was $13,400. However, the per-person reduction in public services recorded by the Denver Housing First Collaborative came to $15,773 per person per year, more than compensating for the annual supportive housing costs. When paired with low-income housing (or mixed-income housing), government subsidies (such as section 8 or Housing choice vouchers) and other revenue generating operations, supportive housing residences are claimed by their supporters to be capable of supporting themselves and even turning a profit (which can be used for enhanced services and amenities for the residents by a non-profit organization). According to a 2007 study done by the National Alliance to End Homelessness, supportive housing helps tenants increase their incomes, work more, get arrested less, make more progress toward recovery, and become more active, valued and productive members of their communities. Impact on neighborhoods Supportive housing can help people facing health challenges to continue to live in the community. However, proposals for new housing projects often faced local opposition, largely based on fears regarding adverse effects on property values and crime rates, local businesses, and the quality of life in the surrounding neighborhood.
Further reading AcademyHealth. (2016, July). Rapid Evidence Review: What Housing-related Services and Supports Improve Health Outcomes among Chronically Homeless Individuals?. Bassuk, Ellen L.; Geller, Stephanie, The Role of Housing and Services in Ending Family Homelessness (2006). Housing Policy Debate 17(4): 781–806. Braisby, D., Echlin, R., Hill, S. & Smith, H. (1984). Changing Futures: Housing and Support Services for People Discharged from Psychiatric Hospitals. London: King's Fund Project Paper. Carling, P.J., Randolph, F.L., Blanch, A.K. & Ridgeway, P. (1988). A review of the research on housing and community integration for people with psychiatric disabilities. National Rehabilitation Information Center Quarterly, 1(3), 1–18. OCLC 33023067 Carling, P.J. (1993, May). Housing and supports for persons with mental illness: Emerging approaches to research and practice. Hospital and Community Psychiatry, 44(5): 439–449. PMID: 8509074; DOI: 10.1176/ps.44.5.439 Cuomo, A.M. (2014). HELP. All Things Possible: Setbacks and Successes in Politics and Life (pp. 80–136). NY, NY: Harper Collins Publishers. ISBN 0-062-30010-5, 9780062300102; OCLC 1199128524 Dilys Page. (1995, April). Whose services? Whose needs? Community Development Journal, 30(2), 217–235. DOI: 10.1093/cdj/30.2.217 Fitton, P. & Wilson, J. (1995). "A home of their own: Achieving supported housing". In: T. Philpot & L. Ward (Eds.), Changing Ideas and Services for People with Learning Disabilities. (pp. 43–54). Oxford: Butterworth-Heinemann, Ltd. ISBN 0-750-62248-2, 9780750622486; OCLC 1302619886 Friedman, Donna Haig, et al., Preventing Homelessness and Promoting Housing Stability: A Comparative Analysis Archived 2023-01-17 at the Wayback Machine, The Boston Foundation, June 2007. Knisley, M. B. & Fleming, M. (1993, May). Implementing supported housing in state and local mental health systems. Hospital and Community Psychiatry, 44(5),456–460. PMID: 8509076 l DOI: 10.1176/ps.44.5.456 Lakin, K. C. & Racino, J.A. (1990). Formation of the Rehabilitation Research and Training Centers on Families and Community Living in US Education. Washington, DC: University of Minnesota and Syracuse University in conjunction with the RRTCS of the USA. Livingston, J. & Srebnik, D. (1991, November). States' strategies for promoting supported housing for persons with psychiatric disabilities. Hospital and Community Psychiatry, 42(11), 1116–1119. PMID: 1743638; DOI: 10.1176/ps.42.11.1116 McCarroll, Christina, "Pathways to housing the homeless", The Christian Science Monitor, May 1, 2002 O’Flaherty, Brendan, Making room : the economics of homelessness, Cambridge, Mass. : Harvard University Press, 1996. ISBN 0-674-54342-4, 0-674-54343-2; OCLC 751331264 Quigley, John M.; Raphael, Steven, The Economics of Homelessness: The Evidence from North America Archived 2022-01-20 at the Wayback Machine, European Journal of Housing Policy 1(3), 2001, 323–336. O'Hara, A. & Day, S. (2001, December). Olmstead and Supportive Housing: A Vision for the Future. Washington, DC: Center for Health Care Strategies and the Technical Assistance Collaborative. OCLC 50119357 Pynoos, J., Hollander-Feldman, P., & Ahrens, J. (2004). Linking Housing and Services for Older Adults: Obstacles, Options, and Opportunities. NY, NY: The Haworth Press. ISBN 0-203-05119-X; OCLC 1082212507 Racino, J. A. (1989, August). Selected Issues in Housing. Prepared for US conference distribution, Rehabilitation Research and Training Center on Community Integration, Syracuse University, Center on Human Policy. Racino, J. (1999). "State policy in housing and support: Evaluation and policy analysis of state systems". In: Policy, Program Evaluation and Research in Disability: Community Support for All. (pp. 263–287). London: Haworth Press. ISBN 0-789-00598-0, 9780789005984; OCLC 301621888 Racino, J. (2014). "Housing and disability: Toward inclusive, equitable, and sustainable housing and communities". Public Administration and Disability: Community Services Administration in the US. NY, NY: CRC Press, Francis and Taylor. ISBN 1-466-57981-1, 9781466579811; OCLC 865641827 Ridgeway, P. & Zipple, A.M.(1990, April). "The paradigm shift in residential services: From the linear continuum to supported housing approaches." Special Issue: Supported Housing: New approaches to residential services. Psychosocial Rehabilitation. Boston, MA: Center for Psychiatric Rehabilitation, Sargent College of Allied Health Professions, Boston University. DOI: 10.1037/h0099479 Rogers, E.S., Farkas, M., Anthony, W., Kash, M., Harding, C., & Olschewski, A. (2009). Systematic Review of Supported Housing Literature 1993–2008. Boston, MA: Boston University Center for Psychiatric Rehabilitation. Roncarati, Jill, Homeless, housed, and homeless again, Journal of the American Academy of Physician's Assistants (authorized for involuntary care by psychiatrists; active legal cases), June 2008. PMID: 18619107; DOI: 10.1097/01720610-200806000-00090 Sheehan, N. & Oakes, C. (2004). "Public policy initiatives addressing supportive housing: The experience of Connecticut". In: Pynoos, J., Holander-Feldman, P. & Ahrens, J. (Eds.), Linking Housing and Services for Older Adults: Obstacles, Options, and Opportunities. pp. 81–113). New York: Haworth Press. ISBN 0-203-05119-X; OCLC 1082212507 Surles, R.C. (1989). Supported Housing Implementation: A Report to the New York State Legislature. Albany, NY: New York State Office of Mental Health. Taylor, S.J. (1987). A Policy Analysis of the Supported Housing Demonstration Project: Pittsburgh, PA. Syracuse, NY: Syracuse University, Center on Human Policy, Community Integration Project. OCLC 27721422 US Housing and Urban Development. (2010, July). Homeless Costs and Interventions: A Portrait of Homelessness in 2009; Low Income Housing Tax Credits' Boost Affordable Rental Housing Supplies; Snapshot of Worst Case Housing Needs in the US.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (16): "association", "boise", "historically", "idaho", "local", "lower", "metropolitan", "opportunities", "owyhee", "payette", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in nonprofits_community: "Treasure Valley". | EXACT TITLE in substance_use_recovery: "Treasure Valley".
associationboisehistoricallyidaholocallowermetropolitanopportunitiesowyheepayetteregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Domestic violence
Q156537 EXACT TITLE 1.000
QID OVERLAP: Q156537 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (49): "abuse", "acceptance", "act", "against", "age", "among", "broader", "cases", "child", "children", "context", "control", "create", "direct", "documentation", "domestic", "early", "established", "experience", "family".... | EXACT TITLE in nonprofits_community: "Domestic violence". | EXACT TITLE in substance_use_recovery: "Domestic violence".
abuseacceptanceactagainstageamongbroadercaseschildchildrencontextcontrolcreatedirectdocumentationdomesticearlyestablishedexperiencefamilyfinancesfinancialformshealthhomehouseholdlegallylifelimitedmarriage+19
Domestic violence (DV) is violence that occurs in a domestic setting, such as in a marriage or cohabitation. In a broader sense, abuse including non-physical abuse in such settings is called domestic abuse. The term domestic violence is often used as a synonym for intimate partner violence, which is committed by one of the people in an intimate relationship against the other, and can take place in relationships or between former spouses or partners. In a broader sense, the term can also refer to violence against one's family members, such as children, siblings or parents. Forms of domestic abuse include physical, verbal, emotional, financial, religious, reproductive and sexual. It can range from subtle, coercive forms to marital rape and other violent physical abuse, such as choking, beating, female genital mutilation, and acid throwing that may result in disfigurement or death, and includes the use of technology to harass, control, monitor, stalk or hack. Domestic murder includes stoning, bride burning, honor killing, and dowry death, which sometimes involves non-cohabitating family members. In 2015, the United Kingdom's Home Office widened the definition of domestic violence to include coercive control. Worldwide, the victims of domestic violence are overwhelmingly women, and women tend to experience more severe forms of violence. The World Health Organization (WHO) estimates one in three of all women are subject to domestic violence at some point in their life. In some countries, domestic violence may be seen as justified or legally permitted, particularly in cases of actual or suspected infidelity on the part of the woman. Research has established that there exists a direct and significant correlation between a country's level of gender inequality and rates of domestic violence, where countries with less gender equality experience higher rates of domestic violence. Domestic violence is among the most underreported crimes worldwide for both men and women. Domestic violence often occurs when the abuser believes that they are entitled to it, or that it is acceptable, justified, or unlikely to be reported. It may produce an intergenerational cycle of violence in children and other family members, who may feel that such violence is acceptable or condoned. Many people do not recognize themselves as abusers or victims, because they may consider their experiences as family conflicts that had gotten out of control. Awareness, perception, definition and documentation of domestic violence differs widely from country to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
in relationships or between former spouses or partners. In a broader sense, the term can also refer to violence against one's family members, such as children, siblings or parents. Forms of domestic abuse include physical, verbal, emotional, financial, religious, reproductive and sexual. It can range from subtle, coercive forms to marital rape and other violent physical abuse, such as choking, beating, female genital mutilation, and acid throwing that may result in disfigurement or death, and includes the use of technology to harass, control, monitor, stalk or hack. Domestic murder includes stoning, bride burning, honor killing, and dowry death, which sometimes involves non-cohabitating family members. In 2015, the United Kingdom's Home Office widened the definition of domestic violence to include coercive control. Worldwide, the victims of domestic violence are overwhelmingly women, and women tend to experience more severe forms of violence. The World Health Organization (WHO) estimates one in three of all women are subject to domestic violence at some point in their life. In some countries, domestic violence may be seen as justified or legally permitted, particularly in cases of actual or suspected infidelity on the part of the woman. Research has established that there exists a direct and significant correlation between a country's level of gender inequality and rates of domestic violence, where countries with less gender equality experience higher rates of domestic violence. Domestic violence is among the most underreported crimes worldwide for both men and women. Domestic violence often occurs when the abuser believes that they are entitled to it, or that it is acceptable, justified, or unlikely to be reported. It may produce an intergenerational cycle of violence in children and other family members, who may feel that such violence is acceptable or condoned. Many people do not recognize themselves as abusers or victims, because they may consider their experiences as family conflicts that had gotten out of control. Awareness, perception, definition and documentation of domestic violence differs widely from country to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
arents. Forms of domestic abuse include physical, verbal, emotional, financial, religious, reproductive and sexual. It can range from subtle, coercive forms to marital rape and other violent physical abuse, such as choking, beating, female genital mutilation, and acid throwing that may result in disfigurement or death, and includes the use of technology to harass, control, monitor, stalk or hack. Domestic murder includes stoning, bride burning, honor killing, and dowry death, which sometimes involves non-cohabitating family members. In 2015, the United Kingdom's Home Office widened the definition of domestic violence to include coercive control. Worldwide, the victims of domestic violence are overwhelmingly women, and women tend to experience more severe forms of violence. The World Health Organization (WHO) estimates one in three of all women are subject to domestic violence at some point in their life. In some countries, domestic violence may be seen as justified or legally permitted, particularly in cases of actual or suspected infidelity on the part of the woman. Research has established that there exists a direct and significant correlation between a country's level of gender inequality and rates of domestic violence, where countries with less gender equality experience higher rates of domestic violence. Domestic violence is among the most underreported crimes worldwide for both men and women. Domestic violence often occurs when the abuser believes that they are entitled to it, or that it is acceptable, justified, or unlikely to be reported. It may produce an intergenerational cycle of violence in children and other family members, who may feel that such violence is acceptable or condoned. Many people do not recognize themselves as abusers or victims, because they may consider their experiences as family conflicts that had gotten out of control. Awareness, perception, definition and documentation of domestic violence differs widely from country to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
S
Q205398 EXACT TITLE 1.000
QID OVERLAP: Q205398 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (56): "academic", "administration", "advocacy", "agencies", "arts", "become", "began", "child", "communities", "community", "conducting", "counseling", "defined", "development", "directly", "education", "effects", "families", "family", "functioning".... | EXACT TITLE in nonprofits_community: "Social work". | EXACT TITLE in substance_use_recovery: "Social work".
academicadministrationadvocacyagenciesartsbecomebeganchildcommunitiescommunityconductingcounselingdefineddevelopmentdirectlyeducationeffectsfamiliesfamilyfunctioninggoalsgovernmentgroupgroupshealthhumanindividualindividualsinterventionslabor+26
Social work is an academic discipline and practice-based profession concerned with meeting the basic needs of individuals, families, groups, communities, and society as a whole to enhance their individual and collective well-being. Social work practice draws from liberal arts, social science, and interdisciplinary areas such as psychology, sociology, health, political science, community development, law, and economics to engage with systems and policies, conduct assessments, develop interventions, and enhance social functioning and responsibility. The ultimate goals of social work include the improvement of people's lives, alleviation of biopsychosocial concerns, empowerment of individuals and communities, and the achievement of social reform. Social work practice is often divided into three levels. Micro-work involves working directly with individuals and families, such as providing individual counseling/therapy or assisting a family in accessing services. Mezzo-work involves working with groups and communities, such as conducting group therapy or providing services for community agencies. Macro-work involves fostering change on a larger scale through advocacy, social policy, research development, non-profit and public service administration, or working with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
Definition Social work is a broad profession that intersects with several disciplines. Social work organizations offer the following definitions: Social work is a practice-based profession and an academic discipline that promotes social change and development, social cohesion, and the empowerment and liberation of people. Principles of social justice, human rights, collective responsibility and respect for diversities are central to social work. Underpinned by theories of social work, social sciences, humanities, and indigenous knowledge, social work engages people and structures to address life challenges and enhance well-being. —International Federation of Social Workers Social work is a profession concerned with helping individuals, families, groups and communities to enhance their individual and collective well-being. It aims to help people develop their skills and their ability to use their resources and those of the community to resolve problems. Social work is concerned with individual and personal problems but also with broader social issues such as poverty, unemployment, and domestic violence. — Canadian Association of Social Workers Social work practice consists of the professional application of social principles, and techniques to one or more of the following ends: helping people obtain tangible services; counseling and psychotherapy with individuals, families, and groups; helping communities or groups provide or improve social and health services, and participating in legislative processes. The practice of social work requires knowledge of human development and behavior; of social and economic, and cultural institutions; and the interaction of all these factors. —[US] National Association of Social Workers Social workers work with individuals and families to help improve outcomes in their lives. This may be helping to protect vulnerable people from harm or abuse or supporting people to live independently. Social workers support people, act as advocates and direct people to the services they may require.
The education of social workers begins with a bachelor's degree (BA, BSc, BSSW, BSW, etc.) or diploma in social work or a Bachelor of Social Services. Some countries offer postgraduate degrees in social work, such as a master's degree (MSW, MSSW, MSS, MSSA, MA, MSc, MRes, MPhil.) or doctoral studies (Ph.D. and DSW (Doctor of Social Work)). Several countries and jurisdictions require registration or license for working as social workers, and there are mandated qualifications. In other places, the professional association sets academic requirements as the qualification for practicing the profession. However, certain types of workers are exempted from needing a registration license. The success of these professionals is based on the recognition of and by the employers that provide social work services.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (39): "academic", "activities", "age", "agencies", "beyond", "college", "continuing", "credit", "curriculum", "degree", "development", "different", "division", "domain", "economic", "education", "formal", "forms", "frequently", "general".... | EXACT TITLE in nonprofits_community: "Continuing education". | EXACT TITLE in substance_use_recovery: "Continuing education".
academicactivitiesageagenciesbeyondcollegecontinuingcreditcurriculumdegreedevelopmentdifferentdivisiondomaineconomiceducationformalformsfrequentlygeneralgovernmentinstitutionalleastlifeoperationprofessionalprogramsprovisionratherrecognized+9
t programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
History In the United Kingdom, Oxford University's Department for Continuing Education was founded in 1878, and the Institute of Continuing Education of Cambridge University dates back to 1873. In the United States, the Chautauqua Institution, originally the Chautauqua Lake Sunday School Assembly, was founded in 1874 "as an educational experiment in out-of-school, vacation learning. It was successful and broadened almost immediately beyond courses for Sunday school teachers to include academic subjects, music, art and physical education." Harvard University traces its origins in continuing education to 1835 when John Lowell Jr. established the Lowell Institute with a mission to provide free public lectures in Boston. In 1909, then-Harvard President A. Lawrence Lowell, who was also a trustee of the Lowell Institute, expanded plans to offer Lowell Institute public courses directly with Harvard. In 1910, Lowell formally established the Havard Extension School, then referred to as the Commission on Extension Courses. The Harvard Extension School now operates under the Faculty of Arts and Sciences and is one of the 13 degree-granting schools that make up Harvard University. The School has remained in continuous operation since 1910. Cornell University was among higher education institutions that began offering university-based continuing education, primarily to teachers, through extension courses in the 1870s. As noted in the Cornell Era of February 16, 1877, the university offered a "Tour of the Great Lakes" program for "teachers and others" under the direction of Professor Theodore B. Comstock, head of Cornell's department of geology. The University of Wisconsin–Madison began its continuing education program in 1907. The New School for Social Research, founded in 1919, was initially devoted to adult education. In 1969, Empire State College, a unit of the State University of New York, was the first institution in the US to exclusively focus on providing higher education to adult learners. In 1976 the University of Florida created its own Division of Continuing Education and most courses were offered on evenings or weekends to accommodate the schedules of working students. The method of delivery of continuing education can include traditional types of classroom lectures and laboratories.
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
Affordable housing
Q4689034 EXACT TITLE 1.000
QID OVERLAP: Q4689034 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "affordability", "affordable", "continuum", "demand", "economic", "emergency", "formal", "forms", "government", "home", "homelessness", "household", "housing", "increased", "informal", "leads", "local", "markets", "national", "ownership".... | EXACT TITLE in nonprofits_community: "Affordable housing". | EXACT TITLE in substance_use_recovery: "Affordable housing".
affordabilityaffordablecontinuumdemandeconomicemergencyformalformsgovernmenthomehomelessnesshouseholdhousingincreasedinformalleadslocalmarketsnationalownershiprecognizedrentalresponsesocialsupply
Affordable housing is housing which is deemed affordable to those with a household income at or below the median, as rated by the national government or a local government by a recognized housing affordability index. Most of the literature on affordable housing refers to mortgages and a number of forms that exist along a continuum – from emergency homeless shelters, to transitional housing, to non-market rental (also known as social or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
ore on housing because they feel they can afford to, while others may not have a choice. Increases in any housing supply (whether affordable housing or market-rate housing) leads to increased housing affordability across all segments of the housing markets. Definition and measurement There are several means of defining and measuring affordable housing.
N
Q163740 EXACT TITLE 1.000
QID OVERLAP: Q163740 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (28): "business", "community", "entity", "faith", "further", "hospitals", "institution", "local", "meaning", "mission", "nonprofit", "nonprofits", "operated", "operates", "operations", "organization", "organizations", "private", "program", "public".... | EXACT TITLE in nonprofits_community: "Nonprofit organization".
businesscommunityentityfaithfurtherhospitalsinstitutionlocalmeaningmissionnonprofitnonprofitsoperatedoperatesoperationsorganizationorganizationsprivateprogrampublicpurposequalifyratherrevenueschoolssocialstatussubject
A nonprofit organization (NPO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Management Most nonprofits have staff that work for the organization, possibly using volunteers to perform the nonprofit's services under the direction of the paid staff. Nonprofits must be careful to balance the salaries paid to staff against the money paid to provide services to the nonprofit's beneficiaries. Organizations whose salary expenses are too high relative to their program expenses may face regulatory scrutiny. Some have the misconception that nonprofit organizations may not make a profit. Although the goal of nonprofits is not specifically to maximize profits, they still have to operate as a fiscally responsible business. They must manage their income (grants, donations, and income from services) and expenses so as to remain a fiscally viable entity. Nonprofits have the responsibility of focusing on being professional and financially responsible, replacing self-interest and profit motive with mission motive. Though nonprofits are managed differently from for-profit businesses, they have felt pressure to be more businesslike. To combat private and public business growth in the public service industry, some nonprofits have modeled their business management and mission, shifting their reason of existing to establish sustainability and growth. Setting effective missions is a key for the successful management of nonprofit organizations. There are three important conditions for effective mission: opportunity, competence, and commitment. One way of managing the sustainability of nonprofit organizations is to establish strong relations with donor groups. This requires a donor marketing strategy, something many nonprofits lack. Nonprofit organizations need to motivate staff, maintain and communicate a vision, set a strategic direction, manage change effectively, and provide a safe working environment for employees, volunteers, and visitors.
Nampa, Idaho
Q622633 QID OVERLAP 0.910
QID OVERLAP: Q622633 in nonprofits_community (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "meaning", "metropolitan", "nampa", "population", "principal", "student", "university", "western". | URL->A (1): http://www.nampa.com/.
boisecanyoncollegehomeidahomeaningmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
T
Q17094058 EXACT TITLE 0.900
QID OVERLAP: Q17094058 in nonprofits_community (tier:branch) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (10): "affordable", "emergency", "housing", "long-term", "people", "permanent", "population", "residents", "shelter", "support". | EXACT TITLE in substance_use_recovery: "Transitional housing".
affordableemergencyhousinglong-termpeoplepermanentpopulationresidentssheltersupport
ents of the homeless population, including working homeless people who are earning too little money to afford long-term housing. Transitional housing is set up to transition residents into permanent, affordable housing. It is not in an emergency homeless shelter, but usually a room or apartment in a residence with support services. Description The transitional time can be short, for example one or two years, and in that time the person must file for and get permanent housing and usually some gainful employment or income, even if Social Security or assistance. The cost of transitional housing is the same or less expensive than emergency shelters. But, due to the on site services, transitional tends to be more expensive than permanent supportive housing. In the USA, federal funding for transitional housing programs was originally allocated in the McKinney–Vento Homeless Assistance Act of 1986. In 2022, the Transitional Housing Program, awarded 72 recipients, spending over $35.6 million in the program. In Hong Kong, as part of the Chief Executive of Hong Kong’s policy address in 2018, a Task Force on Transitional Housing was set up under the then Transport and Housing Bureau to actively assist and facilitate various short-term initiatives proposed and implemented by the community to increase the supply of transitional housing. An example of Transitional Housing designed specifically for youth is the Foyer model.
Description The transitional time can be short, for example one or two years, and in that time the person must file for and get permanent housing and usually some gainful employment or income, even if Social Security or assistance. The cost of transitional housing is the same or less expensive than emergency shelters. But, due to the on site services, transitional tends to be more expensive than permanent supportive housing. In the USA, federal funding for transitional housing programs was originally allocated in the McKinney–Vento Homeless Assistance Act of 1986. In 2022, the Transitional Housing Program, awarded 72 recipients, spending over $35.6 million in the program. In Hong Kong, as part of the Chief Executive of Hong Kong’s policy address in 2018, a Task Force on Transitional Housing was set up under the then Transport and Housing Bureau to actively assist and facilitate various short-term initiatives proposed and implemented by the community to increase the supply of transitional housing. An example of Transitional Housing designed specifically for youth is the Foyer model.
Southwestern Idaho
Q7571418 QID OVERLAP 0.800
QID OVERLAP: Q7571418 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (15): "ada", "adams", "boise", "canyon", "counties", "elmore", "gem", "idaho", "metropolitan", "owyhee", "payette", "region", "treasure", "valley", "washington".
adaadamsboisecanyoncountieselmoregemidahometropolitanowyheepayetteregiontreasurevalleywashington
Southwestern Idaho is a geographical term for the area along the U.S. state of Idaho's borders with Oregon and Nevada.
wyhee, Payette, Valley, and Washington are included in the region. Demographics In the 2020 Census, the ten county area had a combined population of 845,395 people; 45.9% of the state's population. Ada and Canyon are the two most populous counties in Idaho, and both have (respectively) experienced a 36.6% and 31.2% growth in population since 2010, making them among the fastest growing counties in terms of population in the state. The largest city in Southwestern Idaho, and in the state, is Boise, with a population of 235,684.
History Southwestern Idaho was originally inhabited by three main Native American tribes: the Shoshone-Bannock, the Nez Perce, and the Northern Paiute. These people were among the first inhabitants in Idaho, first living in the area as early as 12,000 years ago. The Native Americans tribes were nomadic, adopting a hunter-gatherer lifestyle, and had an annual rendezvous in the Boise Valley, which also included catching salmon. Spanish explorers in the late 1500s explored parts of the American West, including southwestern Idaho, and introduced the Native Americans of the area to pigs, horses, domestic fowl, corn, tomatoes, and garlic. After the Lewis and Clark Expedition through Idaho, French-Canadian fur trappers further explored the area. Mountain men, including Spaniards and Mexicans, lived off the land in Southwestern Idaho, trading with the Native Americans in the area. However, it wasn't until further development in Oregon, the mass exodus of settlers to the West on the Oregon, Californian, and Mormon trails, the establishment of Fort Boise, and the Idaho Gold Rush in the 1850s and 60s that settling of Southwestern Idaho began to increase. In order to support mining towns, such as Idaho City, Booneville, Ruby City, and Silver City, numerous ranching and agriculture businesses were set up in the area. One of the biggest ranching operations in 1869 was in Owyhee County, where an original 1,400 head of cattle was driven around the county, forging the area's cattle industry that persists today.
C
Q1029430 QID OVERLAP 0.800
QID OVERLAP: Q1029430 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (77): "abuse", "access", "affect", "agencies", "beyond", "child", "children", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "environment", "environmental", "even"....
abuseaccessaffectagenciesbeyondchildchildrencommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationenvironmentenvironmentalevenfamiliesfamilyfreefuturegoalsgovernmentgroupsharmhealthhealthcare+47
Child protection (also called child welfare) is the safeguarding of children from violence, exploitation, abuse, abandonment, and neglect. It involves identifying signs of potential harm. This includes responding to allegations or suspicions of abuse, providing support and services to protect children, and holding those who have harmed them accountable. The primary goal of child protection is to ensure that all children are safe and free from harm or danger. Child protection also works to prevent future harm by creating policies and systems that identify and respond to risks before they lead to harm. In order to achieve these goals, research suggests that child protection services should be provided in a holistic way. This means taking into account the social, economic, cultural, psychological, and environmental factors that can contribute to the risk of harm for individual children and their families. Collaboration across sectors and disciplines to create a comprehensive system of support and safety for children is required. It is the responsibility of individuals, organizations, and governments to ensure that children are protected from harm and their rights are respected.
that children are protected from harm and their rights are respected. This includes providing a safe environment for children to grow and develop, protecting them from physical, emotional and sexual abuse, and ensuring they have access to education, healthcare, and resources to fulfill their basic needs. Child protection systems are a set of services, usually government-run, designed to protect children and young people who are underage and to encourage family stability. UNICEF defines a 'child protection system' as: "The set of laws, policies, regulations and services needed across all social sectors – especially social welfare, education, health, security and justice – to support prevention and response to protection-related risks. These systems are part of social protection, and extend beyond it. At the level of prevention, their aim includes supporting and strengthening families to reduce social exclusion, and to lower the risk of separation, violence and exploitation. Responsibilities are often spread across government agencies, with services delivered by local authorities, non-State providers, and community groups, making coordination between sectors and levels, including routine referral systems etc.., a necessary component of effective child protection systems."Under Article 19 of the UN Convention on the Rights of the Child, a 'child protection system' provides for the protection of children in and out of the home. One of the ways this can be enabled is through the provision of quality education, the fourth of the United Nations Sustainable Development Goals, in addition to other child protection systems.
Endangerment Child endangerment is the act of placing a child in a situation that neglects their health or life. Child endangerment can cause many negative physical and mental effects. This can stem from abusive parental care, child neglect, and a multitude of other reasons. Ways to prevent incidents of child endangerment include primary parents or caregivers spending ample time with their children and seeking out appropriate resources to assist in understanding early childhood development. A number of states in the US have laws put in place to prevent child abuse or neglect, with the majority of them focusing on arrest sentences up to five years and fines ranging from $5,000-$15,000. Infanticide (child murder) Infanticide is the intentional killing of infants and young children. This practice has been documented throughout history and still occurs in certain cultures today, usually as a result of poverty and/or other social pressures. Infanticide can be carried out by parents, relatives, or strangers and is often seen as a form of gender-based violence, since female babies are more likely to be killed than male ones. In some cases, infanticide may also be used to conceal evidence of incest or rape. It is most commonly practiced in cultures where there is a preference for male children, or where resources are scarce. In some countries, children can be imprisoned for common crimes. In some countries, like Iran or China, criminals can even be sentenced to capital punishment for crimes committed while they were children (the United States abandoned the practice in 2005). In contexts where military use of children is made, they also risk becoming prisoners of war. Other children are forced into prostitution, exploited by adults for illegal traffic in children, or endangered by poverty and hunger. Infanticide today continues at a much higher rate in areas of extremely high poverty and overpopulation, such as parts of China and India.
H
Q1631460 QID OVERLAP 0.800
QID OVERLAP: Q1631460 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (62): "address", "addresses", "affect", "against", "care", "cause", "children", "community", "comprehensive", "continuum", "cost", "different", "education", "emergency", "employment", "entering", "evidence", "family", "form", "government"....
addressaddressesaffectagainstcarecausechildrencommunitycomprehensivecontinuumcostdifferenteducationemergencyemploymententeringevidencefamilyformgovernmenthealthcarehomelessnesshospitalshousehouseholdhousingimplementationindependentindividualindividuals+32
approaches are based on the concept that a homeless individual or household's first and primary need is to obtain stable housing, and that other issues that may affect the household can and should be addressed once housing is obtained. In contrast, many other programs operate from a model of "housing readiness" — that is, that an individual or household must address other issues that may have led to the episode of homelessness prior to entering housing. The Housing First strategy is a comprehensive solution incorporating support for homeless people in all aspects of their personal and social life. It does not intend to provide housing for the people in need and forget about them. The Housing First philosophy is a paradigm shift, where quick provision of stable accommodations is a precondition for any other treatment to reduce homelessness. Meanwhile, this approach relies on layers of collaborative support networks that promote stability and eliminate factors that cause or prolong homelessness. The support system addresses social and structural issues such as healthcare, education, family, children, employment, and social welfare.
to reduce homelessness. Meanwhile, this approach relies on layers of collaborative support networks that promote stability and eliminate factors that cause or prolong homelessness. The support system addresses social and structural issues such as healthcare, education, family, children, employment, and social welfare.
Definition Housing First for the chronically homeless is premised on the notion that housing is a basic human right, and so should not be denied to anyone, even if they are using alcohol or other substances. The Housing First model, thus, is philosophically in contrast to models that require the homeless to abjure substance-abuse and seek treatment in exchange for housing. This includes 'Treatment first' models, which provide temporary housing while addressing mental, physical and substance use needs, but only offer permanent housing on the condition that treatment plans are adhered to. Housing First, when supported by the United States Department of Housing and Urban Development, does not only provide housing. The model, used by nonprofit agencies throughout America, also provides wraparound case management services to the tenants, without the precondition of sobriety. This case management provides stability for homeless individuals, which increases their success. It allows for accountability and promotes self-sufficiency. The housing provided through government supported Housing First programs is permanent and "affordable," meaning that tenants pay 30% of their income towards rent. Housing First, as pioneered by Pathways to Housing, targets individuals with disabilities. This housing is supported through two HUD programs. They are the Supportive Housing Program and the Shelter Plus Care Program.
Civil Rights Act of 1968
Q1094483 QID OVERLAP 0.800
QID OVERLAP: Q1094483 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (34): "act", "applicable", "child", "children", "code", "concerning", "development", "different", "enforcement", "expanded", "fair", "families", "family", "federal", "financing", "force", "funding", "housing", "law", "makes"....
actapplicablechildchildrencodeconcerningdevelopmentdifferentenforcementexpandedfairfamiliesfamilyfederalfinancingforcefundinghousinglawmakesmembernationalorganizedpeopleprivateprogramsprotectedprovisionprovisionsrental+4
The Civil Rights Act of 1968 (Pub. L. 90–284, 82 Stat. 73, enacted April 11, 1968) is a landmark law in the United States signed into law by President Lyndon B. Johnson during the King assassination riots. Titles II through VII comprise the Indian Civil Rights Act, which applies to the Native American tribes of the United States and makes many but not all of the guarantees of the U.S. Bill of Rights applicable within the tribes. (That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
e Indian Civil Rights Act, which applies to the Native American tribes of the United States and makes many but not all of the guarantees of the U.S. Bill of Rights applicable within the tribes. (That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
That Act appears today in Title 25, sections 1301 to 1303 of the United States Code). Titles VIII and IX are commonly known as the Fair Housing Act, which was meant as a follow-up to the Civil Rights Act of 1964. (This is different legislation than the Housing and Urban Development Act of 1968, which expanded housing funding programs.) While the Civil Rights Act of 1866 prohibited discrimination in housing, there were no federal enforcement provisions. The 1968 act expanded on previous acts and prohibited discrimination concerning the sale, rental, and financing of housing based on race, religion, national origin, and since 1974, sex. Since 1988, the act protects people with disabilities and families with children. Pregnant women are also protected from illegal discrimination because they have been given familial status with their unborn child being the other family member. Victims of discrimination may use both the 1968 act and the 1866 act's section 1983 to seek redress. The 1968 act provides for federal solutions while the 1866 act provides for private solutions (i.e., civil suits). The act also made it a federal crime to "by force or by threat of force, injure, intimidate, or interfere with anyone...
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (16): "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaannualblockboisecapitalcountiesemployershomeidaholocallymajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "home", "idaho", "largest", "local", "metropolitan", "population", "private", "washington".
adaboisecapitaldistricthomeidaholargestlocalmetropolitanpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in nonprofits_community (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "population".
adaamongboisecapitalidahomakingpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
256 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP256 edges
🌿 BRANCH212 edges
0.500
businesscommunity-basedcostenvironmentfinancialfinanciallygrouphousehousesindependentlaterlivingmembermodeloperatingorganizationrecoveryrehabilitationresidentsrules
SHARED TOKENS (23): "business", "community-based", "cost", "environment", "financial", "financially", "group", "house", "houses", "independent", "later", "living", "member", "model", "operating", "organization", "recovery", "rehabilitation", "residents", "rules".... | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
academicamongappropriatebecomecareclinicscoordinationcriticaldepartmentsdirectlyearlyemergencygeneralhopehospitalinterventionslimitedmedicalmodelmodels
SHARED TOKENS (37): "academic", "among", "appropriate", "become", "care", "clinics", "coordination", "critical", "departments", "directly", "early", "emergency", "general", "hope", "hospital", "interventions", "limited", "medical", "model", "models".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
actionbodycasescharitableclaimsevidencehumanlimitedlivinglong-termpractitionersreturnssupportingtherapytypes
SHARED TOKENS (15): "action", "body", "cases", "charitable", "claims", "evidence", "human", "limited", "living", "long-term", "practitioners", "returns", "supporting", "therapy", "types". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.500
absenceactivitiesaffectamongbroadercommunitycreatedecisionsdefinesdetermineshealthindividuallifemerelyorganizationpeoplepotentialprofessionalpsychologyrather
SHARED TOKENS (24): "absence", "activities", "affect", "among", "broader", "community", "create", "decisions", "defines", "determines", "health", "individual", "life", "merely", "organization", "people", "potential", "professional", "psychology", "rather".... | EXACT TITLE in substance_use_recovery: "Mental health".
0.500
accessappointmentbecomebroadcarecenterdepartmentdepartmentsemergencyentryfacilityfoundhospitalhospitalshourslevelsmeansmedicaloperatepatient
SHARED TOKENS (26): "access", "appointment", "become", "broad", "care", "center", "department", "departments", "emergency", "entry", "facility", "found", "hospital", "hospitals", "hours", "levels", "means", "medical", "operate", "patient".... | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
applyassistancecapacityconsentemergencyfoundfoundationinjurylawlegallukemedicalneedoperatepeopleprofessionalprofessionalsprotectionpurposereduce
SHARED TOKENS (25): "apply", "assistance", "capacity", "consent", "emergency", "found", "foundation", "injury", "law", "legal", "luke", "medical", "need", "operate", "people", "professional", "professionals", "protection", "purpose", "reduce".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
businessformgovernmentincreaselifelong-termmaterialpracticespresentprivateprovidingprovisionpublicqualityrather
SHARED TOKENS (15): "business", "form", "government", "increase", "life", "long-term", "material", "practices", "present", "private", "providing", "provision", "public", "quality", "rather". | EXACT TITLE in nonprofits_community: "Philanthropy".
0.500
abusecannotcategorycentercentersdepartmentsdomesticemergencygroupshomesmanagementminorneedorganizationspeopleplaceprocesspurposeresponseschool
SHARED TOKENS (26): "abuse", "cannot", "category", "center", "centers", "departments", "domestic", "emergency", "groups", "homes", "management", "minor", "need", "organizations", "people", "place", "process", "purpose", "response", "school".... | EXACT TITLE in nonprofits_community: "Emergency shelter".
0.500
academicadministrationbusinesscompletiondegreedevelopmentgovernmentgraduateleadersmanagementmasternonprofitspolicyprivateprofessionalprogrampublicrequiresspecializedstudents
SHARED TOKENS (23): "academic", "administration", "business", "completion", "degree", "development", "government", "graduate", "leaders", "management", "master", "nonprofits", "policy", "private", "professional", "program", "public", "requires", "specialized", "students".... | EXACT TITLE in nonprofits_community: "Master of Public Administration".
0.500
accessactiveadultsageassistanceboardcentercenterscommunitycriticalfacilityfederalfinancialfundinginternetlimitedlocalmeansmembersmultiple
SHARED TOKENS (35): "access", "active", "adults", "age", "assistance", "board", "center", "centers", "community", "critical", "facility", "federal", "financial", "funding", "internet", "limited", "local", "means", "members", "multiple".... | EXACT TITLE in nonprofits_community: "Senior center".
0.500
abuseageagencyamongbecomecarechildchildrenclientscommunityconditionscreateddatadecisionsdegreedescribedfamiliesfamilygeneralgovernment
SHARED TOKENS (49): "abuse", "age", "agency", "among", "become", "care", "child", "children", "clients", "community", "conditions", "created", "data", "decisions", "degree", "described", "families", "family", "general", "government".... | EXACT TITLE in nonprofits_community: "Foster care".
0.500
Legal aid ↗ Q707748 EXACT TITLE
accessassistancecasescentralclientsclinicscommunitycostdescribesdevelopmentfairfinancialformsfreegeneralhumanindividualsinformaljusticelaw
SHARED TOKENS (35): "access", "assistance", "cases", "central", "clients", "clinics", "community", "cost", "describes", "development", "fair", "financial", "forms", "free", "general", "human", "individuals", "informal", "justice", "law".... | EXACT TITLE in nonprofits_community: "Legal aid".
0.500
actamongauthorizedblockbuildingcommunitiescommunitycreatecreateddepartmentdevelopmentestablishedfederalgrantgrantshousinglawnationalprogramprovisions
SHARED TOKENS (20): "act", "among", "authorized", "block", "building", "communities", "community", "create", "created", "department", "development", "established", "federal", "grant", "grants", "housing", "law", "national", "program", "provisions". | EXACT TITLE in nonprofits_community: "Housing and Community Development Act of 1974".
0.500
aroundcommunitycoordinateddesignedfacilityfamilyfoundationgrantindividualinvestmentlocalmakingplaceprivatesinglesocialsociety
SHARED TOKENS (17): "around", "community", "coordinated", "designed", "facility", "family", "foundation", "grant", "individual", "investment", "local", "making", "place", "private", "single", "social", "society". | EXACT TITLE in nonprofits_community: "Community foundation".
0.500
activitiescharitablecorporatedemonstratedependeducationalevaluatorsexclusivelyfinancialformfundsimpactindicatorsindividualinformationinvestmentlawleadershiplegalmajor
SHARED TOKENS (38): "activities", "charitable", "corporate", "demonstrate", "depend", "educational", "evaluators", "exclusively", "financial", "form", "funds", "impact", "indicators", "individual", "information", "investment", "law", "leadership", "legal", "major".... | EXACT TITLE in nonprofits_community: "Charitable organization".
0.500
activitiesaddressagecannotcarecommunityconditionscoordinateddisabilityfacilitieshomehomesincreasinglyindependencelifelivinglong-termmedicalmultipleneed
SHARED TOKENS (31): "activities", "address", "age", "cannot", "care", "community", "conditions", "coordinated", "disability", "facilities", "home", "homes", "increasingly", "independence", "life", "living", "long-term", "medical", "multiple", "need".... | EXACT TITLE in nonprofits_community: "Long-term care".
0.500
activitiesaroundauthoritybecomecareclientclinicalcontrolcontrolleddefineddeliveringdirecteducationeffectsevidenceexperiencefinancialformalfoundgeneral
SHARED TOKENS (55): "activities", "around", "authority", "become", "care", "client", "clinical", "control", "controlled", "defined", "delivering", "direct", "education", "effects", "evidence", "experience", "financial", "formal", "found", "general".... | EXACT TITLE in nonprofits_community: "Clinical supervision".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
actionalongsideamongcaseclinicaldetermineeffectsfamilyfederalformfurtherhealthhealthcareincreasedinvolvinglistlocalmakesmanagementmedical
SHARED TOKENS (30): "action", "alongside", "among", "case", "clinical", "determine", "effects", "family", "federal", "form", "further", "health", "healthcare", "increased", "involving", "list", "local", "makes", "management", "medical".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
activitiescharitabledepartmentdevelopmentdistributionestablishedfiscalfundsgroupgroupshousinglegallocalmissionnonprofitorganizationorganizationspracticerelatedstatus
SHARED TOKENS (20): "activities", "charitable", "department", "development", "distribution", "established", "fiscal", "funds", "group", "groups", "housing", "legal", "local", "mission", "nonprofit", "organization", "organizations", "practice", "related", "status". | EXACT TITLE in nonprofits_community: "Fiscal sponsorship".
0.500
accessamongbeganbehavioralcarecasecaseschildcommunitiescommunitycomprehensivecontrolcrisesdesigneddevelopmentdifferentdisabilitydistributioneducationenvironmental
SHARED TOKENS (65): "access", "among", "began", "behavioral", "care", "case", "cases", "child", "communities", "community", "comprehensive", "control", "crises", "designed", "development", "different", "disability", "distribution", "education", "environmental".... | EXACT TITLE in nonprofits_community: "Public health".
0.500
analysisapplicationclinicalcommunitycontroleducationalfamilyframeworkhealthinterventionslargestmanagementmodelplanproceduresproduceprogrampsychologyregulationsrules
SHARED TOKENS (24): "analysis", "application", "clinical", "community", "control", "educational", "family", "framework", "health", "interventions", "largest", "management", "model", "plan", "procedures", "produce", "program", "psychology", "regulations", "rules".... | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
actionagencyappropriatebeganchildrencreatedcreatingdepartmentenforcementforceidaholawmunicipalofficersorganizationpolicepresentpublicstatewide
SHARED TOKENS (19): "action", "agency", "appropriate", "began", "children", "created", "creating", "department", "enforcement", "force", "idaho", "law", "municipal", "officers", "organization", "police", "present", "public", "statewide". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
0.500
administrationadministrativeanalysisappropriatebetterconcerningcostcostsdegreedifferentdocumentedeconomicestablishedevaluationevaluatorsfairfundinggoalsimpactinformation
SHARED TOKENS (52): "administration", "administrative", "analysis", "appropriate", "better", "concerning", "cost", "costs", "degree", "different", "documented", "economic", "established", "evaluation", "evaluators", "fair", "funding", "goals", "impact", "information".... | EXACT TITLE in nonprofits_community: "Program evaluation". | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
administeredapproximatelyassistancebenefitschildrencontractorscostsdepartmentdepartmentsdependsdirectlydivisionelectronicexchangefederalfoodgovernmenthealthhistoryhousehold
SHARED TOKENS (39): "administered", "approximately", "assistance", "benefits", "children", "contractors", "costs", "department", "departments", "depends", "directly", "division", "electronic", "exchange", "federal", "food", "government", "health", "history", "household".... | EXACT TITLE in nonprofits_community: "Supplemental Nutrition Assistance Program".
0.500
abuseactivityalreadyamongcauseclassificationcontrolleddependentdifferenteffectsfurtherhealthhistoryhourhoursincreaselistmedicalorganizationpoint
SHARED TOKENS (27): "abuse", "activity", "already", "among", "cause", "classification", "controlled", "dependent", "different", "effects", "further", "health", "history", "hour", "hours", "increase", "list", "medical", "organization", "point".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
centralclientsclinicalcounselingdefineddescribeddescriptioneffectsexperienceinfluencemakingproblemprocedurespublishedpurposeratherrelationshiptherapiststherapytreatment
SHARED TOKENS (20): "central", "clients", "clinical", "counseling", "defined", "described", "description", "effects", "experience", "influence", "making", "problem", "procedures", "published", "purpose", "rather", "relationship", "therapists", "therapy", "treatment". | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
approximatelydesignedemergencyexperiencefamilyformgovernmenthomelessnesshousehouseshousinghumanidentifyingindividualslegallivingneedspeoplepermanentplace
SHARED TOKENS (30): "approximately", "designed", "emergency", "experience", "family", "form", "government", "homelessness", "house", "houses", "housing", "human", "identifying", "individuals", "legal", "living", "needs", "people", "permanent", "place".... | EXACT TITLE in nonprofits_community: "Homelessness". | EXACT TITLE in substance_use_recovery: "Homelessness".
0.500
administrativeamongassociationcapacitycasesdomainfallgeneralgovernmenthistorynationalofficialpracticeprimaryrecordsserving
SHARED TOKENS (16): "administrative", "among", "association", "capacity", "cases", "domain", "fall", "general", "government", "history", "national", "official", "practice", "primary", "records", "serving". | EXACT TITLE in nonprofits_community: "Secretary of state (U.S. state government)".
0.500
actagainstagebecomeconsentcoordinateddatadisclosuredomesticenforcementengagementevenformfrequentlygeneralhealthhistoricalhumanincreasedindividual
SHARED TOKENS (40): "act", "against", "age", "become", "consent", "coordinated", "data", "disclosure", "domestic", "enforcement", "engagement", "even", "form", "frequently", "general", "health", "historical", "human", "increased", "individual".... | EXACT TITLE in nonprofits_community: "Sexual violence".
0.500
accessaddressaddressingalreadyamongbarrierscapacitycommunitycompetedevelopmentearliereconomiceducationemployersformformalformsgovernmenthistoricallyhistory
SHARED TOKENS (60): "access", "address", "addressing", "already", "among", "barriers", "capacity", "community", "compete", "development", "earlier", "economic", "education", "employers", "form", "formal", "forms", "government", "historically", "history".... | EXACT TITLE in nonprofits_community: "Workforce development".
0.500
Pharmacy ↗ EXACT TITLE
affordablebecomecareclinicalcommunitydirecthealthinformationinstitutionallinksmodernmonitoringofficepatientpharmaciespracticeprimaryprofessionalprofessionalsproviding
SHARED TOKENS (28): "affordable", "become", "care", "clinical", "community", "direct", "health", "information", "institutional", "links", "modern", "monitoring", "office", "patient", "pharmacies", "practice", "primary", "professional", "professionals", "providing".... | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
ageamongcapturecareclinicalclinicianscombinesconditionsdatadesigneddifferentdigitalelectronichealthhealthcarehistoryidentifyincreasinginformationlong-term
SHARED TOKENS (44): "age", "among", "capture", "care", "clinical", "clinicians", "combines", "conditions", "data", "designed", "different", "digital", "electronic", "health", "healthcare", "history", "identify", "increasing", "information", "long-term".... | EXACT TITLE in nonprofits_community: "Electronic health record". | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
admissionsauthoritycentercommunitydifferentdirectlyeducationeducationalestatefundedinstitutionlifelocalpubliclyschoolschoolsservesstate-fundedstudentsstudy
SHARED TOKENS (20): "admissions", "authority", "center", "community", "different", "directly", "education", "educational", "estate", "funded", "institution", "life", "local", "publicly", "school", "schools", "serves", "state-funded", "students", "study". | EXACT TITLE in nonprofits_community: "Community school".
0.500
clinicalconnectioncontinuingcontrolcounselingcounselorsdisclosuredistincteducationemergencyexperienceformsknowledgemedicalmembersorganizationspeerpeerspeoplepersonnel
SHARED TOKENS (35): "clinical", "connection", "continuing", "control", "counseling", "counselors", "disclosure", "distinct", "education", "emergency", "experience", "forms", "knowledge", "medical", "members", "organizations", "peer", "peers", "people", "personnel".... | EXACT TITLE in nonprofits_community: "Peer support". | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
abuseactadministrationagenciesapplicationclassificationcomprehensivecontrolcontrolledcreateddecisionsdeterminedistributionenforcementestablishingfederalfoodlawmedicalnational
SHARED TOKENS (30): "abuse", "act", "administration", "agencies", "application", "classification", "comprehensive", "control", "controlled", "created", "decisions", "determine", "distribution", "enforcement", "establishing", "federal", "food", "law", "medical", "national".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
adultsbenefitschildrenclientclinicalconditionscontrolledcounselorsdesigneddifferdifferentdriverseffectsfamiliesfamilyformsfoundgeneralgroupshealth
SHARED TOKENS (54): "adults", "benefits", "children", "client", "clinical", "conditions", "controlled", "counselors", "designed", "differ", "different", "drivers", "effects", "families", "family", "forms", "found", "general", "groups", "health".... | EXACT TITLE in nonprofits_community: "Psychotherapy".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsaffordableagendaannualbecomebenefitscarechildrencommunity-basedcostcostscoveragecoveredeconomiceligibilityestablishedexpandexpanded
SHARED TOKENS (64): "access", "act", "adults", "affordable", "agenda", "annual", "become", "benefits", "care", "children", "community-based", "cost", "costs", "coverage", "covered", "economic", "eligibility", "established", "expand", "expanded".... | EXACT TITLE in nonprofits_community: "Medicaid". | EXACT TITLE in substance_use_recovery: "Medicaid".
0.500
addressadministeredagencyassistanceavailabilitycarechildrenconnectedcoverageeducationfacilitiesfamiliesfoodfunctiongovernmentgroupshealthhousinghumanindependent
SHARED TOKENS (38): "address", "administered", "agency", "assistance", "availability", "care", "children", "connected", "coverage", "education", "facilities", "families", "food", "function", "government", "groups", "health", "housing", "human", "independent".... | EXACT TITLE in nonprofits_community: "Social services".
0.500
broadcharitableclaimsestatefoundationfundslegalorganizationplanningprivatepublicregisteredrelyreportingrequirementsservesupport
SHARED TOKENS (17): "broad", "charitable", "claims", "estate", "foundation", "funds", "legal", "organization", "planning", "private", "public", "registered", "rely", "reporting", "requirements", "serve", "support". | EXACT TITLE in nonprofits_community: "Private foundation".
0.500
actadministrationagencycausecommunitycontrolleddepartmentdistributiondomesticenforcementestablishedfederalgovernmentharminvolvingjusticelawmembernationaloperations
SHARED TOKENS (25): "act", "administration", "agency", "cause", "community", "controlled", "department", "distribution", "domestic", "enforcement", "established", "federal", "government", "harm", "involving", "justice", "law", "member", "national", "operations".... | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
0.500
Methadone ↗ Q179996 EXACT TITLE
abuseamongeffectsfrequentlyfunctionhealthhoursinvolvinglifelistlong-termmaintenancemanagementorganizationpatientpeoplerapidriskssingletherapy
SHARED TOKENS (21): "abuse", "among", "effects", "frequently", "function", "health", "hours", "involving", "life", "list", "long-term", "maintenance", "management", "organization", "patient", "people", "rapid", "risks", "single", "therapy".... | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Probation ↗ Q13961 EXACT TITLE
abusecasechildcommunityconditionscontactdomesticeducationalelectronicfoundlawlimitedmeansplacepossessionpotentialprogramremainrequiredrules
SHARED TOKENS (24): "abuse", "case", "child", "community", "conditions", "contact", "domestic", "educational", "electronic", "found", "law", "limited", "means", "place", "possession", "potential", "program", "remain", "required", "rules".... | EXACT TITLE in substance_use_recovery: "Probation".
0.500
Drug court ↗ Q5308883 EXACT TITLE
addresscommunitiesdefensedriversenforcementhealthlawlong-termmodelmonitoringprocesspublicpurposerecoveryreducesocialspecializedtreatmentwork
SHARED TOKENS (19): "address", "communities", "defense", "drivers", "enforcement", "health", "law", "long-term", "model", "monitoring", "process", "public", "purpose", "recovery", "reduce", "social", "specialized", "treatment", "work". | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
activitiesaffordableblockcommunitydepartmentdevelopmentfederalfundsgrantgrantshousinginfrastructurelocaloversightprogramprogramsprovidingspecificstatedsubject
SHARED TOKENS (20): "activities", "affordable", "block", "community", "department", "development", "federal", "funds", "grant", "grants", "housing", "infrastructure", "local", "oversight", "program", "programs", "providing", "specific", "stated", "subject". | EXACT TITLE in nonprofits_community: "Community Development Block Grant". | EXACT TITLE in substance_use_recovery: "Community Development Block Grant".
0.500
acceptanceaddressassociationbehavioralchangingchildrenclientcombinesconditionsdefineddesigneddevelopmentformformshealthidentifiedindividuallimitedmaintenancemedical
SHARED TOKENS (37): "acceptance", "address", "association", "behavioral", "changing", "children", "client", "combines", "conditions", "defined", "designed", "development", "form", "forms", "health", "identified", "individual", "limited", "maintenance", "medical".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
Psychology ↗ Q9418 EXACT TITLE
academicactivityassessmentbehavioralbroadclinicalcounselingdevelopmenteducationemployfamilyfunctioningfunctionsgroupgroupshealthhospitalshumanindividualindividuals
SHARED TOKENS (44): "academic", "activity", "assessment", "behavioral", "broad", "clinical", "counseling", "development", "education", "employ", "family", "functioning", "functions", "group", "groups", "health", "hospitals", "human", "individual", "individuals".... | EXACT TITLE in nonprofits_community: "Psychology". | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
administrativeauthoritybeganconsolidatedcountiesdefineddifferentdistrictequivalentformfurthergovernmentindependentlawleastlegallylocallocallyminormultiple
SHARED TOKENS (28): "administrative", "authority", "began", "consolidated", "counties", "defined", "different", "district", "equivalent", "form", "further", "government", "independent", "law", "least", "legally", "local", "locally", "minor", "multiple".... | EXACT TITLE in nonprofits_community: "County (United States)". | EXACT TITLE in substance_use_recovery: "County (United States)".
0.500
accessactivitiesactivityagainstcampaignscaredependentdesigneddifferentdriverseducationenvironmentfacilitiesfoodfreeharmhealthhomelessnesshumaninformation
SHARED TOKENS (48): "access", "activities", "activity", "against", "campaigns", "care", "dependent", "designed", "different", "drivers", "education", "environment", "facilities", "food", "free", "harm", "health", "homelessness", "human", "information".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
casedifferentenforcementequivalentevenexecutiveexperiencefamilygeneralgovernmenthistoricalindividualjusticelawlegalmattersmemberofficialpermanentpermanently
SHARED TOKENS (26): "case", "different", "enforcement", "equivalent", "even", "executive", "experience", "family", "general", "government", "historical", "individual", "justice", "law", "legal", "matters", "member", "official", "permanent", "permanently".... | EXACT TITLE in nonprofits_community: "Attorney general".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
actionamongcareclinicalcollegescommunitydegreedifferenteducationeffectsgovernmenthealthhealthcarehospitalindustryknowledgelegallicensingmanagementmaster
SHARED TOKENS (42): "action", "among", "care", "clinical", "colleges", "community", "degree", "different", "education", "effects", "government", "health", "healthcare", "hospital", "industry", "knowledge", "legal", "licensing", "management", "master".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
Internship ↗ Q6500754 EXACT TITLE
adultsagenciesalreadybroadbuildcollegecurrentdetermineemployersemploymentexchangeexperiencefuturegovernmentgroupsindustryinternsinternshipinvestmentlimited
SHARED TOKENS (44): "adults", "agencies", "already", "broad", "build", "college", "current", "determine", "employers", "employment", "exchange", "experience", "future", "government", "groups", "industry", "interns", "internship", "investment", "limited".... | EXACT TITLE in nonprofits_community: "Internship". | EXACT TITLE in substance_use_recovery: "Internship".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectedamongbehavioralchildclinicalcontextcontrolledcostcostsdevelopmentdirectlyeffectsenvironmentenvironmentalevidenceformsfoundfurthergroupgroups
SHARED TOKENS (56): "affected", "among", "behavioral", "child", "clinical", "context", "controlled", "cost", "costs", "development", "directly", "effects", "environment", "environmental", "evidence", "forms", "found", "further", "group", "groups".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
bodybusinesscasescharitablecorporatedevelopmententityfoundationfundedfundingfundsgovernmentgrantgrantsindividualinstitutionlocalmissionorganizationpaid
SHARED TOKENS (28): "body", "business", "cases", "charitable", "corporate", "development", "entity", "foundation", "funded", "funding", "funds", "government", "grant", "grants", "individual", "institution", "local", "mission", "organization", "paid".... | EXACT TITLE in nonprofits_community: "Grant (money)". | EXACT TITLE in substance_use_recovery: "Grant (money)".
0.500
Caregiver ↗ Q553079 EXACT TITLE
activitiesagecannotcarecentersdisabilitydocumentationfamilyformalhealthcarehomehomeshospitalshouseholdinformallivinglong-termpaidpeoplepersonnel
SHARED TOKENS (25): "activities", "age", "cannot", "care", "centers", "disability", "documentation", "family", "formal", "healthcare", "home", "homes", "hospitals", "household", "informal", "living", "long-term", "paid", "people", "personnel".... | EXACT TITLE in nonprofits_community: "Caregiver".
0.500
academicactionactiveaffectagendaamongassociationbroadbuildciviccommunitiescommunitycontextcouncilcreateddefineddefinesdevelopmenteconomiceducation
SHARED TOKENS (51): "academic", "action", "active", "affect", "agenda", "among", "association", "broad", "build", "civic", "communities", "community", "context", "council", "created", "defined", "defines", "development", "economic", "education".... | EXACT TITLE in nonprofits_community: "Community development". | EXACT TITLE in substance_use_recovery: "Community development".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationsboardsbridgebroadcarecaseclinicalcliniciansconditionsdatadefinesdigitaleducationelectronicevenfacilitiesfunding
SHARED TOKENS (47): "access", "administration", "application", "applications", "boards", "bridge", "broad", "care", "case", "clinical", "clinicians", "conditions", "data", "defines", "digital", "education", "electronic", "even", "facilities", "funding".... | EXACT TITLE in substance_use_recovery: "Telehealth".
0.500
associationbecomebenefitsbusinesscharitablecommunitiescommunitycommunity-baseddefineddirectestablishedgoalsgroupshistoricalhistoricallyhospitalsidentifyinstitutionsmeetingmembers
SHARED TOKENS (34): "association", "become", "benefits", "business", "charitable", "communities", "community", "community-based", "defined", "direct", "established", "goals", "groups", "historical", "historically", "hospitals", "identify", "institutions", "meeting", "members".... | EXACT TITLE in nonprofits_community: "Service club".
0.500
amongapproximatelyconcerningcounselingdesigneddevelopmentevaluationfallfamilygeneralgroupharmhealthhousesincorporatedindividualinternetinterventionlong-termmedical
SHARED TOKENS (44): "among", "approximately", "concerning", "counseling", "designed", "development", "evaluation", "fall", "family", "general", "group", "harm", "health", "houses", "incorporated", "individual", "internet", "intervention", "long-term", "medical".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
abuseadultsagebehavioralcategoriescategorydirectdirectlyharmhealthincreasedindividualoperatingpatternpeoplepercentproblemsqualifiedreducerelated
SHARED TOKENS (20): "abuse", "adults", "age", "behavioral", "categories", "category", "direct", "directly", "harm", "health", "increased", "individual", "operating", "pattern", "people", "percent", "problems", "qualified", "reduce", "related". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.500
adultsamongbehavioralcausecentralconcerningconditionscontrolleddepartmenteffectsenvironmentexposurefacilitiesfrequentlygovernmenthealthincreasedlistlong-termmajor
SHARED TOKENS (43): "adults", "among", "behavioral", "cause", "central", "concerning", "conditions", "controlled", "department", "effects", "environment", "exposure", "facilities", "frequently", "government", "health", "increased", "list", "long-term", "major".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
activitiesaffordablebuildbuildingcontractorsfamiliesfinancialgovernmenthomeshousingindividualsinfrastructurelabormakesmedianonprofitoperatesorganizationpaidpractice
SHARED TOKENS (21): "activities", "affordable", "build", "building", "contractors", "families", "financial", "government", "homes", "housing", "individuals", "infrastructure", "labor", "makes", "media", "nonprofit", "operates", "organization", "paid", "practice".... | EXACT TITLE in nonprofits_community: "Habitat for Humanity".
0.500
activeaddressesappropriatecomprehensivecounselingdependencydischargeeducationalengagementfacilitiesfacilityfamilygroupgroupshealthhospitalhoursindividualoperatesparticipation
SHARED TOKENS (32): "active", "addresses", "appropriate", "comprehensive", "counseling", "dependency", "discharge", "educational", "engagement", "facilities", "facility", "family", "group", "groups", "health", "hospital", "hours", "individual", "operates", "participation".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcarecertificationchangingclinicalcredentialsdegreedemandeducationfamiliesfunctioninggraduatehealthhealthcarehumaninjurylargestlevelslifemembers
SHARED TOKENS (40): "act", "care", "certification", "changing", "clinical", "credentials", "degree", "demand", "education", "families", "functioning", "graduate", "health", "healthcare", "human", "injury", "largest", "levels", "life", "members".... | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
accessactiveaffordableageagencyavailabilitybeyondchildrencreatedegreedevelopmentearlyeconomiceffectsevenfamilyfoodfuturehealthhousehold
SHARED TOKENS (48): "access", "active", "affordable", "age", "agency", "availability", "beyond", "children", "create", "degree", "development", "early", "economic", "effects", "even", "family", "food", "future", "health", "household".... | EXACT TITLE in nonprofits_community: "Food security".
0.500
Eviction ↗ Q1893186 EXACT TITLE
amongevenevictionhistoricallandlordlawlegalpossessionpracticeproceduresprocessprovisionsrelatedrentalspecificstructures
SHARED TOKENS (16): "among", "even", "eviction", "historical", "landlord", "law", "legal", "possession", "practice", "procedures", "process", "provisions", "related", "rental", "specific", "structures". | EXACT TITLE in nonprofits_community: "Eviction". | EXACT TITLE in substance_use_recovery: "Eviction".
0.500
Private equity ↗ EXACT TITLE
activebusinesscapitalcategorycontroldescribeddevelopmentexpansionfinancialfinanciallyfinancingfundsgeneralgoalsinvestmentlimitedlong-termmanagementoperationalownership
SHARED TOKENS (30): "active", "business", "capital", "category", "control", "described", "development", "expansion", "financial", "financially", "financing", "funds", "general", "goals", "investment", "limited", "long-term", "management", "operational", "ownership".... | EXACT TITLE in nonprofits_community: "Private equity".
0.500
benefitscasescommunitydistinctformfreegroupjusticepeopleprogramsreceivingreplacerequirementsschoolwork
SHARED TOKENS (15): "benefits", "cases", "community", "distinct", "form", "free", "group", "justice", "people", "programs", "receiving", "replace", "requirements", "school", "work". | EXACT TITLE in nonprofits_community: "Community service". | EXACT TITLE in substance_use_recovery: "Community service".
0.500
agenciesbegancarecasecontactdeliveringdepartmentemergencyfacilitieshistoricallyhospitalleastlevelslifemedicalmembersmodeloperatepatientpersonnel
SHARED TOKENS (37): "agencies", "began", "care", "case", "contact", "delivering", "department", "emergency", "facilities", "historically", "hospital", "least", "levels", "life", "medical", "members", "model", "operate", "patient", "personnel".... | EXACT TITLE in substance_use_recovery: "Emergency medical services".
0.500
academicadaboardboisecampuscanyoncollegecollegescommunitycomprehensivecountiescreditdevelopmenteducationfallgovernedidahonampapopulationprimary
SHARED TOKENS (30): "academic", "ada", "board", "boise", "campus", "canyon", "college", "colleges", "community", "comprehensive", "counties", "credit", "development", "education", "fall", "governed", "idaho", "nampa", "population", "primary".... | EXACT TITLE in nonprofits_community: "College of Western Idaho".
0.500
addressbroadercentersconnectedcriticaldesigndevelopmentdifferentdistincthumanimplyindependentknowledgeleadsmanagementmaterialnecessarilyneednetworkorganization
SHARED TOKENS (37): "address", "broader", "centers", "connected", "critical", "design", "development", "different", "distinct", "human", "imply", "independent", "knowledge", "leads", "management", "material", "necessarily", "need", "network", "organization".... | EXACT TITLE in nonprofits_community: "Sociotechnical system".
0.500
carecausecontrolcreatesdistributionenvironmentalevenhealthhealthcareindividualsinformationmanagementmedicalopportunitiesorganizationspeopleremainsafesystemthem
SHARED TOKENS (22): "care", "cause", "control", "creates", "distribution", "environmental", "even", "health", "healthcare", "individuals", "information", "management", "medical", "opportunities", "organizations", "people", "remain", "safe", "system", "them".... | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
Form 990 ↗ Q22905923 EXACT TITLE
agenciescomprehensiveformgovernmenthealthcarehospitalsinformationnonprofitnonprofitsorganizationorganizationspublicreportingrequirementsrevenuestatus
SHARED TOKENS (16): "agencies", "comprehensive", "form", "government", "healthcare", "hospitals", "information", "nonprofit", "nonprofits", "organization", "organizations", "public", "reporting", "requirements", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 990".
0.500
accessadministrationaffectedapproximatelyaroundcannotcausedependeffectsfallincreasingindividualindividualsindustryinterventionsleadsleastlevelspartlypeople
SHARED TOKENS (33): "access", "administration", "affected", "approximately", "around", "cannot", "cause", "depend", "effects", "fall", "increasing", "individual", "individuals", "industry", "interventions", "leads", "least", "levels", "partly", "people".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.500
Fiduciary ↗ Q537098 EXACT TITLE
actamongapplicablecapacitycareconsentcorporatedepartmentdifferentfaithfinancialfundsgrouphistoricallyinvestmentknowledgelawlegalmanagersobligations
SHARED TOKENS (32): "act", "among", "applicable", "capacity", "care", "consent", "corporate", "department", "different", "faith", "financial", "funds", "group", "historically", "investment", "knowledge", "law", "legal", "managers", "obligations".... | EXACT TITLE in nonprofits_community: "Fiduciary".
0.500
abusecontroldifferenteducationformincreasinginformationlegallylicensemeaningmedicalpatientpotentialprescriptionsufficient
SHARED TOKENS (15): "abuse", "control", "different", "education", "form", "increasing", "information", "legally", "license", "meaning", "medical", "patient", "potential", "prescription", "sufficient". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.500
boardcaldwellcampuscounselingcrisisfamiliesfundinggovernedhouseidahooperatesoperatingprogramprogramsranchservesheltersourcetherapyyouth
SHARED TOKENS (20): "board", "caldwell", "campus", "counseling", "crisis", "families", "funding", "governed", "house", "idaho", "operates", "operating", "program", "programs", "ranch", "serve", "shelter", "source", "therapy", "youth". | EXACT TITLE in nonprofits_community: "Idaho Youth Ranch".
0.480
againstcompetecoveringcreatingdifferentevenincreasemodernmultipleparticipationpatternpatternsrequirespecified
SHARED TOKENS (14): "against", "compete", "covering", "creating", "different", "even", "increase", "modern", "multiple", "participation", "pattern", "patterns", "require", "specified". | EXACT TITLE in nonprofits_community: "Bingo (American version)".
0.480
blockbodyfederalgeneralgovernmentgrantgrantsoversightprogramsregionalrevenuesmallerspecifiedtypes
SHARED TOKENS (14): "block", "body", "federal", "general", "government", "grant", "grants", "oversight", "programs", "regional", "revenue", "smaller", "specified", "types". | EXACT TITLE in nonprofits_community: "Block grant". | EXACT TITLE in substance_use_recovery: "Block grant".
0.480
aloneassistancebeganchildrenearlierfamiliesfamilyhomehomeshouseinstitutionspolicyratherwork
SHARED TOKENS (14): "alone", "assistance", "began", "children", "earlier", "families", "family", "home", "homes", "house", "institutions", "policy", "rather", "work". | EXACT TITLE in nonprofits_community: "Family preservation".
0.480
agenciescapitalcharitablefinancialformsidentificationindividualsnonprofitorganizationsprocessrecentseekingthoughvoluntary
SHARED TOKENS (14): "agencies", "capital", "charitable", "financial", "forms", "identification", "individuals", "nonprofit", "organizations", "process", "recent", "seeking", "though", "voluntary". | EXACT TITLE in nonprofits_community: "Fundraising".
0.460
assistancecannotcharitablechildrenfundedfundshospitalhospitalspeoplepurchaseresearchtreatmentuninsured
SHARED TOKENS (13): "assistance", "cannot", "charitable", "children", "funded", "funds", "hospital", "hospitals", "people", "purchase", "research", "treatment", "uninsured". | EXACT TITLE in nonprofits_community: "Charitable hospital".
0.460
artscommunitydegreedirectequivalenthospitalsmasterpracticepracticesprofessionalqualifyingsocialwork
SHARED TOKENS (13): "arts", "community", "degree", "direct", "equivalent", "hospitals", "master", "practice", "practices", "professional", "qualifying", "social", "work". | EXACT TITLE in nonprofits_community: "Master of Social Work".
0.460
activitiesappointmentformformationinfrastructurelawleadersmeetingneedorganizationorganizationspaymentpractice
SHARED TOKENS (13): "activities", "appointment", "form", "formation", "infrastructure", "law", "leaders", "meeting", "need", "organization", "organizations", "payment", "practice". | EXACT TITLE in nonprofits_community: "Religious organization".
0.460
administrationcodecoveringdepartmentdomesticestatefederallaworganizedrevenuestatutestatutorytitle
SHARED TOKENS (13): "administration", "code", "covering", "department", "domestic", "estate", "federal", "law", "organized", "revenue", "statute", "statutory", "title". | EXACT TITLE in nonprofits_community: "Internal Revenue Code".
0.440
administeredcharitablecreateddistributesfamiliesfinancialindividualindividualsorganizationorganizationsownershippublic
SHARED TOKENS (12): "administered", "charitable", "created", "distributes", "families", "financial", "individual", "individuals", "organization", "organizations", "ownership", "public". | EXACT TITLE in nonprofits_community: "Donor-advised fund".
0.440
Naltrexone ↗ Q409587 EXACT TITLE
amongeffectsfoundlistmedicalmodelpeoplerecommendedsafethemthoughtreatment
SHARED TOKENS (12): "among", "effects", "found", "list", "medical", "model", "people", "recommended", "safe", "them", "though", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.420
AmeriCorps ↗ Q511243 EXACT TITLE
actagencycommunitycreatedgovernmentindependentitselfnationalofficialprogramswork
SHARED TOKENS (11): "act", "agency", "community", "created", "government", "independent", "itself", "national", "official", "programs", "work". | EXACT TITLE in nonprofits_community: "AmeriCorps".
0.420
actcommunityeducationemergencygroupindividuallaborresponsespecializedtrainingwork
SHARED TOKENS (11): "act", "community", "education", "emergency", "group", "individual", "labor", "response", "specialized", "training", "work". | EXACT TITLE in nonprofits_community: "Volunteering".
0.420
activityamongcampusidahoisupercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (11): "activity", "among", "campus", "idaho", "isu", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in nonprofits_community: "Idaho State University". | EXACT TITLE in substance_use_recovery: "Idaho State University".
0.420
Form 1023 ↗ Q30589159 EXACT TITLE
applicationcodeformgovnonprofitnonprofitsorganizationspaperportalrevenuestatus
SHARED TOKENS (11): "application", "code", "form", "gov", "nonprofit", "nonprofits", "organizations", "paper", "portal", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 1023".
0.400
addressingcommunitieseconomicgovernmenthousinginfrastructureprivateprocesspublicrenewal
SHARED TOKENS (10): "addressing", "communities", "economic", "government", "housing", "infrastructure", "private", "process", "public", "renewal". | EXACT TITLE in nonprofits_community: "Urban renewal".
0.400
applycombinescommunitiescommunitycreatedesignededucationalneedsstudentsuses
SHARED TOKENS (10): "apply", "combines", "communities", "community", "create", "designed", "educational", "needs", "students", "uses". | EXACT TITLE in nonprofits_community: "Service-learning".
0.380
agenciesdocumenteddocumentsexpectationsgovernmentinformationpublicrecordstransactions
SHARED TOKENS (9): "agencies", "documented", "documents", "expectations", "government", "information", "public", "records", "transactions". | EXACT TITLE in nonprofits_community: "Public records".
0.380
United Way ↗ Q3050859 EXACT TITLE
individuallargestlocalnetworknonprofitnonprofitsorganizationpublicsingle
SHARED TOKENS (9): "individual", "largest", "local", "network", "nonprofit", "nonprofits", "organization", "public", "single". | EXACT TITLE in nonprofits_community: "United Way".
0.360
Coalition ↗ Q124964 EXACT TITLE
coalitioneconomicformationfrequentlygroupgroupspeoplework
SHARED TOKENS (8): "coalition", "economic", "formation", "frequently", "group", "groups", "people", "work". | EXACT TITLE in nonprofits_community: "Coalition". | EXACT TITLE in substance_use_recovery: "Coalition".
0.340
entityincorporatedlawlegalmakingnonprofitofficial
SHARED TOKENS (7): "entity", "incorporated", "law", "legal", "making", "nonprofit", "official". | EXACT TITLE in nonprofits_community: "Nonprofit corporation".
0.340
Raffle ↗ Q1761269 EXACT TITLE
againstcharitablecompetitionfundspeoplespecificthem
SHARED TOKENS (7): "against", "charitable", "competition", "funds", "people", "specific", "them". | EXACT TITLE in nonprofits_community: "Raffle".
0.340
Relapse ↗ Q2292472 EXACT TITLE
activityformharmindividualsmedicalmultiplerecovery
SHARED TOKENS (7): "activity", "form", "harm", "individuals", "medical", "multiple", "recovery". | EXACT TITLE in substance_use_recovery: "Relapse".
0.320
Trail ↗ Q628179 EXACT TITLE
communitieshistoricallypathrestrictedsmallthough
SHARED TOKENS (6): "communities", "historically", "path", "restricted", "small", "though". | EXACT TITLE in nonprofits_community: "Trail".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare".
0.300
administeredamongbenefitscaseenvironmentalexperiencefunctioningincreasedindividuallifelowermaintenancepeopleprogramsqualityratesreductionretentionsocialtherapy
SHARED TOKENS (21): "administered", "among", "benefits", "case", "environmental", "experience", "functioning", "increased", "individual", "life", "lower", "maintenance", "people", "programs", "quality", "rates", "reduction", "retention", "social", "therapy"....
0.300
accessaffordableannualaroundassessmentassociationcannotcostcostsdepartmentdevelopmentdriversearlyeconomicevenfoodfoundgrantshealthhistorically
SHARED TOKENS (51): "access", "affordable", "annual", "around", "assessment", "association", "cannot", "cost", "costs", "department", "development", "drivers", "early", "economic", "even", "food", "found", "grants", "health", "historically"....
0.300
Food bank ↗ Q113603 KW CROSS HIGH
activeadministrationassistancebegancasescharitablecommunitiescommunityconditionscostscreatecrisisdependdirectlydistributioneconomicemergencyestablishedevenexperience
SHARED TOKENS (40): "active", "administration", "assistance", "began", "cases", "charitable", "communities", "community", "conditions", "costs", "create", "crisis", "depend", "directly", "distribution", "economic", "emergency", "established", "even", "experience"....
0.300
aroundbegancannotcarecliniciansdependentdirecteducationalhealthhealthcareleastmedicalmodelplanspracticepractitionerpresentprincipalproviderproviders
SHARED TOKENS (31): "around", "began", "cannot", "care", "clinicians", "dependent", "direct", "educational", "health", "healthcare", "least", "medical", "model", "plans", "practice", "practitioner", "present", "principal", "provider", "providers"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaroundbehavioralcasesclinicalclinicscommunitycontextdifferentdisabilityearlyfunctioningfunctionshealthhospitalsincreaseindividualinterventionsmajormaking
SHARED TOKENS (37): "affect", "around", "behavioral", "cases", "clinical", "clinics", "community", "context", "different", "disability", "early", "functioning", "functions", "health", "hospitals", "increase", "individual", "interventions", "major", "making"....
0.300
activitiesapplyauthorityauthorizedbenefitsboardbriefcapacitycaseschildclinicalconditionsconsentdecisionsdisabilityevidenceforceformfreehealthcare
SHARED TOKENS (56): "activities", "apply", "authority", "authorized", "benefits", "board", "brief", "capacity", "cases", "child", "clinical", "conditions", "consent", "decisions", "disability", "evidence", "force", "form", "free", "healthcare"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actactivitiesadmissionsaffordablebecomecarecasescontractingcontrolscostcostsdeliveringearlyeconomicformsgrouphealthhealthcareimpactimplementation
SHARED TOKENS (40): "act", "activities", "admissions", "affordable", "become", "care", "cases", "contracting", "controls", "cost", "costs", "delivering", "early", "economic", "forms", "group", "health", "healthcare", "impact", "implementation"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activityadultscannotcarecasechildrenclientsearlyfacilitiesfacilityfamiliesfamilygrouphealthhomehomeshourshouseindividualsleast
SHARED TOKENS (32): "activity", "adults", "cannot", "care", "case", "children", "clients", "early", "facilities", "facility", "families", "family", "group", "health", "home", "homes", "hours", "house", "individuals", "least"....
0.300
Cocaine ↗ Q41576 KW CROSS HIGH
abuseadministrationaffectbegancausecentralcompetecontrolcostdevelopmenteffectsexposuregroupshistoricallyincreasedleastlegallimitedlocalmarket
SHARED TOKENS (36): "abuse", "administration", "affect", "began", "cause", "central", "compete", "control", "cost", "development", "effects", "exposure", "groups", "historically", "increased", "least", "legal", "limited", "local", "market"....
0.300
activitiescharitablechildrencodecompetitioneducationalfederalindividualslawnonprofitorganizationorganizationsprimarypublicrequirementsrevenuesafety
SHARED TOKENS (17): "activities", "charitable", "children", "code", "competition", "educational", "federal", "individuals", "law", "nonprofit", "organization", "organizations", "primary", "public", "requirements", "revenue", "safety".
0.300
Mutual aid ↗ KW CROSS HIGH
accessbarriersbeyondchangingcommunitiescommunityconditionsdistincteconomiceducationexchangeexecutivefoodformfoundgrantgroupgroupsleadershipmaterial
SHARED TOKENS (35): "access", "barriers", "beyond", "changing", "communities", "community", "conditions", "distinct", "economic", "education", "exchange", "executive", "food", "form", "found", "grant", "group", "groups", "leadership", "material"....
0.300
accessactivebodyburdencapacitycommunitycreateeducationenforcementhealthhealthcarehumanimpactincreasedincreasinglymeasurespreventionproblemprotectionquality
SHARED TOKENS (35): "access", "active", "body", "burden", "capacity", "community", "create", "education", "enforcement", "health", "healthcare", "human", "impact", "increased", "increasingly", "measures", "prevention", "problem", "protection", "quality"....
0.300
actcareconfidentialitydegreedisclosureelectronicemployersfacilityhealthincreaseinstitutionsinsurancemaintainingmanagementmedicalmodernpatientpeoplepracticeproviders
SHARED TOKENS (24): "act", "care", "confidentiality", "degree", "disclosure", "electronic", "employers", "facility", "health", "increase", "institutions", "insurance", "maintaining", "management", "medical", "modern", "patient", "people", "practice", "providers"....
0.300
activityadvocacyagencybecomebodiesexecutivefederalformfreegovernancegovernmentgroupsincreasingincreasinglyindependentindustryinfluencelocalmembersmunicipal
SHARED TOKENS (35): "activity", "advocacy", "agency", "become", "bodies", "executive", "federal", "form", "free", "governance", "government", "groups", "increasing", "increasingly", "independent", "industry", "influence", "local", "members", "municipal"....
0.300
behavioralconditionscounselingdependencyfinancialgeneralgroupslegalmedicalparticipationpatientpeopleprescriptionpresentprocessprofessionalsrecoveryrehabilitationsocialtrained
SHARED TOKENS (21): "behavioral", "conditions", "counseling", "dependency", "financial", "general", "groups", "legal", "medical", "participation", "patient", "people", "prescription", "present", "process", "professionals", "recovery", "rehabilitation", "social", "trained"....
0.300
abuseactadministrationagainstagenciesagencyassociationauthorityauthorizedcommunitycompletecomprehensiveconsolidationcontrolcontrolledcreatesdatadepartmentdeterminesdistribution
SHARED TOKENS (69): "abuse", "act", "administration", "against", "agencies", "agency", "association", "authority", "authorized", "community", "complete", "comprehensive", "consolidation", "control", "controlled", "creates", "data", "department", "determines", "distribution"....
0.300
administeredavailabilitydifferdifferentenforcementformfutureinterventionjusticelawoperationsprogramrehabilitationsystemsystems
SHARED TOKENS (15): "administered", "availability", "differ", "different", "enforcement", "form", "future", "intervention", "justice", "law", "operations", "program", "rehabilitation", "system", "systems".
0.300
Heroin ↗ Q60168 KW CROSS HIGH
administrationamongapproximatelyaroundbehavioralclinicalcontextcontrolledeffectsformfunctionhistoryhoursincreasedlicenselong-termpeoplepercentpointpossess
SHARED TOKENS (26): "administration", "among", "approximately", "around", "behavioral", "clinical", "context", "controlled", "effects", "form", "function", "history", "hours", "increased", "license", "long-term", "people", "percent", "point", "possess"....
0.300
adaboisecanyoncountieselmoregemhomeidaholargestmetropolitannampaowyheepayettepercentpopulationtreasurevalley
SHARED TOKENS (17): "ada", "boise", "canyon", "counties", "elmore", "gem", "home", "idaho", "largest", "metropolitan", "nampa", "owyhee", "payette", "percent", "population", "treasure", "valley".
0.300
accountingadministrationagenciesagencyamongapplicantscarecommercialdifferentenvironmentalfederalgovernmenthealthindividualindividualsindustrylicenselicensedlicenseslicensure
SHARED TOKENS (38): "accounting", "administration", "agencies", "agency", "among", "applicants", "care", "commercial", "different", "environmental", "federal", "government", "health", "individual", "individuals", "industry", "license", "licensed", "licenses", "licensure"....
0.300
ageassociationbehavioralclinicianscurrentdifferenteffectsfamilyformsgrouphealthhistoryhomeincreasedindividuallivinglong-termmedicalmeetingpeer
SHARED TOKENS (36): "age", "association", "behavioral", "clinicians", "current", "different", "effects", "family", "forms", "group", "health", "history", "home", "increased", "individual", "living", "long-term", "medical", "meeting", "peer"....
0.300
Charity shop ↗ Q153551 KW CROSS HIGH
buildingbusinesscharitablecostsfeesfreelimitedmaintenancemunicipaloperatingorganizationpaidpublicpurchasepurposesocialstated
SHARED TOKENS (17): "building", "business", "charitable", "costs", "fees", "free", "limited", "maintenance", "municipal", "operating", "organization", "paid", "public", "purchase", "purpose", "social", "stated".
0.300
administeredagencyamongassociationbenefitsbusinesscarecasecentralcommunitycontractcostscoveragecoveredcoveringdefineddisabilityentityevidencegovernment
SHARED TOKENS (39): "administered", "agency", "among", "association", "benefits", "business", "care", "case", "central", "community", "contract", "costs", "coverage", "covered", "covering", "defined", "disability", "entity", "evidence", "government"....
0.300
alonecategorydependencydependentgrouphomelessnessincreasedindividualsitselfmakingneedspeopleprimaryproblemsratesrestrictedsingle
SHARED TOKENS (17): "alone", "category", "dependency", "dependent", "group", "homelessness", "increased", "individuals", "itself", "making", "needs", "people", "primary", "problems", "rates", "restricted", "single".
0.300
Trauma-informed care ↗ KW CROSS HIGH
architecturebodybroadcarecreatingeducationeffectsexposureframeworkhealthhumanimpactindividualsinformationlawmodelneedorganizationspatternspeople
SHARED TOKENS (31): "architecture", "body", "broad", "care", "creating", "education", "effects", "exposure", "framework", "health", "human", "impact", "individuals", "information", "law", "model", "need", "organizations", "patterns", "people"....
0.300
associationbodybusinesscontextdepartmentsemploymententerenvironmentalformfunctiongovernmentgroupgroupsincorporatedindividualsleastlocalmembersnecessarilyneed
SHARED TOKENS (35): "association", "body", "business", "context", "departments", "employment", "enter", "environmental", "form", "function", "government", "group", "groups", "incorporated", "individuals", "least", "local", "members", "necessarily", "need"....
0.300
accessadministersadministrationappropriationsboardcreatedestablishedfiscalfundedfundingimplementindependentjusticelargestlawlegalmembersnonprofitofficeofficers
SHARED TOKENS (33): "access", "administers", "administration", "appropriations", "board", "created", "established", "fiscal", "funded", "funding", "implement", "independent", "justice", "largest", "law", "legal", "members", "nonprofit", "office", "officers"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisapplicationappropriateassessmentbetterclinicalconditionsdatadecisionsdefineddescriptiondesigndistinctiondistributioneffectsenvironmentalexposurefunctiongeneral
SHARED TOKENS (50): "among", "analysis", "application", "appropriate", "assessment", "better", "clinical", "conditions", "data", "decisions", "defined", "description", "design", "distinction", "distribution", "effects", "environmental", "exposure", "function", "general"....
0.300
Public art ↗ Q557141 KW CROSS HIGH
absencecommercialcreatedcriticaldirectformfunctiongeneralindependentmaintenancemeaningmediaofficialoutsidephysicallyprivateprocessprocurementprofessionalpublic
SHARED TOKENS (25): "absence", "commercial", "created", "critical", "direct", "form", "function", "general", "independent", "maintenance", "meaning", "media", "official", "outside", "physically", "private", "process", "procurement", "professional", "public"....
0.300
Civil society ↗ Q181865 KW CROSS HIGH
aggregateamongbusinesscentralcivicdistinctfamilygeneralgovernmentindependentindividualsinstitutionsorganizationsprivatesectorsociety
SHARED TOKENS (16): "aggregate", "among", "business", "central", "civic", "distinct", "family", "general", "government", "independent", "individuals", "institutions", "organizations", "private", "sector", "society".
0.300
academicacquisitionapplicationapplicationscarecontextdatadesigndevelopmentdomainembeddedhealthhealthcarehospitalsimplementationinformationinstitutionsmanagementmedicalpatient
SHARED TOKENS (25): "academic", "acquisition", "application", "applications", "care", "context", "data", "design", "development", "domain", "embedded", "health", "healthcare", "hospitals", "implementation", "information", "institutions", "management", "medical", "patient"....
0.300
actadministrativeauthorizedcarecasesconcerningconfidentialityconsentcoveragecoveredelectronicemployersentityfamiliesfamilyfederalgrouphealthhealthcareindividuals
SHARED TOKENS (42): "act", "administrative", "authorized", "care", "cases", "concerning", "confidentiality", "consent", "coverage", "covered", "electronic", "employers", "entity", "families", "family", "federal", "group", "health", "healthcare", "individuals"....
0.300
School meal ↗ Q1195832 KW CROSS HIGH
addressadultsaggregateamongaroundbarriersbecomebenefitschildrencoveragecrisisdomesticeducationfoodlargestlocalnetprimaryprogramsreduce
SHARED TOKENS (30): "address", "adults", "aggregate", "among", "around", "barriers", "become", "benefits", "children", "coverage", "crisis", "domestic", "education", "food", "largest", "local", "net", "primary", "programs", "reduce"....
0.300
accessactivitiesactivitybroadcompetitioncreateddegreedemandenvironmentfacilitiesfreegeneralindividualnecessarilyorganizedoutsidepopulationratherrenewalrisk
SHARED TOKENS (21): "access", "activities", "activity", "broad", "competition", "created", "degree", "demand", "environment", "facilities", "free", "general", "individual", "necessarily", "organized", "outside", "population", "rather", "renewal", "risk"....
0.300
affordableapproximatelyassistanceblockcreatedepartmentdesigneddevelopmentexclusivelyfamiliesfederalgranthomehousingidentificationinvestmentlargestlocaloperatingprogram
SHARED TOKENS (22): "affordable", "approximately", "assistance", "block", "create", "department", "designed", "development", "exclusively", "families", "federal", "grant", "home", "housing", "identification", "investment", "largest", "local", "operating", "program"....
0.300
carecoordinationhealthmedicalneedspatientplanspracticepractitionerpreventionproviderregisteredtrainedtrainingtreatment
SHARED TOKENS (15): "care", "coordination", "health", "medical", "needs", "patient", "plans", "practice", "practitioner", "prevention", "provider", "registered", "trained", "training", "treatment".
0.300
accessaffordableanalysischildrencomprehensivecostcostscrisisdatadocumentedeconomicestablishedevictionfederalgovernmenthealthhistoricallyhistoryhomelessnesshousing
SHARED TOKENS (39): "access", "affordable", "analysis", "children", "comprehensive", "cost", "costs", "crisis", "data", "documented", "economic", "established", "eviction", "federal", "government", "health", "historically", "history", "homelessness", "housing"....
0.300
activityadultsaffectedagainstamongcentralcontainingcontainsdistincteffectsgrouphealthincreasedindustrylegallong-termnewsopportunityorganizationpoint
SHARED TOKENS (28): "activity", "adults", "affected", "against", "among", "central", "containing", "contains", "distinct", "effects", "group", "health", "increased", "industry", "legal", "long-term", "news", "opportunity", "organization", "point"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
abuseadministeradministeredadministrationaffectamongapproximatelybegancausecentraldirectlyeffectsfamilyfoundfrequentlyhealthhoursincreaselaborlist
SHARED TOKENS (30): "abuse", "administer", "administered", "administration", "affect", "among", "approximately", "began", "cause", "central", "directly", "effects", "family", "found", "frequently", "health", "hours", "increase", "labor", "list"....
0.300
abusebehavioralexpandedexperiencefinancialformframeworkidentifiedimplyindividualmodernprocessratherrelatedrisksocialsolelysystem
SHARED TOKENS (18): "abuse", "behavioral", "expanded", "experience", "financial", "form", "framework", "identified", "imply", "individual", "modern", "process", "rather", "related", "risk", "social", "solely", "system".
0.300
abuseagenciesauthorizedboardscarecontrolleddatadatabasedistributeselectronicenforcementestablishedevidenceexperiencingfederallyhealthidentifyingincreasedlawlicensing
SHARED TOKENS (38): "abuse", "agencies", "authorized", "boards", "care", "controlled", "data", "database", "distributes", "electronic", "enforcement", "established", "evidence", "experiencing", "federally", "health", "identifying", "increased", "law", "licensing"....
0.300
absenceaddressadvocacyaroundassociationauthoritycapitalciviccommunitiescommunitycontextdefineddegreedevelopmentengagementgovernancehousingintegrationlegallinks
SHARED TOKENS (44): "absence", "address", "advocacy", "around", "association", "authority", "capital", "civic", "communities", "community", "context", "defined", "degree", "development", "engagement", "governance", "housing", "integration", "legal", "links"....
0.300
analysiscareclinicalcurrentdatadecisionsevidenceexperienceguidehealthhealthcarehumanindividualinformationleastmakingmanagementmeanspatientpractice
SHARED TOKENS (24): "analysis", "care", "clinical", "current", "data", "decisions", "evidence", "experience", "guide", "health", "healthcare", "human", "individual", "information", "least", "making", "management", "means", "patient", "practice"....
0.300
addressingadministeredauthorizedconcerningconsentcreateddepartmenteducationexecutivefederalfundinggeneralgovernmenthealthhealthcarehumanmattersmedicalmissionprimary
SHARED TOKENS (26): "addressing", "administered", "authorized", "concerning", "consent", "created", "department", "education", "executive", "federal", "funding", "general", "government", "health", "healthcare", "human", "matters", "medical", "mission", "primary"....
0.300
Municipality ↗ Q15284 KW CROSS HIGH
administrativebodycommunitiescontractcorporatedistrictdivisionearlyexchangegoverninggovernmentlimitedlocalnationalplaceregionalsinglesmallsocialstatus
SHARED TOKENS (20): "administrative", "body", "communities", "contract", "corporate", "district", "division", "early", "exchange", "governing", "government", "limited", "local", "national", "place", "regional", "single", "small", "social", "status".
0.300
Parole ↗ Q5357120 KW CROSS HIGH
behavioralcomplianceconditionscreditsearlyformofficersoriginatingoutsidepaperpeopleplaceratherservingsupervisedsupervisionsystem
SHARED TOKENS (17): "behavioral", "compliance", "conditions", "credits", "early", "form", "officers", "originating", "outside", "paper", "people", "place", "rather", "serving", "supervised", "supervision", "system".
0.300
conditionsenvironmentfacilitieshomeshousehouseshousinglivingpeopleprogramprogramsrecoveryrehabilitationsafeservesocietysupportive
SHARED TOKENS (17): "conditions", "environment", "facilities", "homes", "house", "houses", "housing", "living", "people", "program", "programs", "recovery", "rehabilitation", "safe", "serve", "society", "supportive".
0.300
actcommunitiescrisisfederalhistorylargestlawmedicalpdfpreventionrecoverysinglesupporttexttreatment
SHARED TOKENS (15): "act", "communities", "crisis", "federal", "history", "largest", "law", "medical", "pdf", "prevention", "recovery", "single", "support", "text", "treatment".
0.300
actactivitiesaddressapproximatelyassociationcentersconsumercontroldefineddepartmentdevelopmentdirectlyeconomicentityevenformalfundinggovernmentgroupgroups
SHARED TOKENS (47): "act", "activities", "address", "approximately", "association", "centers", "consumer", "control", "defined", "department", "development", "directly", "economic", "entity", "even", "formal", "funding", "government", "group", "groups"....
0.300
accessactivitiesadministrationagencyannouncedassociationcapacitycenterscontroldepartmentdesigneddisabilityeducationalenvironmentalfederalfoodgovernmenthealthhumanindependence
SHARED TOKENS (44): "access", "activities", "administration", "agency", "announced", "association", "capacity", "centers", "control", "department", "designed", "disability", "educational", "environmental", "federal", "food", "government", "health", "human", "independence"....
0.300
accesscarecentercenterscentralclientsclinicscommunitycoveredexpandedfamilygeneralgrouphealthhealthcarelivinglocalnetworkpeopleplanning
SHARED TOKENS (25): "access", "care", "center", "centers", "central", "clients", "clinics", "community", "covered", "expanded", "family", "general", "group", "health", "healthcare", "living", "local", "network", "people", "planning"....
0.300
Community art ↗ Q2801695 KW CROSS HIGH
actartscenterscommunitiescommunitycommunity-basedcorporatecreateddefineddistrictformlocalmediamembersnationalnetworksorganizationsparticipationpracticeprofessional
SHARED TOKENS (25): "act", "arts", "centers", "communities", "community", "community-based", "corporate", "created", "defined", "district", "form", "local", "media", "members", "national", "networks", "organizations", "participation", "practice", "professional"....
0.300
buildingdecisionsidahojusticepresent
SHARED TOKENS (5): "building", "decisions", "idaho", "justice", "present". | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
0.300
accessaddressaffectingalonebarriersbenefitsbettercannotconditionscontrolcreatecurrentdesigneddisabilityeffectsevenexperienceexperiencingextendsformal
SHARED TOKENS (45): "access", "address", "affecting", "alone", "barriers", "benefits", "better", "cannot", "conditions", "control", "create", "current", "designed", "disability", "effects", "even", "experience", "experiencing", "extends", "formal"....
0.300
actaffordableageapplicantsbenefitsbudgetcannotcareconditionscostscoveragecoverededucationeligibilityexpandedexpansionfederalforcefoundfunded
SHARED TOKENS (63): "act", "affordable", "age", "applicants", "benefits", "budget", "cannot", "care", "conditions", "costs", "coverage", "covered", "education", "eligibility", "expanded", "expansion", "federal", "force", "found", "funded"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthorityauthorizedbecomecasecauseconditionsevenevidenceforceformsgovernmentharmhumanimplyitselflawnecessarilypeopleplace
SHARED TOKENS (27): "against", "authority", "authorized", "become", "case", "cause", "conditions", "even", "evidence", "force", "forms", "government", "harm", "human", "imply", "itself", "law", "necessarily", "people", "place"....
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
acceptanceadultsageauthoritybroadcapacitycausechildchildrenconcerningcontextcreatedatadependencydevelopmentdifferearlyfurthergeneralharm
SHARED TOKENS (48): "acceptance", "adults", "age", "authority", "broad", "capacity", "cause", "child", "children", "concerning", "context", "create", "data", "dependency", "development", "differ", "early", "further", "general", "harm"....
0.300
abuseactiveactivityamongavailabilitybeyondcentralcontrolleddistributioneffectsformsfreefunctionhumanincreaseinjuryinvolvingliabilityplacementpossess
SHARED TOKENS (33): "abuse", "active", "activity", "among", "availability", "beyond", "central", "controlled", "distribution", "effects", "forms", "free", "function", "human", "increase", "injury", "involving", "liability", "placement", "possess"....
0.300
affectaffectingageamongexplicitlyformfundinggroupgroupshousinglandlordmarketpatternsplacepotentialsourcestatustreatment
SHARED TOKENS (18): "affect", "affecting", "age", "among", "explicitly", "form", "funding", "group", "groups", "housing", "landlord", "market", "patterns", "place", "potential", "source", "status", "treatment".
0.300
associationblockcategorycreatedcrisiscurrentdepartmentfinancialgovernmentincorporatedlaterlocalmajorofficeperformanceprogrammingreceivedreceivingresponsesubsequent
SHARED TOKENS (21): "association", "block", "category", "created", "crisis", "current", "department", "financial", "government", "incorporated", "later", "local", "major", "office", "performance", "programming", "received", "receiving", "response", "subsequent"....
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
actionaffectedbecomecriticalelectronicharmhealthidentificationidentifyingimplementinformationlaterlegallylocalnationalpeoplepossessionprogramspublicrecent
SHARED TOKENS (33): "action", "affected", "become", "critical", "electronic", "harm", "health", "identification", "identifying", "implement", "information", "later", "legally", "local", "national", "people", "possession", "programs", "public", "recent"....
0.300
activitiesadultsaffectedaffordableapplicationcarecausechildrencostcounselingdecisionsdisabilityeducationenvironmentalevenhealthhealthcarehomeidentifyincrease
SHARED TOKENS (40): "activities", "adults", "affected", "affordable", "application", "care", "cause", "children", "cost", "counseling", "decisions", "disability", "education", "environmental", "even", "health", "healthcare", "home", "identify", "increase"....
0.300
acquisitionactactivitybusinesscapitalcentralcompetitionconsolidatedconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityexpandfederalgoverned
SHARED TOKENS (44): "acquisition", "act", "activity", "business", "capital", "central", "competition", "consolidated", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "expand", "federal", "governed"....
0.300
actanalysisapplicationauthoritybecomebiascannotcasescategorycreatedatadecisionsdescribesdesigndifferententerevenexpandexpectationsforms
SHARED TOKENS (56): "act", "analysis", "application", "authority", "become", "bias", "cannot", "cases", "category", "create", "data", "decisions", "describes", "design", "different", "enter", "even", "expand", "expectations", "forms"....
0.300
activitiesclientscommunitiescommunitydifferentgrouphousesincreasinglylivinglong-termpathpatientpracticalproblemsrehabilitationresidentialtherapiststherapytreatmentunits
SHARED TOKENS (20): "activities", "clients", "communities", "community", "different", "group", "houses", "increasingly", "living", "long-term", "path", "patient", "practical", "problems", "rehabilitation", "residential", "therapists", "therapy", "treatment", "units".
0.300
Art therapy ↗ Q928865 KW CROSS HIGH
approximatelyartsassessmentcasesclientclientsclinicalcontrolcouncildifferentdistinctevidencefoundfunctionhealthlifemeaningmedianationalpaper
SHARED TOKENS (34): "approximately", "arts", "assessment", "cases", "client", "clients", "clinical", "control", "council", "different", "distinct", "evidence", "found", "function", "health", "life", "meaning", "media", "national", "paper"....
0.300
addressassociationbehavioralcannotcodecontrolexamininglifemakingmemberorganizationsproblemsprocessprogramprogramspublishedrecoverysupportingtwelve
SHARED TOKENS (19): "address", "association", "behavioral", "cannot", "code", "control", "examining", "life", "making", "member", "organizations", "problems", "process", "program", "programs", "published", "recovery", "supporting", "twelve".
0.300
abuseapplybehavioralfederalgovernmenthealthindividualknowledgemissionnationalpublicresearchsocialstudysupplywhose
SHARED TOKENS (16): "abuse", "apply", "behavioral", "federal", "government", "health", "individual", "knowledge", "mission", "national", "public", "research", "social", "study", "supply", "whose".
0.300
causeconsentcontroldatadifferentdigitaldisclosureforminformationlegalprotectionpublicrelationshiptechnologythemtypesuses
SHARED TOKENS (17): "cause", "consent", "control", "data", "different", "digital", "disclosure", "form", "information", "legal", "protection", "public", "relationship", "technology", "them", "types", "uses".
0.300
administrationaroundbuildingcapitalcontractcontractingcostcostsdevelopmentevidencefinancialfinancingfundinggovernmenthospitalsincreasinginfrastructureinstitutionsinvestmentlong-term
SHARED TOKENS (40): "administration", "around", "building", "capital", "contract", "contracting", "cost", "costs", "development", "evidence", "financial", "financing", "funding", "government", "hospitals", "increasing", "infrastructure", "institutions", "investment", "long-term"....
0.300
administrationassistancebenefitsdepartmentdisabilityeducationalhealthcarehomeinjuryinsurancelivingmedicaloccupationalpersonnelsocialveterans
SHARED TOKENS (16): "administration", "assistance", "benefits", "department", "disability", "educational", "healthcare", "home", "injury", "insurance", "living", "medical", "occupational", "personnel", "social", "veterans".
0.300
administrationagencyassistancebenefitscasecentersclinicscostcostsdepartmentdisabilityeducationeligibleemergencyestablishedexecutiveexpandedfacilitiesfamilyfederal
SHARED TOKENS (40): "administration", "agency", "assistance", "benefits", "case", "centers", "clinics", "cost", "costs", "department", "disability", "education", "eligible", "emergency", "established", "executive", "expanded", "facilities", "family", "federal"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalfinancinggovernmenthomehousehousingmemberprogramreportssociety
SHARED TOKENS (17): "administers", "agency", "department", "departments", "development", "directly", "executive", "federal", "financing", "government", "home", "house", "housing", "member", "program", "reports", "society".
0.300
affordabilityagainstamongauthorityavailabilitybegancasesdistrictearlyeconomicenvironmentalexplicitlyhomelessnesshomeshouseshousingincreaselocallowermajor
SHARED TOKENS (37): "affordability", "against", "among", "authority", "availability", "began", "cases", "district", "early", "economic", "environmental", "explicitly", "homelessness", "homes", "houses", "housing", "increase", "local", "lower", "major"....
0.300
actadaagainstbroadbusinesscoalitioncostscouncilcovereddisabilityemployersfinalhouseidentityindividualslaterlawnationalprotectionpublic
SHARED TOKENS (24): "act", "ada", "against", "broad", "business", "coalition", "costs", "council", "covered", "disability", "employers", "final", "house", "identity", "individuals", "later", "law", "national", "protection", "public"....
0.300
activityaffectaffectingagainstbecomebenefitsclientsconcerningconditionscontextcreatecreatesdecisionsdirectdisclosureestablishedevidenceexperiencefamilyfinancial
SHARED TOKENS (55): "activity", "affect", "affecting", "against", "become", "benefits", "clients", "concerning", "conditions", "context", "create", "creates", "decisions", "direct", "disclosure", "established", "evidence", "experience", "family", "financial"....
0.300
Digital divide ↗ Q244752 KW CROSS HIGH
accessageapplycommunitiesconnectdatadigitaleducationalgroupshousinginformationinternetlimitedlivingmaterialmediaopportunitiespeoplereliableresources
SHARED TOKENS (26): "access", "age", "apply", "communities", "connect", "data", "digital", "educational", "groups", "housing", "information", "internet", "limited", "living", "material", "media", "opportunities", "people", "reliable", "resources"....
0.300
administrationassessmentbehavioralcentralclinicalcliniciansdevelopmentdifferenteducationalequivalentfamilyhealthhumanidahoincreaseintegrationknowledgemastermedicalmodel
SHARED TOKENS (38): "administration", "assessment", "behavioral", "central", "clinical", "clinicians", "development", "different", "educational", "equivalent", "family", "health", "human", "idaho", "increase", "integration", "knowledge", "master", "medical", "model"....
0.300
aroundauthorizedbudgetcapturecommunitydefineddevelopmentdirectlydistricteconomicfinancingfutureinfrastructureinvestmentneedprivateprogrampublicrelatedrevenue
SHARED TOKENS (20): "around", "authorized", "budget", "capture", "community", "defined", "development", "directly", "district", "economic", "financing", "future", "infrastructure", "investment", "need", "private", "program", "public", "related", "revenue".
0.300
administeredadministrativeaffordableagenciesagencyallocationassistanceauthoritycentralcontractdepartmentdevelopmentdifferentdirectlydistinctexchangefamiliesformgoalsgovernment
SHARED TOKENS (41): "administered", "administrative", "affordable", "agencies", "agency", "allocation", "assistance", "authority", "central", "contract", "department", "development", "different", "directly", "distinct", "exchange", "families", "form", "goals", "government"....
0.300
administeredadministersagencyapproximatelyassistancebudgetcommercialcommunitiescurrentdepartmentdirectlyexecutivefederalfoodgovernmentlargestmembernationalneedsproduction
SHARED TOKENS (26): "administered", "administers", "agency", "approximately", "assistance", "budget", "commercial", "communities", "current", "department", "directly", "executive", "federal", "food", "government", "largest", "member", "national", "needs", "production"....
0.300
behavioralcommunityestablishedfreegroupsinternetmedicalmodelorganizationpeerpeopleprofessionalprofessionalspsychologyrecoveryseekingsupporttherapytrainedtraining
SHARED TOKENS (20): "behavioral", "community", "established", "free", "groups", "internet", "medical", "model", "organization", "peer", "people", "professional", "professionals", "psychology", "recovery", "seeking", "support", "therapy", "trained", "training".
0.300
abusearchitecturearoundbarriersdifferentdisabilityeducationemployersemploymentenvironmentfunctionsgoalshousingindependentindividualsinstitutionallegallivingmultipleopportunities
SHARED TOKENS (27): "abuse", "architecture", "around", "barriers", "different", "disability", "education", "employers", "employment", "environment", "functions", "goals", "housing", "independent", "individuals", "institutional", "legal", "living", "multiple", "opportunities"....
0.300
actadministeredagainstagenciesapplicantsapproximatelyassistancebenefitschildrencodedepartmentdevelopmentfairfamilieshousingindividualslandlordlocallocallymajor
SHARED TOKENS (35): "act", "administered", "against", "agencies", "applicants", "approximately", "assistance", "benefits", "children", "code", "department", "development", "fair", "families", "housing", "individuals", "landlord", "local", "locally", "major"....
0.300
actadministeradministersadministrationadministrativeagencycarecenterscertificationchildrenclinicaldepartmentfacilitiesfederalfinancinggovhealthhealthcarehomehomes
SHARED TOKENS (32): "act", "administer", "administers", "administration", "administrative", "agency", "care", "centers", "certification", "children", "clinical", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "homes"....
0.300
actcapitalcreateddesignationdesignedeconomicfundsimpactinvestmentleastloweroperateopportunityoutcomesprogramqualified
SHARED TOKENS (16): "act", "capital", "created", "designation", "designed", "economic", "funds", "impact", "investment", "least", "lower", "operate", "opportunity", "outcomes", "program", "qualified".
0.300
actadministeredadministrationagenciesappearcurrentdepartmentdepartmentsdomesticearlyestablishedexecutivefederalfinancialfiscalgovernmentinstitutionslicenseslimitedmajor
SHARED TOKENS (32): "act", "administered", "administration", "agencies", "appear", "current", "department", "departments", "domestic", "early", "established", "executive", "federal", "financial", "fiscal", "government", "institutions", "licenses", "limited", "major"....
0.300
accessaddressesaffectbeganboardcarecostcostsdeliveringfinancinghealthhealthcareindividualsinformationinstitutionsknowledgelifemedicalorganizationorganizational
SHARED TOKENS (38): "access", "addresses", "affect", "began", "board", "care", "cost", "costs", "delivering", "financing", "health", "healthcare", "individuals", "information", "institutions", "knowledge", "life", "medical", "organization", "organizational"....
0.300
actassociationauthorityauthorizedbodycampaignscovereddemanddepartmentearlierformationfundsincreasingindustryinformationmarketmarketsmechanismorganizationsposition
SHARED TOKENS (26): "act", "association", "authority", "authorized", "body", "campaigns", "covered", "demand", "department", "earlier", "formation", "funds", "increasing", "industry", "information", "market", "markets", "mechanism", "organizations", "position"....
0.300
adaboisecentercentralconnectedcontainsidahoitselfmetropolitannationalpopulationranchruralvalleywestern
SHARED TOKENS (15): "ada", "boise", "center", "central", "connected", "contains", "idaho", "itself", "metropolitan", "national", "population", "ranch", "rural", "valley", "western".
0.300
actionagainstagencycampaignscasecausecenterconsumercorporatedatadatabasedecisionsdegreeeligibilityfederalfinancingfoundfundedfundingfunds
SHARED TOKENS (54): "action", "against", "agency", "campaigns", "case", "cause", "center", "consumer", "corporate", "data", "database", "decisions", "degree", "eligibility", "federal", "financing", "found", "funded", "funding", "funds"....
0.300
buildcomcommunitiescommunityconsumerevenexchangeexperiencefoundinformationinternetmembersphysicallyprogramprovidingprovisionsrelatedrolesignificantsupport
SHARED TOKENS (24): "build", "com", "communities", "community", "consumer", "even", "exchange", "experience", "found", "information", "internet", "members", "physically", "program", "providing", "provisions", "related", "role", "significant", "support"....
0.300
abuseadministrationannouncedavailabilitybuildingcostdepartmentdirectlydisabilityhealthhumanoutsidequalityreducereportssocietytreatment
SHARED TOKENS (17): "abuse", "administration", "announced", "availability", "building", "cost", "department", "directly", "disability", "health", "human", "outside", "quality", "reduce", "reports", "society", "treatment".
0.300
amongcharitablecommunity-basedfoodgovernmenthomehomeshospitalsindividualsinsecuritylifeneedorganizationprogramprogramspurchasequalityreduceresearch
SHARED TOKENS (19): "among", "charitable", "community-based", "food", "government", "home", "homes", "hospitals", "individuals", "insecurity", "life", "need", "organization", "program", "programs", "purchase", "quality", "reduce", "research".
0.300
abuseactadministrationannouncedappropriationsauthorizedavailabilitybuildcommunitycomprehensiveeducationfederalfundinggrantshealthincreaselawmajornetworksorganizations
SHARED TOKENS (27): "abuse", "act", "administration", "announced", "appropriations", "authorized", "availability", "build", "community", "comprehensive", "education", "federal", "funding", "grants", "health", "increase", "law", "major", "networks", "organizations"....
0.300
businesscaredefinesdepartmentfacilityhealthhumanindividualinsurancelicensedmedicalorganizationpaidprofessionalproviderproviderstreatment
SHARED TOKENS (17): "business", "care", "defines", "department", "facility", "health", "human", "individual", "insurance", "licensed", "medical", "organization", "paid", "professional", "provider", "providers", "treatment".
0.300
beyondchangingcommunitycontinuumdependencydevelopmentdifferenteffectsevenexplicitlygoalshealthhopeindividualslifelimitationslivingmeaningmeasuresmodel
SHARED TOKENS (37): "beyond", "changing", "community", "continuum", "dependency", "development", "different", "effects", "even", "explicitly", "goals", "health", "hope", "individuals", "life", "limitations", "living", "meaning", "measures", "model"....
0.300
administrationaffectcasescauseconditionsdifferentevenformgroupincreasedindividualslegalmedicalprescriptionratherrolethemupon
SHARED TOKENS (18): "administration", "affect", "cases", "cause", "conditions", "different", "even", "form", "group", "increased", "individuals", "legal", "medical", "prescription", "rather", "role", "them", "upon".
0.300
activeactivityaroundformshealthhumanincreaseincreasingindicatorsindividuallevelsmeanspeopleprogramspromotingpublicratesseparatelythoughtransportation
SHARED TOKENS (20): "active", "activity", "around", "forms", "health", "human", "increase", "increasing", "indicators", "individual", "levels", "means", "people", "programs", "promoting", "public", "rates", "separately", "though", "transportation".
0.300
controldemandeffectsevaluationfederalfoodfundinghealthinvolvingknowledgelegalmedicalopportunitypeopleprivatepublicrelatedresearchsectortreatment
SHARED TOKENS (20): "control", "demand", "effects", "evaluation", "federal", "food", "funding", "health", "involving", "knowledge", "legal", "medical", "opportunity", "people", "private", "public", "related", "research", "sector", "treatment".
0.300
accessbehavioralcarecenterconditionscontrolleddischargefacilitiesfacilityhealthhealthcareinterventionsleastlimitedmakesoutsidepatientpeoplepopulationspractice
SHARED TOKENS (37): "access", "behavioral", "care", "center", "conditions", "controlled", "discharge", "facilities", "facility", "health", "healthcare", "interventions", "least", "limited", "makes", "outside", "patient", "people", "populations", "practice"....
0.300
actadministrationagencyauthoritybeganconsentcontrolcurrentdepartmentdirectlyfederalfoodhealthhouseholdhumanmedicalprescriptionprimarypromotingpublic
SHARED TOKENS (28): "act", "administration", "agency", "authority", "began", "consent", "control", "current", "department", "directly", "federal", "food", "health", "household", "human", "medical", "prescription", "primary", "promoting", "public"....
0.300
Support group ↗ Q3117735 KW CROSS HIGH
advocacyburdencommunityestablishingformgroupinformationmembersnetworkspeopleprovidingpublicrelevantsocialsupporttypeswork
SHARED TOKENS (17): "advocacy", "burden", "community", "establishing", "form", "group", "information", "members", "networks", "people", "providing", "public", "relevant", "social", "support", "types", "work".
0.300
Data sharing ↗ Q5227350 KW CROSS HIGH
absenceacademicaccessagenciesalonecodecommunityconfidentialitydatadevelopmentestablishedfoundfundingfurthergoverninghistoryidentifiedincreasinglyinformationinstitutions
SHARED TOKENS (48): "absence", "academic", "access", "agencies", "alone", "code", "community", "confidentiality", "data", "development", "established", "found", "funding", "further", "governing", "history", "identified", "increasingly", "information", "institutions"....
0.300
administeredaloneamongchildcontrolleddifferenteducationindividualindividualsinvolvingjusticelegallegallymedicalprofessionalprogramprogramspurposerehabilitationsystem
SHARED TOKENS (20): "administered", "alone", "among", "child", "controlled", "different", "education", "individual", "individuals", "involving", "justice", "legal", "legally", "medical", "professional", "program", "programs", "purpose", "rehabilitation", "system".
0.300
amongapplyassociationcharitablechildrencodecommunitycompetitioncorporateeducationalexclusivelyfederalformfoundationfundsgrantindividualnationalnonprofitoperated
SHARED TOKENS (33): "among", "apply", "association", "charitable", "children", "code", "community", "competition", "corporate", "educational", "exclusively", "federal", "form", "foundation", "funds", "grant", "individual", "national", "nonprofit", "operated"....
0.300
activeassistancebettercontrolcostdistinctexperiencefoundfreegoverninggrouphealthcarehopeinstitutionslatermeetingmembersneedorganizationsprimary
SHARED TOKENS (29): "active", "assistance", "better", "control", "cost", "distinct", "experience", "found", "free", "governing", "group", "healthcare", "hope", "institutions", "later", "meeting", "members", "need", "organizations", "primary"....
0.300
activitiesagainstagencyboardbodybusinesscorporatedegreeexecutivegeneralgoverninggovernmentidentificationinstitutionitselflawmanagementmembersnonprofitorganization
SHARED TOKENS (25): "activities", "against", "agency", "board", "body", "business", "corporate", "degree", "executive", "general", "governing", "government", "identification", "institution", "itself", "law", "management", "members", "nonprofit", "organization"....
0.300
actionagendaalignedalonearoundcoalitionscommunitycouncilcreatecross-sectordefineddifferentearlierformframeworkgoalsgrouphouseidentifiesimpact
SHARED TOKENS (40): "action", "agenda", "aligned", "alone", "around", "coalitions", "community", "council", "create", "cross-sector", "defined", "different", "earlier", "form", "framework", "goals", "group", "house", "identifies", "impact"....
0.300
acquireactivitiescommunitiescommunitydecisionsdefineddesignededucationenvironmentalformgroupshealthindividualindividualsinfluenceinformationinvolvingknowledgelifenational
SHARED TOKENS (31): "acquire", "activities", "communities", "community", "decisions", "defined", "designed", "education", "environmental", "form", "groups", "health", "individual", "individuals", "influence", "information", "involving", "knowledge", "life", "national"....
0.300
actaddressaffordableagainstalongsideappropriationsassistancebenefitsbudgetbusinesscarechildchildrenclassificationconsolidatedcreditdirectdistributioneconomiceducation
SHARED TOKENS (47): "act", "address", "affordable", "against", "alongside", "appropriations", "assistance", "benefits", "budget", "business", "care", "child", "children", "classification", "consolidated", "credit", "direct", "distribution", "economic", "education"....
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
absenceassessmentassociationcaseclassificationclinicalcommunityconditionsconductingcontrolemploymenthealthhistoricalhistoryindividualindustryinfluencemattersmeasuresmedical
SHARED TOKENS (35): "absence", "assessment", "association", "case", "classification", "clinical", "community", "conditions", "conducting", "control", "employment", "health", "historical", "history", "individual", "industry", "influence", "matters", "measures", "medical"....
🫐 BERRY44 edges
0.280
agenciesannouncedleadershiplocalmembernationalnetworkofficeorganizationorganizationspositionsocialuniversityvoluntary
SHARED TOKENS (14): "agencies", "announced", "leadership", "local", "member", "national", "network", "office", "organization", "organizations", "position", "social", "university", "voluntary".
0.280
developmentenvironmenthistoricalmaintains
SHARED TOKENS (4): "development", "environment", "historical", "maintains". | EXACT TITLE in nonprofits_community: "Historic preservation".
0.280
aroundbecomehomeindividualsintegrationleadslocallong-termoutsidepeoplepermanentlyrefugeethemvoluntary
SHARED TOKENS (14): "around", "become", "home", "individuals", "integration", "leads", "local", "long-term", "outside", "people", "permanently", "refugee", "them", "voluntary".
0.280
crisisinterventionspecificstabilization
SHARED TOKENS (4): "crisis", "intervention", "specific", "stabilization". | EXACT TITLE in substance_use_recovery: "Crisis intervention".
0.260
accountingbusinesscasecasesclientdesigneddiscoveryelectroniclawmanagementoperationspracticerecords
SHARED TOKENS (13): "accounting", "business", "case", "cases", "client", "designed", "discovery", "electronic", "law", "management", "operations", "practice", "records".
0.260
activitiescasescentercommunitygroupinformationlocalmemberspublicsocialsupportthoughyouth
SHARED TOKENS (13): "activities", "cases", "center", "community", "group", "information", "local", "members", "public", "social", "support", "though", "youth".
0.260
boardscontrolledcorporatedecisionsdefinesgovernancelong-termmanagersoperatedorganizationsperformancepracticespublicly
SHARED TOKENS (13): "boards", "controlled", "corporate", "decisions", "defines", "governance", "long-term", "managers", "operated", "organizations", "performance", "practices", "publicly".
0.260
advocacyassistancedesignedexperiencingfamiliesfoodindividualsnetprogramspublicsafetyschoolsocial
SHARED TOKENS (13): "advocacy", "assistance", "designed", "experiencing", "families", "food", "individuals", "net", "programs", "public", "safety", "school", "social".
0.240
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongcontrolledeffectsequivalentformitselfmedicalproductionrecommendedrequiresupplywork
SHARED TOKENS (12): "among", "controlled", "effects", "equivalent", "form", "itself", "medical", "production", "recommended", "require", "supply", "work".
0.240
boisecentercontainsextendsfederallyidaholargestmetropolitanowyheepopulationrecognizedvalley
SHARED TOKENS (12): "boise", "center", "contains", "extends", "federally", "idaho", "largest", "metropolitan", "owyhee", "population", "recognized", "valley".
0.240
becomedesigneddistinctfamilyinfluenceinformationmarketingprimaryprocessreferralreferralssubsequent
SHARED TOKENS (12): "become", "designed", "distinct", "family", "influence", "information", "marketing", "primary", "process", "referral", "referrals", "subsequent".
0.240
boisecompletioncoveredestablishedextendshomeidaholargestpayettepopulationruralvalley
SHARED TOKENS (12): "boise", "completion", "covered", "established", "extends", "home", "idaho", "largest", "payette", "population", "rural", "valley".
0.220
distinctentryfrequentlygoverninggovernmentlawlegalmattersnationalregulationsrights
SHARED TOKENS (11): "distinct", "entry", "frequently", "governing", "government", "law", "legal", "matters", "national", "regulations", "rights".
0.220
acquirebecomebodiescontractingfederalgovernmentlocalmarketsprocurementpublicreal
SHARED TOKENS (11): "acquire", "become", "bodies", "contracting", "federal", "government", "local", "markets", "procurement", "public", "real".
0.220
becomedescribesitselfmajormodelnonprofitorganizationpeopleproblemsocietyuses
SHARED TOKENS (11): "become", "describes", "itself", "major", "model", "nonprofit", "organization", "people", "problem", "society", "uses".
0.220
Sales tax ↗ Q11055488 KW CROSS HIGH
bodyconsumerdirectlyeducationfoodfundsgoverningpaidpointpurchaserelated
SHARED TOKENS (11): "body", "consumer", "directly", "education", "food", "funds", "governing", "paid", "point", "purchase", "related".
0.220
affordablehealthhousingincreasinginsecurityoutcomesregulationssafestablesupplyzoning
SHARED TOKENS (11): "affordable", "health", "housing", "increasing", "insecurity", "outcomes", "regulations", "safe", "stable", "supply", "zoning".
0.220
Oxycodone ↗ Q407535 KW CROSS HIGH
abuseamongeffectsequivalentformhealthhourslaterlistorganizationtreatment
SHARED TOKENS (11): "abuse", "among", "effects", "equivalent", "form", "health", "hours", "later", "list", "organization", "treatment".
0.210
rehabilitation
SHARED TOKENS (1): "rehabilitation". | EXACT TITLE in nonprofits_community: "Rehabilitation". | EXACT TITLE in substance_use_recovery: "Rehabilitation".
0.200
justiceplacepointpolicepreventionreformrightsstatedsystemsystems
SHARED TOKENS (10): "justice", "place", "point", "police", "prevention", "reform", "rights", "stated", "system", "systems".
0.200
accuracydecisionselectronicevaluationexperienceformprofessionalreviewsitesusers
SHARED TOKENS (10): "accuracy", "decisions", "electronic", "evaluation", "experience", "form", "professional", "review", "sites", "users".
0.200
costexchangeharmprogramprovidingreducereductionrisksocialusers
SHARED TOKENS (10): "cost", "exchange", "harm", "program", "providing", "reduce", "reduction", "risk", "social", "users".
0.200
charitabledefinedestablishfundedlawplanningrevenuerulesspecifictypes
SHARED TOKENS (10): "charitable", "defined", "establish", "funded", "law", "planning", "revenue", "rules", "specific", "types".
0.200
Endowment ↗ Q16775552 EXACT TITLE
EXACT TITLE in nonprofits_community: "Endowment".
0.180
activitiescharitableformfurthergroupprivateproceedsratheruses
SHARED TOKENS (9): "activities", "charitable", "form", "further", "group", "private", "proceeds", "rather", "uses".
0.180
adamscouncilestablishedhomeidaholargestmakingpopulationrural
SHARED TOKENS (9): "adams", "council", "established", "home", "idaho", "largest", "making", "population", "rural".
0.180
agenciescommunity-basedfoodlargestnetworknonprofitorganizationpeoplerevenue
SHARED TOKENS (9): "agencies", "community-based", "food", "largest", "network", "nonprofit", "organization", "people", "revenue".
0.160
causeeffectspathwaysprescriptionrapidreducedreductiontherapy
SHARED TOKENS (8): "cause", "effects", "pathways", "prescription", "rapid", "reduced", "reduction", "therapy".
0.160
Recidivism ↗ Q1420643 KW CROSS HIGH
abuseactfallfrequentlyindividualmodelrecurringtrained
SHARED TOKENS (8): "abuse", "act", "fall", "frequently", "individual", "model", "recurring", "trained".
0.160
agencycommunitiesdepartmentdepartmentsgovernmentpolicypublicveterans
SHARED TOKENS (8): "agency", "communities", "department", "departments", "government", "policy", "public", "veterans".
0.160
Cannabis ↗ Q79817 KW CROSS HIGH
familyhistorylevelsoriginatingprincipalproducerecognizedsingle
SHARED TOKENS (8): "family", "history", "levels", "originating", "principal", "produce", "recognized", "single".
0.160
agebegandegreedisabilityearlieremploymentindividualpattern
SHARED TOKENS (8): "age", "began", "degree", "disability", "earlier", "employment", "individual", "pattern".
0.160
activitybehavioralengagementenvironmentalexposureforminvolvingupon
SHARED TOKENS (8): "activity", "behavioral", "engagement", "environmental", "exposure", "form", "involving", "upon".
0.140
boisegemhomeidaholargestmetropolitanpopulation
SHARED TOKENS (7): "boise", "gem", "home", "idaho", "largest", "metropolitan", "population".
0.140
careclinicscomprehensivehospitalmodernrequireswhose
SHARED TOKENS (7): "care", "clinics", "comprehensive", "hospital", "modern", "requires", "whose".
0.140
benefitsbodycharitableestablishedfundedorganizationspecific
SHARED TOKENS (7): "benefits", "body", "charitable", "established", "funded", "organization", "specific".
0.140
agencycertificationdesignationeducationalprofessionalpublictask
SHARED TOKENS (7): "agency", "certification", "designation", "educational", "professional", "public", "task".
0.120
abusedependentindividualmedicalphysicallyupon
SHARED TOKENS (6): "abuse", "dependent", "individual", "medical", "physically", "upon".
0.120
Drug overdose ↗ Q3505252 KW CROSS HIGH
applicationcaseshealthpotentialrecommendedrisk
SHARED TOKENS (6): "application", "cases", "health", "potential", "recommended", "risk".
0.120
Food drive ↗ Q5465459 KW CROSS HIGH
cannotfoodformgroupindividualspeople
SHARED TOKENS (6): "cannot", "food", "form", "group", "individuals", "people".
0.100
establishedidaholargestpopulationwashington
SHARED TOKENS (5): "established", "idaho", "largest", "population", "washington".
0.100
elmorehomeidaholargestpopulation
SHARED TOKENS (5): "elmore", "home", "idaho", "largest", "population".
0.100
financialgroupmemberssupporttypes
SHARED TOKENS (5): "financial", "group", "members", "support", "types".
0.100
controlinfluencemultipleoperatingprescription
SHARED TOKENS (5): "control", "influence", "multiple", "operating", "prescription".
◈ Frequently Asked Questions
Nonprofits Community × Substance Use Recovery — Treasure Valley
HAIKU · HIGH GATE
Which Treasure Valley nonprofits provide case management services for people in substance use recovery?
Nonprofits across Boise and Nampa employ social workers trained in case management to coordinate treatment, housing, and family support for individuals recovering from substance use. Boise State University's continuing education programs prepare these professionals to address the specific recovery needs of Southwestern Idaho's population.
How do nonprofits in the Treasure Valley connect substance use recovery to housing support?
Nonprofits in Boise and the broader Treasure Valley operate transitional housing and supportive housing programs specifically designed for people in recovery, recognizing stable home environments as essential to sustained health outcomes. These organizations coordinate with family therapy providers and domestic violence services to address the interconnected challenges many recovering individuals face in the Nampa and Boise metropolitan area.
What role do Treasure Valley nonprofits play in protecting children when parents are in substance use recovery?
Nonprofit organizations in Southwestern Idaho integrate child protection services with family therapy and case management to ensure children's development continues safely when parents enter recovery. Boise-area nonprofits work within Idaho's child welfare framework to maintain family connections while addressing substance use, keeping both adult recovery and children's health as dual priorities.
How do nonprofits in Boise and Nampa address affordable housing barriers in substance use recovery?
Nonprofits across the Treasure Valley recognize that affordable housing scarcity directly impacts recovery stability, so many organizations operate supportive housing programs combining rental assistance with wraparound services. Boise State University's social work programs train nonprofit staff to integrate affordable housing strategies into comprehensive recovery support for Southwestern Idaho's population.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nonprofits Community × Substance Use Recovery 22 QID bridges 278 edges 7,426 ext links 2026-07-17 22:29:05 UTC 67656cf14da50236
Nonprofits Community corridor ↗ Substance Use Recovery corridor ↗ Substance Use Recovery × Nonprofits Community ↗ boisestandard.org/standard ↗
Parent Corridors
Nonprofits Community × All Other Verticals