—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nonprofits Community ↔ relates to ↔ Childcare Family

27 Wikipedia bridge articles confirmed in both vertical ledgers. 249 deterministic cross-vertical edges. 6,655 external source links harvested. Every edge provenance-stamped. Every claim auditable.

27 QID Bridge Articles
249 Cross Edges
6,655 External Sources
291 Wikipedia Articles
28 🌲 Evergreen
182 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nonprofits Community
× Childcare Family
QID Bridge Articles
27
confirmed Wikipedia overlap
Total Cross Edges
249
External Sources Harvested
6,655
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (20)
Boise State UniversityFamily therapyIdahoMental healthFoster careChild protectionSocial workContinuing educationCommunity developmentFood securityCollege of Western IdahoNonprofit organizationCase managementPhilanthropyTreasure ValleyVolunteeringNampa, IdahoSpecial-use permitZoning in the United StatesBoise, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationdevelopmentcommunityeducationhealthpublicindividualpeoplesociallocalamonghomeprivatecollegefamiliesfamilysystemland
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:25:47 UTC
Content Hash
fabbd873b3d92b5e
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
27 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (19): "activity", "among", "boise", "business", "church", "college", "division", "economics", "education", "health", "idaho", "independent", "institution", "program", "programs", "public", "research", "school", "university". | URL->A (1): https://boisestate.edu/. | EXACT TITLE in nonprofits_community: "Boise State University". | EXACT TITLE in childcare_family: "Boise State University".
activityamongboisebusinesschurchcollegedivisioneconomicseducationhealthidahoindependentinstitutionprogramprogramspublicresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
F
Q870449 EXACT TITLE 1.000
QID OVERLAP: Q870449 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (29): "children", "clients", "clinicians", "counseling", "defined", "development", "different", "direct", "early", "families", "family", "individual", "influence", "involvement", "long-term", "parents", "participation", "people", "problem", "related".... | EXACT TITLE in nonprofits_community: "Family therapy". | EXACT TITLE in childcare_family: "Family therapy".
childrenclientsclinicianscounselingdefineddevelopmentdifferentdirectearlyfamiliesfamilyindividualinfluenceinvolvementlong-termparentsparticipationpeopleproblemrelatedrelationshipsrolesschoolsstudysupportsystemsystemstherapyview
way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
erms of the systems of interaction between family members. The different schools of family therapy have in common a belief that, regardless of the origin of the problem, and regardless of whether the clients consider it an "individual" or "family" issue, involving families in solutions often benefits clients. This involvement of families is commonly accomplished by their direct participation in the therapy session. The skills of the family therapist thus include the ability to influence conversations in a way that catalyses the strengths, wisdom, and support of the wider system. In the field's early years, many clinicians defined the family in a narrow, traditional manner usually including parents and children.
History and theoretical frameworks Formal interventions with families to help individuals and families experiencing various kinds of problems have been a part of many cultures, probably throughout history. These interventions have sometimes involved formal procedures or rituals, and often included the extended family as well as non-kin members of the community (see, for example, Ho'oponopono). Following the emergence of specialization in various societies, these interventions were often conducted by particular members of a community—for example, a tribal chief, priest, physician, and so on—usually as an ancillary function. Family therapy as a distinct professional practice within Western cultures can be argued to have had its origins in the social work movements of the 19th century in the United Kingdom and the United States. As a branch of psychotherapy, its roots can be traced somewhat later to the early 20th century with the emergence of the child guidance movement and marriage counseling. The formal development of family therapy dates from the 1940s and early 1950s with the founding in 1942 of the American Association of Marriage Counselors (the precursor of the AAMFT), and through the work of various independent clinicians and groups—in the United Kingdom (John Bowlby at the Tavistock Clinic), the United States (Donald deAvila Jackson, John Elderkin Bell, Nathan Ackerman, Christian Midelfort, Theodore Lidz, Lyman Wynne, Murray Bowen, Carl Whitaker, Virginia Satir, Ivan Boszormenyi-Nagy), and in Hungary, D.L.P. Liebermann—who began seeing family members together for observation or therapy sessions. There was initially a strong influence from psychoanalysis (most of the early founders of the field had psychoanalytic backgrounds) and social psychiatry, and later from behaviorism and behavior therapy—and significantly, these clinicians began to articulate various theories about the nature and functioning of the family as an entity that was more than a mere aggregation of individuals. The movement received an important boost starting in the early 1950s through the work of anthropologist Gregory Bateson and colleagues—Jay Haley, Donald deAvila Jackson, John Weakland, William Fry, and later, Virginia Satir, Ivan Boszormenyi-Nagy, Paul Watzlawick and others—at Palo Alto in the United States, who introduced ideas from cybernetics and general systems theory into social psychology and psychotherapy, focusing in particular on the role of communication. This approach eschewed the traditional focus on individual psychology and historical factors—that involve so-called linear causation and content—and emphasized instead feedback and homeostatic mechanisms and "rules" in here-and-now interactions—so-called circular causation and process—that were thought to maintain or exacerbate problems, whatever the original cause(s). This group was also influenced significantly by the work of US psychiatrist, hypnotherapist, and brief therapist Milton H. Erickson—especially his innovative use of strategies for change, such as paradoxical directives. The members of the Bateson Project (like the founders of a number of other schools of family therapy, including Carl Whitaker, Murray Bowen, and Ivan Boszormenyi-Nagy) had a particular interest in the possible psychosocial causes and treatment of schizophrenia, especially in terms of the putative "meaning" and "function" of signs and symptoms within the family system. The research of psychiatrists and psychoanalysts Lyman Wynne and Theodore Lidz on communication deviance and roles (e.g., pseudo-mutuality, pseudo-hostility, schism, and skew) in families of people with schizophrenia also became influential with systems-communications-oriented theorists and therapists. A related theme—applying to dysfunction and psychopathology more generally—was that of the "identified patient" or "presenting problem" as a manifestation of or surrogate for the family's (or even society's) problems. By the mid-1960s, a number of distinct schools of family therapy had emerged. From the groups that were most strongly influenced by cybernetics and systems theory there came Mental Research Institute brief therapy, strategic therapy, Salvador Minuchin's structural family therapy and the model proposed by Mara Selvini Palazzoli (i.e., the Milan systems model). Partly in reaction to some aspects of these systemic models came the experiential approaches of Virginia Satir and Carl Whitaker, which downplayed theoretical constructs and emphasized subjective experience and unexpressed feelings (including the subconscious), authentic communication, spontaneity, creativity, total therapist engagement, and often included the extended family. Concurrently, intergenerational therapies by Murray Bowen, Ivan Boszormenyi-Nagy, James Framo, and Norman Paul emerged. They proposed different theories on the intergenerational transmission of health and dysfunction, usually involving three generations in therapy or through "homework" and "journeys home." Psychodynamic family therapy—which, more than any other school of family therapy, deals directly with individual psychology and the unconscious mind in the context of current relationships—continued to develop through a number of groups that were influenced by the ideas and methods of Nathan Ackerman, the British school of object relations theory, and John Bowlby's work on attachment theory. Multiple-family group therapy, a precursor of psychoeducational family intervention, emerged, in part, as a pragmatic alternative form of intervention—especially as an adjunct to the treatment of serious mental illnesses with significant biological underpinnings, such as schizophrenia—and represented something of a conceptual challenge to some of the systemic (and thus potentially "family-blaming") paradigms of pathogenesis that were implicit in many of the dominant models of family therapy. The late 1960s and early 1970s saw the development of network therapy (which bears some resemblance to traditional practices such as Ho'oponopono) by Ross Speck and Carolyn Attneave, and the emergence of behavioral marital therapy (renamed behavioral couples therapy in the 1990s) and behavioral family therapy as models in their own right. By the late 1970s, the weight of clinical experience—especially in the treatment of serious mental disorders—had led to revisions of several of the original models and a moderation of earlier stridency and theoretical purism. There were the beginnings of a general softening of the strict demarcations between schools, with moves toward rapprochement, integration, and eclecticism—although there was, nevertheless, some hardening of positions within some schools. These trends were reflected in and influenced by lively debates within the field and critiques from various sources, including feminism and post-modernism, that reflected in part the cultural and political tenor of the times, and which foreshadowed the emergence (in the 1980s and 1990s) of the various post-systems constructivist and social constructionist approaches. While there was still debate within the field about whether, or to what degree, the systemic-constructivist and medical-biological paradigms were necessarily antithetical to each other (see also anti-psychiatry; biopsychosocial model), there was a growing willingness and tendency on the part of family therapists to work in multi-modal clinical partnerships with other members of the helping and medical professions. From the mid-1980s to the present, the field has been marked by a diversity of approaches that partly reflect the original schools, but which also draw on other theories and methods from individual psychotherapy and elsewhere—these approaches and sources include: brief therapy, structural therapy, constructivist approaches (e.g., Milan systems, post-Milan/collaborative/conversational, and reflective), bringforthist approach (e.g., Karl Tomm's IPscope model and Interventive interviewing), solution focused brief therapy, narrative therapy, a range of cognitive behavioral therapy approaches, psychodynamic and object relations approaches, attachment and emotionally focused therapy, intergenerational approaches, network therapy, and multisystemic therapy (MST). Multicultural, intercultural, and integrative approaches are being developed, with Vincenzo Di Nicola weaving a synthesis of family therapy and transcultural psychiatry in his model of cultural family therapy, A Stranger in The Family: Culture, Families, and Therapy. Many practitioners claim to be eclectic, using techniques from several areas, depending upon their own inclinations and/or the needs of the client(s), and there is a growing movement toward a single "generic" family therapy that seeks to incorporate the best of the accumulated knowledge in the field and which can be adapted to many different contexts. Nonetheless, there are still a significant number of therapists who adhere more or less strictly to a particular, or limited number of, approach(es). The liberation-based healing framework for family therapy offers a complete paradigm shift for working with families while addressing the intersections of race, class, gender identity, sexual orientation, and other socio-political identity markers. This theoretical approach and praxis is informed by critical pedagogy, feminism, critical race theory, and decolonizing theory. It necessitates an understanding of the ways colonization, cisheteronormativity, patriarchy, white supremacy and other systems of domination impact individuals, families and communities and centers the need to disrupt the status quo in how power operates. Traditional Western models of family therapy have historically ignored these dimensions, and when white, male privilege has been critiqued, largely by feminist theory practitioners, it has often been to the benefit of middle-class, white women's experiences. While an understanding of intersectionality is of particular significance in working with families with violence, a liberatory framework examines how power, privilege and oppression operate within and across all relationships. Liberatory practices are based on the principles of critical consciousness, accountability, and empowerment. These principles guide not only the content of therapeutic work with clients but also the supervisory and training processes for therapists.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (27): "agriculture", "around", "associated", "boise", "capital", "contains", "distinct", "early", "geographic", "idaho", "isolated", "land", "national", "north", "official", "people", "population", "river", "sector", "separate".... | EXACT TITLE in nonprofits_community: "Idaho". | EXACT TITLE in childcare_family: "Idaho".
agriculturearoundassociatedboisecapitalcontainsdistinctearlygeographicidahoisolatedlandnationalnorthofficialpeoplepopulationriversectorseparatesignificantsmallsuppliestechnologythousandsuseswestern
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
In 2025, the gross state product (state GDP) for Idaho was $135.5 billion and the state's per capita personal income was $64,846. Idaho had the 39th highest GDP per capita in the United States of America in 2025. In 2025, small businesses made up 99.2% and employed 56.0% of the state's work force. As of May 2025, the state's unemployment rate was 3.6%. Total employment in Idaho in 2024 was 965,824. Idaho is the top potato producing state in the United States and almost one-third of the nation's potatoes are grown in the Snake River Plain, a belt of low-lying land that extends across southern Idaho. Important industries in Idaho are food processing, lumber and wood products, machinery, chemical products, paper products, electronics manufacturing, silver and other mining, and tourism. The world's largest factory for barrel cheese, the raw product for processed cheese, is in Gooding, Idaho. It has a capacity of 120,000 metric tons per year of barrel cheese and belongs to the Glanbia group. As Idaho neared statehood, mining and other extractive industries played a significant role in its economy. Although the state's reliance on mining has diminished over time, Idaho remains renowned as "The Gem State" due to its production of seventy-two varieties of precious and semi-precious stones. Idaho is a leading national producer of potatoes, trout, Austrian winter peas, and lentils. The state's primary industries include manufacturing, agriculture, food processing, timber, and mining. Tourism is another way that Idaho capitalizes on its natural resources.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
Mental health
Q317309 EXACT TITLE 1.000
QID OVERLAP: Q317309 in nonprofits_community (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (22): "absence", "activities", "affect", "among", "broader", "community", "create", "decisions", "defines", "determines", "health", "individual", "merely", "organization", "people", "professional", "rather", "relationships", "resilience", "role".... | EXACT TITLE in childcare_family: "Mental health".
absenceactivitiesaffectamongbroadercommunitycreatedecisionsdefinesdetermineshealthindividualmerelyorganizationpeopleprofessionalratherrelationshipsresiliencerolesocialwork
sychological, and social well-being, and it affects how people manage stress and make everyday decisions. From the perspectives of positive psychology or holism, mental health is thus not merely the absence of mental illness. Rather, it is a broader state of well-being that includes an individual's ability to enjoy life and to create a balance between life activities and efforts to achieve psychological resilience.
"The terms mental health promotion and prevention have often been confused. Promotion is defined as intervening to optimize positive mental health by addressing determinants of positive mental health (i.e. protective factors) before a specific mental health problem has been identified, with the ultimate goal of improving the positive mental health of the population. Mental health prevention is defined as intervening to minimize mental health problems (i.e. risk factors) by addressing determinants of mental health problems before a specific mental health problem has been identified in the individual, group, or population of focus with the ultimate goal of reducing the number of future mental health problems in the population." In order to improve mental health, the root of the issue has to be resolved. "Prevention emphasizes the avoidance of risk factors; promotion aims to enhance an individual's ability to achieve a positive sense of self-esteem, mastery, well-being, and social inclusion." Mental health promotion attempts to increase protective factors and healthy behaviors that can help prevent the onset of a diagnosable mental disorder and reduce risk factors that can lead to the development of a mental disorder. Yoga is an example of an activity that calms one's entire body and nerves. According to a study on well-being by Richards, Campania, and Muse-Burke, "mindfulness is considered to be a purposeful state, it may be that those who practice it belief in its importance and value being mindful, so that valuing of self-care activities may influence the intentional component of mindfulness." Akin to surgery, sometimes the body must be further damaged, before it can properly heal Mental health is conventionally defined as a hybrid of the absence of a mental disorder and the presence of well-being. Focus is increasing on preventing mental disorders. Prevention is beginning to appear in mental health strategies, including the 2004 WHO report "Prevention of Mental Disorders", the 2008 EU "Pact for Mental Health" and the 2011 US National Prevention Strategy. Some commentators have argued that a pragmatic and practical approach to mental disorder prevention at work would be to treat it the same way as physical injury prevention. Prevention of a disorder at a young age may significantly decrease the chances that a child will have a disorder later in life, and shall be the most efficient and effective measure from a public health perspective. Prevention may require the regular consultation of a physician for at least twice a year to detect any signs that reveal any mental health concerns. Additionally, social media is becoming a resource for prevention. In 2004, the Mental Health Services Act began to fund marketing initiatives to educate the public on mental health. This California-based project is working to combat the negative perception with mental health and reduce the stigma associated with it. While social media can benefit mental health, it can also lead to deterioration if not managed properly. Limiting social media intake is beneficial. Studies report that patients in mental health care who can access and read their Electronic Health Records (EHR) or Open Notes online experience increased understanding of their mental health, feeling in control of their care, and enhanced trust in their clinicians. Patients' also reported feelings of greater validation, engagement, remembering their care plan, and acquiring a better awareness of potential side effects of their medications, when reading their mental health notes. Other common experiences were that shared mental health notes enhance patient empowerment and augment patient autonomy. Furthermore, recent studies have shown that social media is an effective way to draw attention to mental health issues. By collecting data from Twitter, researchers found that social media presence is heightened after an event relating to behavioral health occurs.
m, mental health is thus not merely the absence of mental illness. Rather, it is a broader state of well-being that includes an individual's ability to enjoy life and to create a balance between life activities and efforts to achieve psychological resilience.
F
Q1430789 EXACT TITLE 1.000
QID OVERLAP: Q1430789 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (46): "abuse", "age", "agency", "among", "care", "caregiver", "child", "children", "clients", "community", "conditions", "created", "data", "decisions", "described", "families", "family", "foster", "general", "group".... | EXACT TITLE in nonprofits_community: "Foster care". | EXACT TITLE in childcare_family: "Foster care".
abuseageagencyamongcarecaregiverchildchildrenclientscommunityconditionscreateddatadecisionsdescribedfamiliesfamilyfostergeneralgrouphealthhigherhomehomelessinstitutionlegalmakingoutcomesparentplacement+16
ion. Children in foster care have a high rate of ill health, particularly psychiatric conditions such as anxiety, depression, and eating disorders. One third of foster children in a US study reported abuse from a foster parent or other adult in the foster home.
Japan The idea of foster care or taking in abandoned children actually came about around 1392–1490s in Japan. The foster care system in Japan is similar to the Orphan Trains system of the US, thinking the children would do better on farms rather than living in the "dusty city". The families would often send their children to a farm family outside the village and only keep their oldest son. The farm families served as the foster parents and they were financially rewarded for taking in the younger siblings. "It was considered an honor to be chosen as foster parents, and selection greatly depended on the family's reputation and status within the village". Around 1895 the foster care program became more like the system used in the United States because the Tokyo Metropolitan Police sent children to a hospital where they would be "settled". Problems emerged in this system, such as child abuse, so the government started phasing it out and "began increasing institutional facilities".
Italy Although the numbers have greatly decreased since post World War II, over 27,000 children in Italy are in alternative care. Under 40% of children are able to return to their birth families, which is the ultimate goal of foster care. Italian law considers familial relationships to be pivotal to a child's developments and gives primary relevance to the original family and offer home based support. However, if neglect or abuse is present, the judicial system may intervene to remove involved children.
C
Q1029430 EXACT TITLE 1.000
QID OVERLAP: Q1029430 in nonprofits_community (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (69): "abuse", "access", "account", "affect", "agencies", "basic", "beyond", "child", "children", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "even".... | EXACT TITLE in childcare_family: "Child protection".
abuseaccessaccountaffectagenciesbasicbeyondchildchildrencommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationevenfamiliesfamilyfreefuturegroupshealthhealthcarehomeidentifyidentifying+39
Child protection (also called child welfare) is the safeguarding of children from violence, exploitation, abuse, abandonment, and neglect. It involves identifying signs of potential harm. This includes responding to allegations or suspicions of abuse, providing support and services to protect children, and holding those who have harmed them accountable. The primary goal of child protection is to ensure that all children are safe and free from harm or danger. Child protection also works to prevent future harm by creating policies and systems that identify and respond to risks before they lead to harm. In order to achieve these goals, research suggests that child protection services should be provided in a holistic way. This means taking into account the social, economic, cultural, psychological, and environmental factors that can contribute to the risk of harm for individual children and their families. Collaboration across sectors and disciplines to create a comprehensive system of support and safety for children is required. It is the responsibility of individuals, organizations, and governments to ensure that children are protected from harm and their rights are respected.
that children are protected from harm and their rights are respected. This includes providing a safe environment for children to grow and develop, protecting them from physical, emotional and sexual abuse, and ensuring they have access to education, healthcare, and resources to fulfill their basic needs. Child protection systems are a set of services, usually government-run, designed to protect children and young people who are underage and to encourage family stability. UNICEF defines a 'child protection system' as: "The set of laws, policies, regulations and services needed across all social sectors – especially social welfare, education, health, security and justice – to support prevention and response to protection-related risks. These systems are part of social protection, and extend beyond it. At the level of prevention, their aim includes supporting and strengthening families to reduce social exclusion, and to lower the risk of separation, violence and exploitation. Responsibilities are often spread across government agencies, with services delivered by local authorities, non-State providers, and community groups, making coordination between sectors and levels, including routine referral systems etc.., a necessary component of effective child protection systems."Under Article 19 of the UN Convention on the Rights of the Child, a 'child protection system' provides for the protection of children in and out of the home. One of the ways this can be enabled is through the provision of quality education, the fourth of the United Nations Sustainable Development Goals, in addition to other child protection systems.
Endangerment Child endangerment is the act of placing a child in a situation that neglects their health or life. Child endangerment can cause many negative physical and mental effects. This can stem from abusive parental care, child neglect, and a multitude of other reasons. Ways to prevent incidents of child endangerment include primary parents or caregivers spending ample time with their children and seeking out appropriate resources to assist in understanding early childhood development. A number of states in the US have laws put in place to prevent child abuse or neglect, with the majority of them focusing on arrest sentences up to five years and fines ranging from $5,000-$15,000. Infanticide (child murder) Infanticide is the intentional killing of infants and young children. This practice has been documented throughout history and still occurs in certain cultures today, usually as a result of poverty and/or other social pressures. Infanticide can be carried out by parents, relatives, or strangers and is often seen as a form of gender-based violence, since female babies are more likely to be killed than male ones. In some cases, infanticide may also be used to conceal evidence of incest or rape. It is most commonly practiced in cultures where there is a preference for male children, or where resources are scarce. In some countries, children can be imprisoned for common crimes. In some countries, like Iran or China, criminals can even be sentenced to capital punishment for crimes committed while they were children (the United States abandoned the practice in 2005). In contexts where military use of children is made, they also risk becoming prisoners of war. Other children are forced into prostitution, exploited by adults for illegal traffic in children, or endangered by poverty and hunger. Infanticide today continues at a much higher rate in areas of extremely high poverty and overpopulation, such as parts of China and India.
S
Q205398 EXACT TITLE 1.000
QID OVERLAP: Q205398 in nonprofits_community (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (51): "administration", "advocacy", "agencies", "basic", "began", "child", "communities", "community", "conducting", "counseling", "defined", "development", "directly", "economics", "education", "families", "family", "functioning", "group", "groups".... | EXACT TITLE in nonprofits_community: "Social work".
administrationadvocacyagenciesbasicbeganchildcommunitiescommunityconductingcounselingdefineddevelopmentdirectlyeconomicseducationfamiliesfamilyfunctioninggroupgroupshealthindividualindividualslaborlargerlawlevelsmanagementneedsorganizations+21
group therapy or providing services for community agencies. Macro-work involves fostering change on a larger scale through advocacy, social policy, research development, non-profit and public service administration, or working with government agencies. Starting in the 1960s, a few universities began social work management programmes, to prepare students for the management of social and human service organizations, in addition to classical social work education. The social work profession developed in the 19th century, with some of its roots in voluntary philanthropy and in grassroots organizing. However, responses to social needs had existed long before then, primarily from public almshouses, private charities and religious organizations.
The practice and profession of social work has a relatively modern and scientific origin, and is generally considered to have developed out of three strands. The first was individual casework, a strategy pioneered by the Charity Organization Society in the mid-19th century, which was founded by Helen Bosanquet and Octavia Hill in London, England. Most historians identify COS as the pioneering organization of the social theory that led to the emergence of social work as a professional occupation. COS had its main focus on individual casework. The second was social administration, which included various forms of poverty relief – 'relief of paupers'. Statewide poverty relief could be said to have its roots in the English Poor Laws of the 17th century but was first systematized through the efforts of the Charity Organization Society. The third consisted of social action – rather than engaging in the resolution of immediate individual requirements, the emphasis was placed on political action working through the community and the group to improve their social conditions and thereby alleviate poverty. This approach was developed originally by the Settlement House Movement. This was accompanied by a less easily defined movement; the development of institutions to deal with the entire range of social problems. All had their most rapid growth during the nineteenth century, and laid the foundation basis for modern social work, both in theory and in practice. Professional social work originated in 19th century England, and had its roots in the social and economic upheaval wrought by the Industrial Revolution, in particular, the societal struggle to deal with the resultant mass urban-based poverty and its related problems.
Engagement — social worker must first engage the client in early meetings to promote a collaborative relationship Assessment — data gathered must be specifically aimed at guiding and directing a plan of action to help the client Planning — negotiate and formulate an action plan Implementation — promote resource acquisition and enhance role performance Monitoring/Evaluation — ongoing documentation for assessing the extent to which the client is following through on short-term goal attainment Supportive Counseling — affirming, challenging, encouraging, informing, and exploring options Graduated Disengagement — seeking to replace the social worker with a naturally occurring resource Administration — planning and managing social work programs, providing operations management support, and administrating case management services There are six broad ethical principles in National Association of Social Workers' (NASW) Code of Ethics that inform social work practice, they are both prescriptive and proscriptive, and are based on six core values:
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (35): "activities", "age", "agencies", "beyond", "college", "continuing", "curriculum", "development", "different", "division", "economic", "education", "formal", "frequently", "general", "institutional", "learning", "least", "operation", "partnerships".... | EXACT TITLE in nonprofits_community: "Continuing education". | EXACT TITLE in childcare_family: "Continuing education".
activitiesageagenciesbeyondcollegecontinuingcurriculumdevelopmentdifferentdivisioneconomiceducationformalfrequentlygeneralinstitutionallearningleastoperationpartnershipsprofessionalprogramsprovisionratherrevenueschoolseparatestaffstrengtheningstudents+5
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
n". Georgetown University, Michigan State University, and the University of Denver have benefited from non-credit programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
Community development
Q718998 EXACT TITLE 1.000
QID OVERLAP: Q718998 in nonprofits_community (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (41): "active", "affect", "among", "association", "civic", "communities", "community", "context", "created", "defined", "defines", "developers", "development", "economic", "education", "groups", "higher", "identity", "individuals", "institutions".... | EXACT TITLE in nonprofits_community: "Community development".
activeaffectamongassociationciviccommunitiescommunitycontextcreateddefineddefinesdevelopersdevelopmenteconomiceducationgroupshigheridentityindividualsinstitutionsinvolvedlargerlocalmajorpeoplepositionspracticepracticesprocessprofessional+11
countries, i.e. the United States, United Kingdom, Australia, Canada, New Zealand, as well as other countries in the Commonwealth of Nations. It is also used in some countries in Eastern Europe with active community development associations in Hungary and Romania. The Community Development Journal, published by Oxford University Press, since 1966 has aimed to be the major forum for research and dissemination of international community development theory and practice. Community development approaches are recognised internationally. These methods and approaches have been acknowledged as significant for local social, economic, cultural, environmental and political development by such organisations as the UN, WHO, OECD, World Bank, Council of Europe and EU.
A set of values and practices which plays a special role in overcoming poverty and disadvantage, knitting society together at the grass roots and deepening democracy. There is a community development profession, defined by national occupational standards and a body of theory and experience going back the best part of a century.
their communities. These skills are often created through the formation of social groups working for a common agenda. Community developers must understand both how to work with individuals and how to affect communities' positions within the context of larger social institutions. Community development as a term has taken off widely in anglophone countries, i.e. the United States, United Kingdom, Australia, Canada, New Zealand, as well as other countries in the Commonwealth of Nations. It is also used in some countries in Eastern Europe with active community development associations in Hungary and Romania. The Community Development Journal, published by Oxford University Press, since 1966 has aimed to be the major forum for research and dissemination of international community development theory and practice. Community development approaches are recognised internationally. These methods and approaches have been acknowledged as significant for local social, economic, cultural, environmental and political development by such organisations as the UN, WHO, OECD, World Bank, Council of Europe and EU.
Food security
Q1229911 EXACT TITLE 1.000
QID OVERLAP: Q1229911 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (48): "access", "active", "affordable", "age", "agency", "availability", "beyond", "children", "create", "development", "early", "economic", "even", "family", "food", "future", "growth", "health", "higher", "household".... | EXACT TITLE in nonprofits_community: "Food security". | EXACT TITLE in childcare_family: "Food security".
accessactiveaffordableageagencyavailabilitybeyondchildrencreatedevelopmentearlyeconomicevenfamilyfoodfuturegrowthhealthhigherhouseholdindividualindividualsinsecurityinstabilityintakelandlegallevelslimitedpeople+18
Food security is the state of having reliable access to a sufficient quantity of affordable, healthy food. The availability of food for people of any class, gender, status, ethnicity, or religion is another element of food protection. Similarly, household food security is considered to exist when all the members of a family have consistent access to enough food for an active, healthy life. Food-secure individuals do not live in hunger or fear of starvation. Food security includes resilience to future disruptions of food supply. Such a disruption could occur due to various risk factors such as droughts and floods, shipping disruptions, fuel shortages, economic instability, and wars. Food insecurity is the opposite of food security: a state where there is only limited or uncertain availability of suitable food. The concept of food security has evolved over time. The four pillars of food security include availability, access, utilization, and stability. In addition, there are two more dimensions that are important: agency and sustainability. These six dimensions of food security are reinforced in conceptual and legal understandings of the right to food. The World Food Summit in 1996 declared that "food should not be used as an instrument for political and economic pressure." Food insecurity goes beyond hunger; it includes people who do not have regular access to nutritious and sufficient food, even if they may not necessarily be suffering from hunger. In 2024, an estimated 28.0 percent of the world population, or 2.28 billion people, has experienced food insecurity at moderate or severe levels. There are many causes of food insecurity. The most important ones are high food prices and disruptions in global food supplies for example due to war. Climate change, water scarcity, land degradation, agricultural diseases, pandemics and disease outbreaks can also create food insecurity. Additionally, food insecurity affects individuals with low socioeconomic status, affects the health of a population on an individual level, and causes divisions in interpersonal relationships. Food insecurity due to unemployment causes a higher rate of poverty. The effects of food insecurity can include hunger and even famines. Chronic food insecurity translates into a high degree of vulnerability to hunger and famine. Chronic hunger and malnutrition in childhood can lead to stunted growth of children. Once stunting has occurred, improved nutritional intake after the age of about two years is unable to reverse the damage. Severe malnutrition in early childhood often leads to defects in cognitive development. About 2.3 billion people in the world are estimated to have been moderately or severely food insecure in 2024. The global prevalence of moderate or severe food insecurity has declined gradually since 2021, reaching 28.0% in 2024. Food insecurity is on the rise in Africa and falling in Latin America and the Caribbean; it has been decreasing gradually in Asia for several consecutive years, while in Oceania and in Northern America and Europe, new estimates point to a slight decline from 2023 to 2024 following a several-year rise.
d security: a state where there is only limited or uncertain availability of suitable food. The concept of food security has evolved over time. The four pillars of food security include availability, access, utilization, and stability. In addition, there are two more dimensions that are important: agency and sustainability. These six dimensions of food security are reinforced in conceptual and legal understandings of the right to food. The World Food Summit in 1996 declared that "food should not be used as an instrument for political and economic pressure." Food insecurity goes beyond hunger; it includes people who do not have regular access to nutritious and sufficient food, even if they may not necessarily be suffering from hunger. In 2024, an estimated 28.0 percent of the world population, or 2.28 billion people, has experienced food insecurity at moderate or severe levels. There are many causes of food insecurity. The most important ones are high food prices and disruptions in global food supplies for example due to war. Climate change, water scarcity, land degradation, agricultural diseases, pandemics and disease outbreaks can also create food insecurity. Additionally, food insecurity affects individuals with low socioeconomic status, affects the health of a population on an individual level, and causes divisions in interpersonal relationships. Food insecurity due to unemployment causes a higher rate of poverty. The effects of food insecurity can include hunger and even famines. Chronic food insecurity translates into a high degree of vulnerability to hunger and famine. Chronic hunger and malnutrition in childhood can lead to stunted growth of children. Once stunting has occurred, improved nutritional intake after the age of about two years is unable to reverse the damage. Severe malnutrition in early childhood often leads to defects in cognitive development. About 2.3 billion people in the world are estimated to have been moderately or severely food insecure in 2024. The global prevalence of moderate or severe food insecurity has declined gradually since 2021, reaching 28.0% in 2024. Food insecurity is on the rise in Africa and falling in Latin America and the Caribbean; it has been decreasing gradually in Asia for several consecutive years, while in Oceania and in Northern America and Europe, new estimates point to a slight decline from 2023 to 2024 following a several-year rise.
World Food Summit in 1996 declared that "food should not be used as an instrument for political and economic pressure." Food insecurity goes beyond hunger; it includes people who do not have regular access to nutritious and sufficient food, even if they may not necessarily be suffering from hunger. In 2024, an estimated 28.0 percent of the world population, or 2.28 billion people, has experienced food insecurity at moderate or severe levels. There are many causes of food insecurity. The most important ones are high food prices and disruptions in global food supplies for example due to war. Climate change, water scarcity, land degradation, agricultural diseases, pandemics and disease outbreaks can also create food insecurity. Additionally, food insecurity affects individuals with low socioeconomic status, affects the health of a population on an individual level, and causes divisions in interpersonal relationships. Food insecurity due to unemployment causes a higher rate of poverty. The effects of food insecurity can include hunger and even famines. Chronic food insecurity translates into a high degree of vulnerability to hunger and famine. Chronic hunger and malnutrition in childhood can lead to stunted growth of children. Once stunting has occurred, improved nutritional intake after the age of about two years is unable to reverse the damage. Severe malnutrition in early childhood often leads to defects in cognitive development. About 2.3 billion people in the world are estimated to have been moderately or severely food insecure in 2024. The global prevalence of moderate or severe food insecurity has declined gradually since 2021, reaching 28.0% in 2024. Food insecurity is on the rise in Africa and falling in Latin America and the Caribbean; it has been decreasing gradually in Asia for several consecutive years, while in Oceania and in Northern America and Europe, new estimates point to a slight decline from 2023 to 2024 following a several-year rise.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (28): "ada", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "residents".... | EXACT TITLE in nonprofits_community: "College of Western Idaho". | EXACT TITLE in childcare_family: "College of Western Idaho".
adaboisecampuscanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicresidentsservedsouthweststudentstransfertreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
N
Q163740 EXACT TITLE 1.000
QID OVERLAP: Q163740 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (33): "benefit", "business", "churches", "clubs", "community", "donations", "entities", "faith", "finance", "hospitals", "institution", "local", "meaning", "mission", "nonprofit", "operated", "operates", "operations", "organization", "organizations".... | EXACT TITLE in nonprofits_community: "Nonprofit organization". | EXACT TITLE in childcare_family: "Nonprofit organization".
benefitbusinesschurchesclubscommunitydonationsentitiesfaithfinancehospitalsinstitutionlocalmeaningmissionnonprofitoperatedoperatesoperationsorganizationorganizationsownersprivateprogrampublicpurposeratherreceiverevenueschoolssocial+3
PO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Formation and structure In the United States, nonprofit organizations are formed by filing bylaws, articles of incorporation, or both in the state in which they expect to operate. The act of incorporation creates a legal entity enabling the organization to be treated as a distinct body (corporation) by law and to enter into business dealings, form contracts, and own property as individuals or for-profit corporations can. There is an important distinction in the US between non-profit and not-for-profit organizations (NFPOs); while an NFPO does not profit its owners, and money goes into running the organization, it is not required to operate for the public good. An example is a sports club, whose purpose is its members' enjoyment. The names used and precise regulations vary from one jurisdiction to another. Nonprofits can have members, but many do not. The nonprofit may also be a trust or association of members. The organization may be controlled by its members who elect the board of directors, board of governors, or board of trustees. A nonprofit may have a delegate structure to allow for the representation of groups or corporations as members. Alternatively, it may be a non-membership organization and the board of directors may elect its own successors. The two major types of nonprofit organizations are membership and board-only. A membership organization elects the board and has regular meetings and the power to amend the bylaws. A board-only organization typically has a self-selected board and a membership whose powers are limited to those delegated to it by the board. A board-only organization's bylaws may even state that the organization does not have any membership, although the organization's literature may refer to its donors or service recipients as 'members'. Examples of such organizations are FairVote and the National Organization for the Reform of Marijuana Laws. The Model Nonprofit Corporation Act imposes many complexities and requirements on membership decision-making. Accordingly, many organizations, such as the Wikimedia Foundation, have formed board-only structures. The National Association of Parliamentarians has generated concerns about the implications of this trend for the future of openness, accountability, and understanding of public concerns in nonprofit organizations. Specifically, they note that nonprofit organizations, unlike business corporations, are not subject to market discipline for products and shareholder discipline of their capital; therefore, without membership control of major decisions such as the election of the board, there are few inherent safeguards against abuse. A rebuttal to this might be that as nonprofit organizations grow and seek larger donations, the degree of scrutiny increases, including expectations of audited financial statements. A further rebuttal might be that NPOs are constrained, by their choice of legal structure, from financial benefit as far as distribution of profit to members and directors is concerned. In United States According to the National Center for Charitable Statistics (NCCS), there are more than 1.5 million nonprofit organizations registered in the United States, including public charities, private foundations, and other nonprofit organizations. According to the Giving USA 2025 report, which details philanthropic data from 2024, charitable giving in the United States reached an estimated $557.08 billion. In addition to financial support, volunteering remains a cornerstone of the sector. A 2025 report from AmeriCorps found that 56.7 million adults formally volunteered with an organization, contributing an estimated $145 billion in economic value to their communities. In the United States, both nonprofit organizations and not-for-profit organizations may be tax-exempt. There are various types of nonprofit exemptions, such as 501(c)(3) organizations that are a religious, charitable, or educational-based organization that does not influence state and federal legislation, and 501(c)(7) organizations that are for pleasure, recreation, or another nonprofit purpose. There is an important distinction in the US between non-profit and not-for-profit organizations (NFPOs). While an NFPO does not profit its owners, and money goes into running the organization, it is not required to operate for the public good. An example is a club whose purpose is its members' enjoyment. Other examples of NFPOs include credit unions, sports clubs, and advocacy groups. Nonprofit organizations provide services to the community such as aid and development programs, medical research, education, and health services. Some nonprofits are both member-serving and community-serving. Examples of these are homeowners associations, the American Red Cross, and Habitat for Humanity.
Alternative names Some organizations offer new, positive-sounding alternative terminology to describe the sector. The term civil society organization (CSO) has been used by a growing number of organizations, including the Center for the Study of Global Governance. The term citizen sector organization (CSO) has also been advocated to describe the sector – as one of citizens, for citizens – by organizations including Ashoka: Innovators for the Public. Advocates argue that these terms describe the sector in its own terms, without relying on terminology used for the government or business sectors. However, use of terminology by a nonprofit of self-descriptive language that is not legally compliant risks confusing the public about nonprofit abilities, capabilities, and limitations. Tax exemption In some countries nonprofits may apply for tax-exempt status. Tax exemptions have been justified by community benefit of some organizations. Studies argue that the community benefits of non-profits have be overestimated and can be negative compared to for-profit organizations when including the cost of the tax exemptions and costs due to financial mismanagement. The discretionary process of tax exemptions application can result in corruption or fraud. In the United States, to be exempt from federal income taxes, the organization must meet the requirements set forth in the Internal Revenue Code (IRC). Granting nonprofit status is done by the state, while granting tax-exempt designation (such as IRC 501(c)) is granted by the federal government via the IRS. This means that not all nonprofits are eligible to be tax-exempt. For example, employees of non-profit organizations pay taxes from their salaries, which they receive according to the laws of the country. NPOs use the model of a double bottom line in that furthering their cause is more important than making a profit, though both are needed to ensure the organization's sustainability. An advantage of nonprofits registered in the UK is that they benefit from some reliefs and exemptions. Charities and nonprofits are exempt from Corporation Tax as well as the trustees being exempt from Income Tax.
C
Q5048341 EXACT TITLE 0.980
QID OVERLAP: Q5048341 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (14): "care", "case", "community", "coordination", "firms", "general", "health", "individuals", "law", "legal", "management", "medical", "system", "treatment". | EXACT TITLE in nonprofits_community: "Case management". | EXACT TITLE in childcare_family: "Case management".
carecasecommunitycoordinationfirmsgeneralhealthindividualslawlegalmanagementmedicalsystemtreatment
ent may refer to: Case management (mental health), a specific approach for the coordination of community mental health services Case management (US health system), a specific term used in the health care system of the United States of America Medical case management, a general term referring to the facilitation of treatment plans to assure the appropriate medical care is provided to disabled, ill or
P
Q185733 EXACT TITLE 0.980
QID OVERLAP: Q185733 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (14): "business", "form", "increase", "long-term", "material", "philanthropy", "practices", "present", "private", "providing", "provision", "public", "quality", "rather". | EXACT TITLE in nonprofits_community: "Philanthropy". | EXACT TITLE in childcare_family: "Philanthropy".
businessformincreaselong-termmaterialphilanthropypracticespresentprivateprovidingprovisionpublicqualityrather
life". Philanthropy tends to be used interchangeably with the term charity. Charity has been noted in Egypt, centuries before the Christian era, having religious origins. Philanthropy contrasts with business initiatives, which are private initiatives for private good, focusing on material gain; and with government endeavors that are public initiatives for public good, such as those that focus on the provision of public services. Present day philanthropy has evolved into providing long-term aid and change, rather than immediate relief.
Philanthropists, such as anti-slavery campaigner William Wilberforce, began to adopt active campaigning roles, where they would champion a cause and lobby the government for legislative change. This included organized campaigns against the ill-treatment of animals and children and the campaign that succeeded in ending the slave trade throughout the Empire starting in 1807. Although there were no slaves allowed in Britain itself, many rich men owned sugar plantations in the West Indies, and resisted the movement to buy them out until it finally succeeded in 1833. Financial donations to organized charities became fashionable among the middle class in the 19th century. By 1869 there were over 200 London charities with an annual income, all together, of about £2 million. By 1885, rapid growth had produced over 1000 London charities, with an income of about £4.5 million. They included a wide range of religious and secular goals, with the American import, YMCA, as one of the largest, and many small ones, such as the Metropolitan Drinking Fountain Association. In addition to making annual donations, increasingly wealthy industrialists and financiers left generous sums in their wills. A sample of 466 wills in the 1890s revealed a total wealth of £76 million, of which £20 million was bequeathed to charities. By 1900 London charities enjoyed an annual income of about £8.5 million. Led by the energetic Lord Shaftesbury (1801–1885), philanthropists organized themselves. In 1869 they set up the Charity Organisation Society. It was a federation of district committees, one in each of the 42 Poor Law divisions. Its central office had experts in coordination and guidance, thereby maximizing the impact of charitable giving to the poor. Many of the charities were designed to alleviate the harsh living conditions in the slums. such as the Labourer's Friend Society founded in 1830. This included the promotion of allotment of land to labourers for "cottage husbandry" that later became the allotment movement. In 1844 it became the first Model Dwellings Company—an organization that sought to improve the housing conditions of the working classes by building new homes for them, while at the same time receiving a competitive rate of return on any investment. This was one of the first housing associations, a philanthropic endeavor that flourished in the second half of the nineteenth century, brought about by the growth of the middle class. Later associations included the Peabody Trust, and the Guinness Trust. The principle of philanthropic intention with capitalist return was given the label "five per cent philanthropy." Switzerland In 1863, the Swiss businessman Henry Dunant used his fortune to fund the Geneva Society for Public Welfare, which became the International Committee of the Red Cross. During the Franco-Prussian War of 1870, Dunant personally led Red Cross delegations that treated soldiers. He shared the first Nobel Peace Prize for this work in 1901. The International Committee of the Red Cross (ICRC) played a major role in working with POWs on all sides in World War II. It was in a cash-starved position when the war began in 1939, but quickly mobilized its national offices to set up a Central Prisoner of War Agency. For example, it provided food, mail and assistance to 365,000 British and Commonwealth soldiers and civilians held captive.
The first corporation founded in the Thirteen Colonies was Harvard College (1636), designed primarily to train young men for the clergy. A leading theorist was the Puritan theologian Cotton Mather (1662–1728), who in 1710 published a widely read essay, "Bonifacius, or an Essay to Do Good". Mather worried that the original idealism had eroded, so he advocated philanthropic benefaction as a way of life. Though his context was Christian, his idea was also characteristically American and explicitly Classical, on the threshold of the Enlightenment. Benjamin Franklin (1706–1790) was an activist and theorist of American philanthropy. He was much influenced by Daniel Defoe's An Essay upon Projects (1697) and Cotton Mather's Bonifacius: an essay upon the good (1710). Franklin attempted to motivate his fellow Philadelphians into projects for the betterment of the city: examples included the Library Company of Philadelphia (the first American subscription library), the fire department, the police force, street lighting, and a hospital. A world-class physicist himself, he promoted scientific organizations including the Philadelphia Academy (1751) – which became the University of Pennsylvania – as well as the American Philosophical Society (1743), to enable scientific researchers from all 13 colonies to communicate. By the 1820s, newly rich American businessmen were initiating philanthropic work, especially with respect to private colleges and hospitals. George Peabody (1795–1869) is the acknowledged father of modern philanthropy. A financier based in Baltimore and London, in the 1860s, he began to endow libraries and museums in the United States and also funded housing for poor people in London.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "historically", "idaho", "land", "local", "lower", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in nonprofits_community: "Treasure Valley". | EXACT TITLE in childcare_family: "Treasure Valley".
associationboisehistoricallyidaholandlocallowerregionresourcesriverruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Volunteering
Q188844 EXACT TITLE 0.920
QID OVERLAP: Q188844 in nonprofits_community (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (11): "act", "community", "education", "group", "individual", "labor", "provide", "response", "training", "volunteers", "work". | EXACT TITLE in nonprofits_community: "Volunteering".
actcommunityeducationgroupindividuallaborprovideresponsetrainingvolunteerswork
Volunteering is an optional and freely chosen act of an individual or group giving their time and labor, often for community service. Many volunteers have specialized training in the fields that they work in, such as medicine, education, or emergency rescue.
Volunteering as utilized by service learning programs Many schools on all education levels offer service-learning programs, which allow students to serve the community through volunteering while earning educational credit. According to Alexander Astin in the foreword to Where's the Learning in Service-Learning? by Janet Eyler and Dwight E. Giles, Jr., "...we promote more wide-spread adoption of service-learning in higher education because we see it as a powerful means of preparing students to become more caring and responsible parents and citizens and of helping colleges and universities to make good on their pledge to 'serve society.'" When describing service learning, the Medical Education at Harvard says, "Service learning unites academic study and volunteer community service in mutually reinforcing ways. ...service learning is characterized by a relationship of partnership: the student learns from the service agency and from the community and, in return, gives energy, intelligence, commitment, time and skills to address human and community needs." Volunteering in service learning seems to have the result of engaging both mind and heart, thus providing a more powerful learning experience; according to Janet Eyler and Dwight E. Giles, it succeeds by the fact that it "...fosters student development by capturing student interest..." More recent scholarship has found shortcomings in the early assumptions of mutual benefit, since early studies were interested in educational benefits rather than community outcomes. An Indiana study found that the nonprofit agencies hosting student service-learners do not report a positive impact on service capacity, although service-learners do help to increase agency visibility.
Micro-volunteering is a task performed via an internet-connected device. An individual typically does this task in small, un-paid increments of time. Micro-volunteering is distinct from "virtual volunteering" in that it typically does not require the individual volunteer to go through an application process, screening process, or training period. Environmental volunteering Environmental volunteering refers to the volunteers who contribute towards environmental management or conservation. Volunteers conduct a range of activities including environmental monitoring, ecological restoration such as re-vegetation and weed removal, protecting endangered animals, and educating others about the natural environment.Community-led initiatives such as Bus Stop Boys have contributed to improving urban sanitation in Accra.
Nampa, Idaho
Q622633 QID OVERLAP 0.890
QID OVERLAP: Q622633 in nonprofits_community (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meaning", "nampa", "population", "principal", "second", "university", "western". | URL->A (1): http://www.nampa.com/.
boisecanyoncollegehomeidahomeaningnampapopulationprincipalseconduniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
S
EXACT TITLE 0.800
QID OVERLAP: Q7574442 in nonprofits_community (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (5): "applicable", "district", "land", "uses", "zoning". | EXACT TITLE in childcare_family: "Special-use permit".
applicabledistrictlanduseszoning
A special-use permit authorizes land uses that are allowed and encouraged by the ordinance and declared harmonious with the applicable zoning district. Purpose Land use is governed by a set of regulations generally known as ordinances or municipal codes, which are authorized by the state's zoning enabling law. Within an ordinance is a list of land use designations commonly known as zoning. Each different type of zone has its own set of allowed uses. These are known as by-right uses. Then there is an extra set of uses known as special uses. To build a use that is listed as a special use, a special-use permit (or conditional-use permit) must be obtained. An example of a special-use permit may be found in a church applying for one to construct a church building in a residential neighborhood. Although the church building is not a residential building, the zoning law may allow for churches in the residential neighborhood if the local zoning authority may review the impact on the neighborhood.
Abuse If the local zoning authority grants a special-use permit that exceeds the discretion allowed to it, then an incidence of spot zoning may arise. Such discretion then may be attacked as ultra vires, and the special-use permit overturned as an unconstitutional violation of equal protection. Special-use permits are also required when a property has been deemed a "nonconforming use." A permit for a nonconforming use will allow the owner of a previously-compliant property to continue the existing use. This often arises when a property has been rezoned or amortized. Amortization is unconstitutional in many states, and is a controversial tool according to many property rights advocacy groups. An example of special-use-permit abuse may be found when a business or other organization is using U.S. Forest Service land for commercial use. Special-use permits may be revoked after the initial period if it is deemed to have not met the proposed public need. This then allows for another operator to apply for the special-use permit which will be evaluated on whether they are likely to succeed and meet the public need as well as follow all other criteria such as proper resource management and respectful public use.
Other uses Special land-use permits are also issued by the U.S. Forest Service for the operation of ski areas and other recreational facilities in national forests. These facilities are operated by commercial providers who help the public in a way that would not otherwise be helped by the U.S. Forest Service. The U.S. Forest Service does not run the facility itself and is not the one providing the benefits that the commercial business provides. Special-use permits have also been issued for other purposes, such as in Alaska during the summer of 2015, when special fishing permits were issued to feed firefighters who had difficulty receiving supplies via land routes due to the forest fires that they were fighting in remote areas. In broadcasting, a restricted service licence (UK) or special temporary authority (US) may be issued by a broadcasting authority for temporary changes or set-ups for a radio station or television station.
Zoning in the United States
Q8073994 QID OVERLAP 0.800
QID OVERLAP: Q8073994 in nonprofits_community (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (39): "affordability", "against", "among", "authority", "availability", "began", "construction", "district", "districts", "early", "economic", "explicitly", "homelessness", "homes", "housing", "increase", "jurisdiction", "land", "local", "lower"....
affordabilityagainstamongauthorityavailabilitybeganconstructiondistrictdistrictsearlyeconomicexplicitlyhomelessnesshomeshousingincreasejurisdictionlandlocallowermajoroperatingoppositionplanningpolicepropertyprovisionpublicrealresidential+9
te to inequality, a weaker economy, and racial housing segregation in the United States. Zoning laws that prioritize single-family housing have raised concerns regarding housing availability, housing affordability and environmental harms. In the U.S., support for local zoning against multifamily housing is concentrated among white, affluent homeowners. There are no substantial differences between liberal and conservative homeowners in their opposition to the construction of dense housing in their neighborhoods.
21st century In the early 21st century, several local and state governments across the United States have been relaxing or abolishing specific zoning classes (e.g. single-family zoning) to address various issues that have arisen as a result of zoning, such as housing affordability crises and racial and socio-economic segregation.
California In September 2021, the state of California adopted Senate Bill 9 allowing the development of up to four residential units on single-family lots, following a growing push from local governments such as Berkeley (set to phase out single-family zoning by December 2022), San Jose and other cities across the state. Massachusetts In 2000, Republican governor Paul Cellucci of Massachusetts passed the Community Preservation Act for housing affordability. In 2004, Republican governor Mitt Romney adopted the 40R law which provided financial incentives to cities, suburbs, and towns to adopt zoning legislation for new rental and condo units around rail stations. In 2012, Democratic governor Deval Patrick expanded 40R with Compact Neighborhoods, incentivizing zoning for denser, multifamily housing near rail and transit hubs across the Commonwealth. In November 2017, Republican governor Charlie Baker introduced the Housing Choice reform (adopted in January 2021), including relaxing the requirement of a two-thirds majority to a simple majority at the local level to pass zoning amendments for new housing, a requirement for 175 cities and towns in the Greater Boston area to rezone land for denser, multi-family housing near MBTA stations, and financial means of compliance to new zoning regulations on top of existing incentives. Unlike California, where the state legislature has taken a more leading role in local zoning reform, the focus in Massachusetts is on local government control of zoning policy changes; both approaches have their advantages and disadvantages. In February 2024, residents in the Town of Milton, a Boston suburb, voted to not comply with the law. Massachusetts Attorney General Andrea Joy Campbell has filed suit to force compliance.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (17): "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "north", "population", "river", "technology", "treasure", "valley".
adaannualblockboisecapitalcountiesemployershomeidaholocallymajornorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Public housing
Q6532502 QID OVERLAP 0.800
QID OVERLAP: Q6532502 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (40): "administered", "administrative", "affordable", "agencies", "agency", "assistance", "authority", "central", "department", "development", "different", "directly", "distinct", "exchange", "families", "form", "generally", "home", "housing", "individual"....
administeredadministrativeaffordableagenciesagencyassistanceauthoritycentraldepartmentdevelopmentdifferentdirectlydistinctexchangefamiliesformgenerallyhomehousingindividuallandlordslocallow-incomenationalneedsnonprofitoperatedorganizationsownersprivate+10
housing developments are classified as housing projects that are owned by a housing authority or a low-income (project-based voucher) property. PBV are a component of a public housing agency. PBVs, administered by state and local housing agencies, are distinct from Section 8 Project-Based Rental Assistance (PBRA), a program through which property owners' contract directly with the Department of Housing and Urban Development (HUD) to rent units to families with low incomes. Affordable housing goals can also be achieved through subsidies. Subsidized housing is owned and operated by private owners who receive subsidies in exchange for providing affordable housing.
The public-owned housing system was established when the Chinese Communist Party started a planned economy in the 1950s as part of its Great Leap Forward. The system was funded by the central government's budget and were administered and distributed by state-owned enterprises. The occupants of the public housing were usually the employees of the enterprises and their family, who were subject to pay rent at a very low price. The size and the type of room the households received were dependent on their job title or administrative level. The central government found it difficult to upkeep the public housing due to the low rent it received; the distribution policy that was intended to be "egalitarian" was actually corrupt. The Chinese government commercialized the housing market after the reform and opening up started in 1978 by Deng Xiaoping. The public houses that were constructed before that the economic reforms were categorized as "Old Public Houses" (Chinese: 老公房). "Old Public Houses" were, in principle, not supposed to be privately sold, but the household could sell it after purchasing the ownership of the building (not the property), and such transactions were subject to be review by local housing authorities and the State-owned Assets Supervision and Administration Commission. However, an informal filing system and unclear policies resulted in problems of corruption and family dispute. The concept of the low-cost rental housing can be traced to a 1998 policy statement, but did not truly take off until 2006 due to limited funding and administrative problems. The provision of more affordable housing is one of the key components of China's Twelfth Five-year Plan, which targets the construction of 36 million homes by 2015.
Belgium Social housing is a responsibility of the regions in Belgium. The regions do not directly own the houses, semi-private social housing corporations do. The government regulates and mostly finances these corporations. Below a certain income limit, people are eligible for social housing. Because there is a major shortage of social housing in Belgium, other priority conditions are often imposed, such as having children to care for. Social housing accounts for approximately 6.5% of the Belgian housing market. This is much lower than neighbouring countries such as the Netherlands and France. As of 2018, Flanders, Wallonia and Brussels are responsible for 280,687 social houses, 212,794 people are on the waiting list. For the people on the waiting list there are other possibilities such as subsidies and sociale rental agencies in Flanders. Denmark In Denmark, public housing is called alment boligbyggeri and is owned and administered by approximately 700 self-governing, democratic and non-profit organizations by and for the tenants themselves. Many of the public housing organizations in Denmark are rooted in the early history of the labor unions and currently forms about 20% of the total housing stock with about 7,500 departments countrywide. A membership of a housing organization is usually required to obtain a rental and they are granted with regard to length of membership. Although the buildings are owned and administered by self-governing and economically independent organizations, the State of Denmark is strongly regulating public housing in the country. By law, the municipalities have access to 25% of the rentals, usually reserving them for the poor, the unemployed, the disabled or mentally ill or any other group dependent on social benefits from the municipality. Over the years, these regulations have created many 'vulnerable residential areas' within the country. Danish public housing has never had any income restrictions, but in recent years new state regulations has made it mandatory for several of them to favor fully employed renters and disfavor unemployed or part-time employed people. This is a relatively new effort by the state to counter the ghettoisation, which is now an officially recognized problem countrywide. As in Sweden, state and municipal policies carried out throughout the first decade of the 21st century, has led to an increased privatization of public housing. In many areas, residents have been offered to buy their own flats, thereby effectively changing the status of the property. The privatization of public housing was initiated as part of an ideological program by the right wing governments of the early 21st century and was launched a few years after the closure of the former Ministry of Housing Affairs in 2001.
Historic preservation
Q914856 EXACT TITLE 0.780
QID OVERLAP: Q914856 in nonprofits_community (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (4): "development", "historic", "maintains", "preservation". | EXACT TITLE in nonprofits_community: "Historic preservation". | EXACT TITLE in childcare_family: "Historic preservation".
developmenthistoricmaintainspreservation
s, objects, landscapes or other artifacts of historical significance. It is a philosophical concept that became popular in the twentieth century, which maintains that cities as products of centuries' development should be obligated to protect their patrimonial legacy.
A historic district in the United States is a group of buildings, properties, or sites that have been designated by one of several entities on different levels as historically or architecturally significant. Buildings, structures, objects and sites within a historic district are normally divided into two categories, contributing and non-contributing. Districts greatly vary in size, some having hundreds of structures while others have just a few. The U.S. federal government designates historic districts through the U.S. Department of Interior, under the auspices of the National Park Service. Federally designated historic districts are listed on the National Register of Historic Places. Historic districts allows rural areas to preserve their characters through historic preservation programs. These include "Main Street" programs that can be used to redevelop rural downtowns.
All of Australia's major cities have had historic or heritage preservation establishments and legislation in place since the mid to late 1970s, though destruction or outright demolition of historic buildings continues in most Australian cities to this day, subject to council or planning approval, particularly outside of the city centres in historic neighbourhoods. Melbourne was founded in 1835 and grew enormously in wealth and prosperity following the 1850s gold rush, which resulted in a construction boom: large edifices were erected to serve as public buildings such as libraries, court houses, schools, churches, and offices. This led to a period where Melbourne became known as "Marvellous Melbourne", boasting the largest collection of Victorian architecture outside of England. However, in the years that followed, and as the thousands of Australian soldiers arrived back from the battlefields following the end of World War I there emerged a sense of renewed pride and a willingness to forget the dark days of war and distance Australian from its Victorian origins, considered "unfashionable" or "outdated" by some. The Council of the City of Melbourne was no doubt buoyed by this new nationalistic pride and put in place schemes to modernize the city which included increasing the building height limit and removing some of the Victorian era cast ironwork. In the years leading up to World War II the Whelan the Wrecker firm had already pulled down thousands of structures in both the city and surrounding suburbs, as Melbourne became particularly conscious of International Modernism. James Paul Whelan's obituary of 1938 suggests that his company had the task of demolishing up to 98% of buildings marked for removal in the city alone. The rise of this International Modernism saw a new approach that valued replacing older, elaborate inefficient buildings with new ones. An early example of this was a City of Melbourne by-law in 1954 that mandated the demolition of all posted cast-iron verandas, thought to be dangerous as well as old fashioned, in order to 'clean up' the city before the 1956 Summer Olympics. Sydney (Australia's oldest city) was also affected by the International Modernism period and also suffered an extensive loss of its Victorian architecture, something that subsisted well into the 1980s. From the 1950s onwards, many of Sydney's handsome sandstone and masonry buildings were wiped away by architects and developers who built "brown concrete monstrosities" in their place. The 1980s saw "uncomfortable pastiches of facades with no coherence and little artistic merit". Green bans in Australian cities such as Sydney and Melbourne came into effect in the 1970s and the Australian Heritage Commission (AHS), was established by the Federal Government in 1975 by the Australian Heritage Commission Act 1975 as the first body to manage natural and cultural heritage in Australia until its demise in 2004. It was responsible for the Register of the National Estate. The Australian National Heritage List was established in 2003. Controversy arose in 2016 in Melbourne after the historic Corkman Irish Pub was illegally demolished overnight, resulting in the State Planning Minister pursuing an order (via the Victorian Administrative Appeals Tribunal) for the two-story pub to be rebuilt. The site owners were fined AUD$1.325 million after pleading guilty to the process. In the city of Adelaide, large public protests erupted in the 1980s regarding the 1983 campaign to save the Aurora Hotel in Hindmarsh Square, which had been recommended for listing on the city heritage register but refused because the site was to be redeveloped. The protest led to the emergence of Aurora Heritage Action, Inc. (AHA), which became the most vocal heritage lobby group in Adelaide during the decade, often working in cooperation with residents' associations and later the National Trust. While governments were urged to protect the traditional character of Adelaide, capital became more widely available for development. The large increase in property development from 1987 increased opposition to further demolition of Adelaide's historic buildings. Local councils and lobbyists alike aimed to expand the horizon of heritage to protect historic precincts across the city, even if buildings within those precincts did not warrant heritage listing. The Bannon government slowly responded to public demand and introduced historic (conservation) zones through a revision to the Planning Act (1982) in 1989.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in nonprofits_community (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "population", "private", "second".
adaboisecapitaldistricthomeidahojurisdictionlocalpopulationprivatesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
C
Q5196473 QID OVERLAP 0.660
QID OVERLAP: Q5196473 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "customer", "decisions", "experience", "form", "professional", "purchasing", "review", "sites".
customerdecisionsexperienceformprofessionalpurchasingreviewsites
A customer review is an evaluation of a product or service made by someone who has purchased and used, or had experience with, a product or service. Customer reviews are a form of customer feedback on electronic commerce and online shopping sites. There are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users.
here are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines.
or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines. These methods still exist today although internet review sites are used more in recent years. Reliability The reliability of customer reviews has been questioned. Abuses akin to ballot stuffing of favourable reviews by the seller (known as incentivized reviews), or negative reviews by competitors, need to be policed by the review host site. Indeed, gathering fake reviews has become big business. In 2012, for example, fake book reviews have been revealed as significantly affecting ratings on Amazon. In 2016 Amazon banned the practice of reviewing complimentary products, researchers have shown that the process still continued as of 2021, but without any disclosures. Since few sites restrict users to reviewing only items they have actually purchased, it is difficult to know if a customer is real, has actually used the product they are reviewing, and is giving honest, unbiased feedback about the product or services being reviewed. Tools like Fakespot and ReviewMeta can help spot fake reviews on shopping sites like Amazon. Unfortunately, the tools do not work on most other websites that show customer reviews. Public calls have been growing stronger, demanding that review sites be held accountable for publishing fake reviews. Most recently (June 2021), the Competition and Markets Authority (CMA) in the United Kingdom has launched an investigation into whether Amazon and Google are doing enough to prevent fake reviews from being published on their sites. Both businesses claim to have sufficient resources and policies in place to prevent fake reviews from being published. Legal steps could be taken against the giants if CMA determines those claims to be false.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "population", "second".
adaamongboisecapitalidahomakingpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in nonprofits_community (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "locally", "population".
boisecaldwellcanyoncollegeidaholocallypopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
222 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP222 edges
🌲 EVERGREEN1 edges
0.650
after-schoolagecarechildchildrenearlyeducationnetworkoperatedoperatesownersprivateprogramsproviderprovidingschools
SHARED TOKENS (16): "after-school", "age", "care", "child", "children", "early", "education", "network", "operated", "operates", "owners", "private", "programs", "provider", "providing", "schools". | URL->B (1): https://www.roarkcapital.com/files/Primrose-Press_Release.pdf. | EXACT TITLE in childcare_family: "Primrose Schools".
🌿 BRANCH182 edges
0.500
YMCA ↗ Q157169 EXACT TITLE
activitiesassociationbodydevelopmentfacilitiesgeographicallyindependentlocalnationalorganizationorganizationspeoplepracticeprogramsprovidingregionalstaffstatedsubjectvolunteers
SHARED TOKENS (22): "activities", "association", "body", "development", "facilities", "geographically", "independent", "local", "national", "organization", "organizations", "people", "practice", "programs", "providing", "regional", "staff", "stated", "subject", "volunteers".... | EXACT TITLE in childcare_family: "YMCA".
0.500
Orphanage ↗ Q160645 EXACT TITLE
abusecannotcarecenterschildchildrencommunitiescontroldescribeddiffersfamiliesfamilyfundfundinggenerallygroupgroupshomehomesincrease
SHARED TOKENS (40): "abuse", "cannot", "care", "centers", "child", "children", "communities", "control", "described", "differs", "families", "family", "fund", "funding", "generally", "group", "groups", "home", "homes", "increase".... | EXACT TITLE in childcare_family: "Orphanage".
0.500
adultsageauthoritycannotcaredecisionsfamilyfoundguardianshiphousingindividuallegalmakingmeaningmedicalotherwiseprofessionalpropertypublicrelevant
SHARED TOKENS (22): "adults", "age", "authority", "cannot", "care", "decisions", "family", "found", "guardianship", "housing", "individual", "legal", "making", "meaning", "medical", "otherwise", "professional", "property", "public", "relevant".... | EXACT TITLE in nonprofits_community: "Legal guardian".
0.500
Parenting ↗ Q1217379 EXACT TITLE
affectassociatedcarechildchildrendevelopmenteducationalfamilyfosterhistoryinfluencelegallong-termolderoutcomesparentsphysicalprocessproviderproviders
SHARED TOKENS (27): "affect", "associated", "care", "child", "children", "development", "educational", "family", "foster", "history", "influence", "legal", "long-term", "older", "outcomes", "parents", "physical", "process", "provider", "providers".... | EXACT TITLE in childcare_family: "Parenting".
0.500
agechildcarechildrencoordinationdesigneddevelopmentdifferentdisabilitiesfacilitiesgroupshelpinformalinstitutionsolderpeoplephysicalprovideprovidingpublicrecreation
SHARED TOKENS (26): "age", "childcare", "children", "coordination", "designed", "development", "different", "disabilities", "facilities", "groups", "help", "informal", "institutions", "older", "people", "physical", "provide", "providing", "public", "recreation".... | EXACT TITLE in childcare_family: "Playground".
0.500
Family court ↗ Q82749 EXACT TITLE
addressagainstchildcreateddecisionsdifferentdistinctionequityfamilyjurisdictionslawlegalmattersrelationshipsrequirementsrulessupportsystem
SHARED TOKENS (18): "address", "against", "child", "created", "decisions", "different", "distinction", "equity", "family", "jurisdictions", "law", "legal", "matters", "relationships", "requirements", "rules", "support", "system". | EXACT TITLE in childcare_family: "Family court".
0.500
abusecannotcategorycentercenterschurchdepartmentsgroupshomelesshomesmanagementorganizationspeopleprocessprovidepurposeresponseschoolsheltershelters
SHARED TOKENS (26): "abuse", "cannot", "category", "center", "centers", "church", "departments", "groups", "homeless", "homes", "management", "organizations", "people", "process", "provide", "purpose", "response", "school", "shelter", "shelters".... | EXACT TITLE in nonprofits_community: "Emergency shelter".
0.500
amongaroundcarechildcostdifferenteducationevenexperiencefamilyhealthhealthcareincomeindividualsinvestmentlivingplanningreduceresultingthough
SHARED TOKENS (20): "among", "around", "care", "child", "cost", "different", "education", "even", "experience", "family", "health", "healthcare", "income", "individuals", "investment", "living", "planning", "reduce", "resulting", "though". | EXACT TITLE in childcare_family: "Maternal health".
0.500
administrationbusinessdevelopmentmanagementpolicypreparesprivateprofessionalprogrampublicrequiresrolesstudentstraininguniversitywork
SHARED TOKENS (16): "administration", "business", "development", "management", "policy", "prepares", "private", "professional", "program", "public", "requires", "roles", "students", "training", "university", "work". | EXACT TITLE in nonprofits_community: "Master of Public Administration".
0.500
accessactiveadultsageallowassistancecentercenterscommunityeventsfacilityfederalfinancialfundinghelplimitedlocalmultiplemunicipalneeds
SHARED TOKENS (34): "access", "active", "adults", "age", "allow", "assistance", "center", "centers", "community", "events", "facility", "federal", "financial", "funding", "help", "limited", "local", "multiple", "municipal", "needs".... | EXACT TITLE in nonprofits_community: "Senior center".
0.500
Legal aid ↗ Q707748 EXACT TITLE
accessassistancecentralclientscommunitycostdescribesdevelopmentessentialfinancialfreegeneralindividualsinformallawlegallowermodelsoutsidepeople
SHARED TOKENS (26): "access", "assistance", "central", "clients", "community", "cost", "describes", "development", "essential", "financial", "free", "general", "individuals", "informal", "law", "legal", "lower", "models", "outside", "people".... | EXACT TITLE in nonprofits_community: "Legal aid".
0.500
actamongblockbuildingcommunitiescommunitycreatecreateddepartmentdevelopmententitlementestablishedfederalgrantgrantshousinglawnationalprogramprovisions
SHARED TOKENS (21): "act", "among", "block", "building", "communities", "community", "create", "created", "department", "development", "entitlement", "established", "federal", "grant", "grants", "housing", "law", "national", "program", "provisions".... | EXACT TITLE in nonprofits_community: "Housing and Community Development Act of 1974".
0.500
activecommunitydepartmentsdifferentdisabilitiesfacefamiliesfundinghealthhelphomelessnesshousingindividualspeopleprofessionalstablework
SHARED TOKENS (17): "active", "community", "departments", "different", "disabilities", "face", "families", "funding", "health", "help", "homelessness", "housing", "individuals", "people", "professional", "stable", "work". | EXACT TITLE in nonprofits_community: "Supportive housing".
0.500
aroundcommunitycoordinateddesigneddonationsfacilityfamilyfoundationgrantindividualinvestmentlocalmakingprivatesinglesocialsociety
SHARED TOKENS (17): "around", "community", "coordinated", "designed", "donations", "facility", "family", "foundation", "grant", "individual", "investment", "local", "making", "private", "single", "social", "society". | EXACT TITLE in nonprofits_community: "Community foundation".
0.500
activitiesbenefitbusinessescorporatedemonstratedependdonationseducationalentitiesevaluatorsfinancialformfundsincomeindividualinformationinvestmentlawleadershiplegal
SHARED TOKENS (41): "activities", "benefit", "businesses", "corporate", "demonstrate", "depend", "donations", "educational", "entities", "evaluators", "financial", "form", "funds", "income", "individual", "information", "investment", "law", "leadership", "legal".... | EXACT TITLE in nonprofits_community: "Charitable organization".
0.500
Family ↗ Q8436 EXACT TITLE
categorieschildrencommunitycreateeconomiceconomicsfamiliesfamilygrouphistoricallyhistoryorganizationsparentspeopleprimarypurposerelatedrelationshipsafetysocial
SHARED TOKENS (22): "categories", "children", "community", "create", "economic", "economics", "families", "family", "group", "historically", "history", "organizations", "parents", "people", "primary", "purpose", "related", "relationship", "safety", "social".... | EXACT TITLE in nonprofits_community: "Family". | EXACT TITLE in childcare_family: "Family".
0.500
activitiesaddressageassociatedcannotcarecommunityconditionscoordinateddisabilityfacilitieshelphomehomesincreasinglylivinglong-termmealmedicalmultiple
SHARED TOKENS (30): "activities", "address", "age", "associated", "cannot", "care", "community", "conditions", "coordinated", "disability", "facilities", "help", "home", "homes", "increasingly", "living", "long-term", "meal", "medical", "multiple".... | EXACT TITLE in nonprofits_community: "Long-term care".
0.500
Living wage ↗ Q543406 EXACT TITLE
additionaladvocatesallowauthoritybasiccampaignscarechildcreateddefineddemanddiffersdiscoveryeconomiceconomicsemploymenteventsfamilyfoodhealth
SHARED TOKENS (46): "additional", "advocates", "allow", "authority", "basic", "campaigns", "care", "child", "created", "defined", "demand", "differs", "discovery", "economic", "economics", "employment", "events", "family", "food", "health".... | EXACT TITLE in childcare_family: "Living wage".
0.500
Workforce ↗ Q13440398 EXACT TITLE
alignedcannotchildrendefinedemploymentforceotherwiseparticipationpeoplepopulationresultsstatedtextworkworkforce
SHARED TOKENS (15): "aligned", "cannot", "children", "defined", "employment", "force", "otherwise", "participation", "people", "population", "results", "stated", "text", "work", "workforce". | EXACT TITLE in nonprofits_community: "Workforce". | EXACT TITLE in childcare_family: "Workforce".
0.500
activitiesarrangementdepartmentdevelopmentdistributionestablishedfundsgroupgroupshousinglegallocalmissionnonprofitorganizationorganizationspracticeprojectrelatedstatus
SHARED TOKENS (22): "activities", "arrangement", "department", "development", "distribution", "established", "funds", "group", "groups", "housing", "legal", "local", "mission", "nonprofit", "organization", "organizations", "practice", "project", "related", "status".... | EXACT TITLE in nonprofits_community: "Fiscal sponsorship".
0.500
accountadministeredagricultureassistancebenefitchildrencostsdepartmentdepartmentsdependsdirectlydistributeddivisionexchangefederalfoodhealthhelphistoryhousehold
SHARED TOKENS (35): "account", "administered", "agriculture", "assistance", "benefit", "children", "costs", "department", "departments", "depends", "directly", "distributed", "division", "exchange", "federal", "food", "health", "help", "history", "household".... | EXACT TITLE in nonprofits_community: "Supplemental Nutrition Assistance Program".
0.500
addressingbusinessescommunitiesconstructioneconomicgrowthhousinginfrastructurelandlow-incomeminorityprivateprocesspublicrenewalurban
SHARED TOKENS (16): "addressing", "businesses", "communities", "construction", "economic", "growth", "housing", "infrastructure", "land", "low-income", "minority", "private", "process", "public", "renewal", "urban". | EXACT TITLE in nonprofits_community: "Urban renewal".
0.500
designeddiffersexperiencefamilyformgenerallyhomelesshomelessnesshousehousingidentifyingindividualslegallivingneedspeoplepopulationsprimaryprivatepublic
SHARED TOKENS (28): "designed", "differs", "experience", "family", "form", "generally", "homeless", "homelessness", "house", "housing", "identifying", "individuals", "legal", "living", "needs", "people", "populations", "primary", "private", "public".... | EXACT TITLE in nonprofits_community: "Homelessness". | EXACT TITLE in childcare_family: "Homelessness".
0.500
actagainstagecompletedcoordinateddataenforcementengagementevenformfrequentlygeneralhealthindividuallawlevelslong-termparentspartnerspeople
SHARED TOKENS (30): "act", "against", "age", "completed", "coordinated", "data", "enforcement", "engagement", "even", "form", "frequently", "general", "health", "individual", "law", "levels", "long-term", "parents", "partners", "people".... | EXACT TITLE in nonprofits_community: "Sexual violence".
0.500
accessaddressaddressingamongbarriersbusinessescapacitycommunitydevelopersdevelopmenteconomiceducationemployersequityformformalhistoricallyhistoryhomehousehold
SHARED TOKENS (56): "access", "address", "addressing", "among", "barriers", "businesses", "capacity", "community", "developers", "development", "economic", "education", "employers", "equity", "form", "formal", "historically", "history", "home", "household".... | EXACT TITLE in nonprofits_community: "Workforce development".
0.500
agearoundcarecentralchildchildrencollegecostscurriculumdescribeddevelopmentdevelopmentalearlyearly-childhoodeducationeducationaleducatorsentitiesfederalfoundation
SHARED TOKENS (50): "age", "around", "care", "central", "child", "children", "college", "costs", "curriculum", "described", "development", "developmental", "early", "early-childhood", "education", "educational", "educators", "entities", "federal", "foundation".... | EXACT TITLE in childcare_family: "Early childhood education".
0.500
authoritycentercommunitydifferentdirectlyeducationeducationalestateinstitutionlanguagelocalschoolschoolsservesstaffstate-fundedstudentsstudytype
SHARED TOKENS (19): "authority", "center", "community", "different", "directly", "education", "educational", "estate", "institution", "language", "local", "school", "schools", "serves", "staff", "state-funded", "students", "study", "type". | EXACT TITLE in nonprofits_community: "Community school".
0.500
abuseactagainstageamongbroaderchildchildrencontextcontrolcreatediffersdirectdisabilitiesdocumentationearlyestablishedexistsexperiencefamily
SHARED TOKENS (43): "abuse", "act", "against", "age", "among", "broader", "child", "children", "context", "control", "create", "differs", "direct", "disabilities", "documentation", "early", "established", "exists", "experience", "family".... | EXACT TITLE in nonprofits_community: "Domestic violence".
0.500
agecarecentercenterschildchildrencommunitiescommunitycoordinatedcoordinationcountiesdesigneddevelopmentaldifferentdisabilitiesdistrictsearlyeducationeligibleexperience
SHARED TOKENS (55): "age", "care", "center", "centers", "child", "children", "communities", "community", "coordinated", "coordination", "counties", "designed", "developmental", "different", "disabilities", "districts", "early", "education", "eligible", "experience".... | EXACT TITLE in childcare_family: "Early Head Start".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsaffordableannualassetscarechildrencostcostscovereddisabilitieseconomiceligibilityestablishedexpandedfamiliesfederalfinancialfunding
SHARED TOKENS (57): "access", "act", "adults", "affordable", "annual", "assets", "care", "children", "cost", "costs", "covered", "disabilities", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "funding".... | EXACT TITLE in nonprofits_community: "Medicaid". | EXACT TITLE in childcare_family: "Medicaid".
0.500
additionaladultsageauthoritybenefitcapacitychildchildrencontextcreatedatadependencydevelopmentdifferearlygeneralincreasinglyinterventionjurisdictionlegal
SHARED TOKENS (41): "additional", "adults", "age", "authority", "benefit", "capacity", "child", "children", "context", "create", "data", "dependency", "development", "differ", "early", "general", "increasingly", "intervention", "jurisdiction", "legal".... | EXACT TITLE in childcare_family: "Juvenile court".
0.500
addressadministeredagencyassistanceavailabilitycarechildrenconnectededucationfacilitiesfamiliesfirefoodfunctiongenerallygroupshealthhousingindependentindividuals
SHARED TOKENS (39): "address", "administered", "agency", "assistance", "availability", "care", "children", "connected", "education", "facilities", "families", "fire", "food", "function", "generally", "groups", "health", "housing", "independent", "individuals".... | EXACT TITLE in nonprofits_community: "Social services". | EXACT TITLE in childcare_family: "Social services".
0.500
estatefoundationfundsgenerallylegalorganizationphilanthropyplanningprivatepublicregisteredrelyreportingrequirementsservesupporttype
SHARED TOKENS (17): "estate", "foundation", "funds", "generally", "legal", "organization", "philanthropy", "planning", "private", "public", "registered", "rely", "reporting", "requirements", "serve", "support", "type". | EXACT TITLE in nonprofits_community: "Private foundation".
0.500
Disability ↗ Q12131 EXACT TITLE
accessaccessibilityactivitiesactivityagainstaroundbarrierscategoriescenterscommunitycreateddefinesdevelopmentaldifferentdisabilitiesdisabilityexperienceexplainfosterframework
SHARED TOKENS (53): "access", "accessibility", "activities", "activity", "against", "around", "barriers", "categories", "centers", "community", "created", "defines", "developmental", "different", "disabilities", "disability", "experience", "explain", "foster", "framework".... | EXACT TITLE in nonprofits_community: "Disability". | EXACT TITLE in childcare_family: "Disability".
0.500
affiliateassetscapitalequityfinancialfundgrowthinvestmentmakesmanagementmeaningminoritypartnerprivatesignificanttechnology
SHARED TOKENS (16): "affiliate", "assets", "capital", "equity", "financial", "fund", "growth", "investment", "makes", "management", "meaning", "minority", "partner", "private", "significant", "technology". | EXACT TITLE in childcare_family: "Golden Gate Capital".
0.500
adaadjacentboisedepartmentdistrictdistrictseducationeducationalenrollmentidahojurisdictionpublicratesschoolschoolssecondservessystemwestern
SHARED TOKENS (19): "ada", "adjacent", "boise", "department", "district", "districts", "education", "educational", "enrollment", "idaho", "jurisdiction", "public", "rates", "school", "schools", "second", "serves", "system", "western". | EXACT TITLE in childcare_family: "Boise School District".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessactivitiesaffordablebackgroundcarecaregivercenterscheckschildchildcarechildrencommunitiescontextdevelopmentearlyeconomiceducationeducationalessentialfacility
SHARED TOKENS (50): "access", "activities", "affordable", "background", "care", "caregiver", "centers", "checks", "child", "childcare", "children", "communities", "context", "development", "early", "economic", "education", "educational", "essential", "facility".... | EXACT TITLE in childcare_family: "Child care".
0.500
accessassociationcoordinationcostsdevelopmentdiffereconomicestateexcludedfinancialfrequentlyfundinggeneralgeographichigherindustryinfrastructureinvestmentlevelslocal
SHARED TOKENS (49): "access", "association", "coordination", "costs", "development", "differ", "economic", "estate", "excluded", "financial", "frequently", "funding", "general", "geographic", "higher", "industry", "infrastructure", "investment", "levels", "local".... | EXACT TITLE in nonprofits_community: "Public transport".
0.500
activitiesaffordableanti-povertyblockcommunitydepartmentdevelopmentdiffersfederalfundsgrantgrantshousinginfrastructurelocaloversightprogramprogramsprovidingstated
SHARED TOKENS (22): "activities", "affordable", "anti-poverty", "block", "community", "department", "development", "differs", "federal", "funds", "grant", "grants", "housing", "infrastructure", "local", "oversight", "program", "programs", "providing", "stated".... | EXACT TITLE in nonprofits_community: "Community Development Block Grant".
0.500
administrationassistancebeganbenefitblockcashchildrencreatesdepartmentdesigneddivisioneducationaleligibleentitlementfamiliesfederalfundsgranthealthhome
SHARED TOKENS (37): "administration", "assistance", "began", "benefit", "block", "cash", "children", "creates", "department", "designed", "division", "educational", "eligible", "entitlement", "families", "federal", "funds", "grant", "health", "home".... | EXACT TITLE in childcare_family: "Temporary Assistance for Needy Families".
0.500
businessbusinessescapacitycasecommercialcustomerdefinedexpandedfamiliesfamilygenerallyhelphomehouseofficeoperateoperatedoperatesownerparking
SHARED TOKENS (27): "business", "businesses", "capacity", "case", "commercial", "customer", "defined", "expanded", "families", "family", "generally", "help", "home", "house", "office", "operate", "operated", "operates", "owner", "parking".... | EXACT TITLE in childcare_family: "Home business".
0.500
administrativeauthoritybegancountiesdefineddifferentdistrictdistrictsentitiesformgeographicindependentlawleastlegallylocallocallymultipleplacespopulation
SHARED TOKENS (26): "administrative", "authority", "began", "counties", "defined", "different", "district", "districts", "entities", "form", "geographic", "independent", "law", "least", "legally", "local", "locally", "multiple", "places", "population".... | EXACT TITLE in nonprofits_community: "County (United States)". | EXACT TITLE in childcare_family: "County (United States)".
0.500
Indeed ↗ EXACT TITLE
additionalaroundbegancentralcomdirectlyemployersemploymentfirmsindependentrecruitrevenuesearchsinglesitestaffingthousandsvertical
SHARED TOKENS (18): "additional", "around", "began", "central", "com", "directly", "employers", "employment", "firms", "independent", "recruit", "revenue", "search", "single", "site", "staffing", "thousands", "vertical". | EXACT TITLE in childcare_family: "Indeed".
0.500
advocatescasedifferentenforcementevenexecutiveexperiencefamilygeneralgenerallyindividualjurisdictionjurisdictionslawlegalmattersofficialpracticeprincipalpublic
SHARED TOKENS (23): "advocates", "case", "different", "enforcement", "even", "executive", "experience", "family", "general", "generally", "individual", "jurisdiction", "jurisdictions", "law", "legal", "matters", "official", "practice", "principal", "public".... | EXACT TITLE in nonprofits_community: "Attorney general".
0.500
Internship ↗ Q6500754 EXACT TITLE
adultsagenciesbenefitbusinesseschoicecollegecurrentemployersemploymentexchangeexperiencefuturegroupsindustryinvestmentlearninglimitedmedicalnetworkorganization
SHARED TOKENS (43): "adults", "agencies", "benefit", "businesses", "choice", "college", "current", "employers", "employment", "exchange", "experience", "future", "groups", "industry", "investment", "learning", "limited", "medical", "network", "organization".... | EXACT TITLE in nonprofits_community: "Internship".
0.500
benefitbodybusinesscorporatedevelopmentfoundationfundfundingfundsgrantgrantsindividualinstitutionlocalmissionorganizationpublicpurposeregionalresearch
SHARED TOKENS (22): "benefit", "body", "business", "corporate", "development", "foundation", "fund", "funding", "funds", "grant", "grants", "individual", "institution", "local", "mission", "organization", "public", "purpose", "regional", "research".... | EXACT TITLE in nonprofits_community: "Grant (money)". | EXACT TITLE in childcare_family: "Grant (money)".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesapplicablebasicchainchildrencommunitiesconditionscontactdefineddevelopmentexistsgeneralgrowthhealthlevelslimitedmaintainingoperatingpeople
SHARED TOKENS (33): "access", "activities", "applicable", "basic", "chain", "children", "communities", "conditions", "contact", "defined", "development", "exists", "general", "growth", "health", "levels", "limited", "maintaining", "operating", "people".... | EXACT TITLE in childcare_family: "Sanitation".
0.500
Caregiver ↗ Q553079 EXACT TITLE
activitiesagecannotcarecaregivercentersdisabilitydocumentationfamilyformalhealthcarehomehomeshospitalshouseholdinformallivinglong-termpeoplepersonnel
SHARED TOKENS (26): "activities", "age", "cannot", "care", "caregiver", "centers", "disability", "documentation", "family", "formal", "healthcare", "home", "homes", "hospitals", "household", "informal", "living", "long-term", "people", "personnel".... | EXACT TITLE in nonprofits_community: "Caregiver". | EXACT TITLE in childcare_family: "Caregiver".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationscarecaseclinicalcliniciansconditionsdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcarehigherhome
SHARED TOKENS (41): "access", "administration", "application", "applications", "care", "case", "clinical", "clinicians", "conditions", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare", "higher", "home".... | EXACT TITLE in childcare_family: "Telehealth".
0.500
aroundbuildingcommunitiescommunitydevelopmentdistinctexperiencefunctioninggeographicallygeographyhealthmakingmodelnetworksoperateoperatingorganizationorganizationsorganizingshared
SHARED TOKENS (25): "around", "building", "communities", "community", "development", "distinct", "experience", "functioning", "geographically", "geography", "health", "making", "model", "networks", "operate", "operating", "organization", "organizations", "organizing", "shared".... | EXACT TITLE in nonprofits_community: "Community organization". | EXACT TITLE in childcare_family: "Community organization".
0.500
authoritybeganbuildingcasecodecodescomplianceconstructioncontroldepartmentsdesigndevelopersdistrictestatefacilitygeneralgenerallyhealthinsurancejurisdiction
SHARED TOKENS (41): "authority", "began", "building", "case", "code", "codes", "compliance", "construction", "control", "departments", "design", "developers", "district", "estate", "facility", "general", "generally", "health", "insurance", "jurisdiction".... | EXACT TITLE in nonprofits_community: "Building code".
0.500
accessadditionalarrangementbehavioralbenefitcommunitycurriculumdesigneddevelopmentaldifferentdisabilitieseducationeducationaleducatorsgeneralhelphigherindividualindividualslearning
SHARED TOKENS (35): "access", "additional", "arrangement", "behavioral", "benefit", "community", "curriculum", "designed", "developmental", "different", "disabilities", "education", "educational", "educators", "general", "help", "higher", "individual", "individuals", "learning".... | EXACT TITLE in childcare_family: "Special education".
0.500
associationbusinessclubscommunitiescommunitydefineddirectessentialestablishedgroupsgrowthhistoricallyhospitalsidentifyinstitutionsinvolvementmissionnonprofitofficialorganization
SHARED TOKENS (29): "association", "business", "clubs", "communities", "community", "defined", "direct", "essential", "established", "groups", "growth", "historically", "hospitals", "identify", "institutions", "involvement", "mission", "nonprofit", "official", "organization".... | EXACT TITLE in nonprofits_community: "Service club".
0.500
affordabilityaffordableassociatedchoicedemandeconomicformalgenerallyhomehomelesshomelessnesshouseholdhousingincomeinformallocalmarketsnationalownershipresponse
SHARED TOKENS (23): "affordability", "affordable", "associated", "choice", "demand", "economic", "formal", "generally", "home", "homeless", "homelessness", "household", "housing", "income", "informal", "local", "markets", "national", "ownership", "response".... | EXACT TITLE in nonprofits_community: "Affordable housing". | EXACT TITLE in childcare_family: "Affordable housing".
0.500
Care work ↗ Q5038877 EXACT TITLE
activitiesaddressassociatedcarecenterschildcommunitiesconditionscostdatadescribeddevelopmentdevelopmentaldirectdistributionemploymentfacefamiliesfamilyform
SHARED TOKENS (45): "activities", "address", "associated", "care", "centers", "child", "communities", "conditions", "cost", "data", "described", "development", "developmental", "direct", "distribution", "employment", "face", "families", "family", "form".... | EXACT TITLE in childcare_family: "Care work".
0.500
activitiesagearoundblockbodybuildingcapacitycarechildchildrencreatesdefineddevelopmentdevelopmentalearlyeducationalestablishedfoundationidentityincrease
SHARED TOKENS (41): "activities", "age", "around", "block", "body", "building", "capacity", "care", "child", "children", "creates", "defined", "development", "developmental", "early", "educational", "established", "foundation", "identity", "increase".... | EXACT TITLE in childcare_family: "Child development".
0.500
activitiesaffordablebuildingconstructionequityfamiliesfinancialgenerallyhelphomeshousingindividualsinfrastructurelaborlow-incomemakesmedianonprofitoperatesorganization
SHARED TOKENS (24): "activities", "affordable", "building", "construction", "equity", "families", "financial", "generally", "help", "homes", "housing", "individuals", "infrastructure", "labor", "low-income", "makes", "media", "nonprofit", "operates", "organization".... | EXACT TITLE in nonprofits_community: "Habitat for Humanity".
0.500
activitiesamongbackgroundcheckscompletecomprehensiveeducationemployeremploymenthistoryindividualindividualsprocesspurposerecordsearchsecurity
SHARED TOKENS (17): "activities", "among", "background", "checks", "complete", "comprehensive", "education", "employer", "employment", "history", "individual", "individuals", "process", "purpose", "record", "search", "security". | EXACT TITLE in nonprofits_community: "Background check". | EXACT TITLE in childcare_family: "Background check".
0.500
Franchising ↗ Q171947 EXACT TITLE
arrangementbrandedbusinesscapitalchainconditionscorporatedirecteconomicexpansionexplicitlyfeesfinancialgrowthindividualinvestmentlegallicenseslicensingmarket
SHARED TOKENS (34): "arrangement", "branded", "business", "capital", "chain", "conditions", "corporate", "direct", "economic", "expansion", "explicitly", "fees", "financial", "growth", "individual", "investment", "legal", "licenses", "licensing", "market".... | EXACT TITLE in childcare_family: "Franchising".
0.500
actchildcarechildrencomprehensivecurrentdepartmentdesigneddevelopmentalearlyeducationestablishexpandedfamiliesfamilyfederalfosterhealthinvolvementlow-incomenetwork
SHARED TOKENS (31): "act", "childcare", "children", "comprehensive", "current", "department", "designed", "developmental", "early", "education", "establish", "expanded", "families", "family", "federal", "foster", "health", "involvement", "low-income", "network".... | EXACT TITLE in childcare_family: "Head Start (program)".
0.500
againstarrangementcoveringcreatingdifferentevenhostincreasejurisdictionmultipleparticipationpatternpatternsrequirespecifiedvertical
SHARED TOKENS (16): "against", "arrangement", "covering", "creating", "different", "even", "host", "increase", "jurisdiction", "multiple", "participation", "pattern", "patterns", "require", "specified", "vertical". | EXACT TITLE in nonprofits_community: "Bingo (American version)".
0.500
aloneassistancebeganchildrenfamiliesfamilyfosterhelphomehomeshouseinstitutionspolicypreservationratherwork
SHARED TOKENS (16): "alone", "assistance", "began", "children", "families", "family", "foster", "help", "home", "homes", "house", "institutions", "policy", "preservation", "rather", "work". | EXACT TITLE in nonprofits_community: "Family preservation".
0.500
alignedaloneamongchurchchurchescommunitycostsdifferseducationestablishesexecutivefundinggeneralgroupshomelessinstitutionmajormissionnationalneeds
SHARED TOKENS (37): "aligned", "alone", "among", "church", "churches", "community", "costs", "differs", "education", "establishes", "executive", "funding", "general", "groups", "homeless", "institution", "major", "mission", "national", "needs".... | EXACT TITLE in childcare_family: "Salvation Army".
0.500
addressbroadercentersconnecteddesigndevelopmentdifferentdistinctindependentknowledgemanagementmaterialnetworkorganizationorganizationalpeopleprovidersprovidingqualityrelated
SHARED TOKENS (30): "address", "broader", "centers", "connected", "design", "development", "different", "distinct", "independent", "knowledge", "management", "material", "network", "organization", "organizational", "people", "providers", "providing", "quality", "related".... | EXACT TITLE in nonprofits_community: "Sociotechnical system".
0.500
Form 990 ↗ Q22905923 EXACT TITLE
agenciescomprehensiveformhealthcarehospitalsincomeinformationnonprofitorganizationorganizationspublicreportingrequirementsrevenuestatus
SHARED TOKENS (15): "agencies", "comprehensive", "form", "healthcare", "hospitals", "income", "information", "nonprofit", "organization", "organizations", "public", "reporting", "requirements", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 990".
0.500
Fiduciary ↗ Q537098 EXACT TITLE
actamongapplicableassetsbenefitcapacitycarecorporatedepartmentdifferentdiffersequityfaithfinancialfundsgrouphigherhistoricallyinvestmentjurisdictions
SHARED TOKENS (34): "act", "among", "applicable", "assets", "benefit", "capacity", "care", "corporate", "department", "different", "differs", "equity", "faith", "financial", "funds", "group", "higher", "historically", "investment", "jurisdictions".... | EXACT TITLE in nonprofits_community: "Fiduciary".
0.500
caldwellcampuscounselingcrisisfamiliesfundinggovernedhouseidahonorthoperatesoperatingprogramprogramsservesheltersourcetherapyvolunteeryouth
SHARED TOKENS (20): "caldwell", "campus", "counseling", "crisis", "families", "funding", "governed", "house", "idaho", "north", "operates", "operating", "program", "programs", "serve", "shelter", "source", "therapy", "volunteer", "youth". | EXACT TITLE in nonprofits_community: "Idaho Youth Ranch".
0.480
accountadministeredcashcreateddonationsfamiliesfinancialfundindividualindividualsorganizationorganizationsownershippublic
SHARED TOKENS (14): "account", "administered", "cash", "created", "donations", "families", "financial", "fund", "individual", "individuals", "organization", "organizations", "ownership", "public". | EXACT TITLE in nonprofits_community: "Donor-advised fund".
0.480
administrativeamongassociationcapacitygeneralhistorynationalnorthofficialpracticeprimaryrecordsservedserving
SHARED TOKENS (14): "administrative", "among", "association", "capacity", "general", "history", "national", "north", "official", "practice", "primary", "records", "served", "serving". | EXACT TITLE in nonprofits_community: "Secretary of state (U.S. state government)".
0.480
activitiesagechildreneducationeducationalhomeinstitutionslearningoutsideparentsschoolservesocialwhose
SHARED TOKENS (14): "activities", "age", "children", "education", "educational", "home", "institutions", "learning", "outside", "parents", "school", "serve", "social", "whose". | EXACT TITLE in childcare_family: "Kindergarten".
0.480
applicantscarechildchildrendemonstratedevelopmentearlyeducationfamilygrowthhomeprofessionalprogramssupport
SHARED TOKENS (14): "applicants", "care", "child", "children", "demonstrate", "development", "early", "education", "family", "growth", "home", "professional", "programs", "support". | EXACT TITLE in childcare_family: "Child Development Associate".
0.480
Eviction ↗ Q1893186 EXACT TITLE
amongeveninvolvedjurisdictionjurisdictionslawlegalownerspracticeprocesspropertyprovisionsrelatedstructures
SHARED TOKENS (14): "among", "even", "involved", "jurisdiction", "jurisdictions", "law", "legal", "owners", "practice", "process", "property", "provisions", "related", "structures". | EXACT TITLE in nonprofits_community: "Eviction".
0.440
AmeriCorps ↗ Q511243 EXACT TITLE
actagencycommunitycreatedfundindependentitselfnationalofficialprogramsvolunteerwork
SHARED TOKENS (12): "act", "agency", "community", "created", "fund", "independent", "itself", "national", "official", "programs", "volunteer", "work". | EXACT TITLE in nonprofits_community: "AmeriCorps".
0.440
Preschool ↗ Q1076052 EXACT TITLE
agechildrenearlyeducationeducationalfundslearningoperatedprimarypublicschoolspace
SHARED TOKENS (12): "age", "children", "early", "education", "educational", "funds", "learning", "operated", "primary", "public", "school", "space". | EXACT TITLE in childcare_family: "Preschool".
0.440
agenciesbusinessescapitaldonationsfinancialindividualsnonprofitorganizationsprocessseekingthoughvoluntary
SHARED TOKENS (12): "agencies", "businesses", "capital", "donations", "financial", "individuals", "nonprofit", "organizations", "process", "seeking", "though", "voluntary". | EXACT TITLE in nonprofits_community: "Fundraising".
0.440
administrationcodecoveringdepartmentestatefederalincomelawrevenuestatutestatutorytitle
SHARED TOKENS (12): "administration", "code", "covering", "department", "estate", "federal", "income", "law", "revenue", "statute", "statutory", "title". | EXACT TITLE in nonprofits_community: "Internal Revenue Code".
0.420
assistancecannotchildrendonationsfundshospitalhospitalspeopleresearchtreatmenttype
SHARED TOKENS (11): "assistance", "cannot", "children", "donations", "funds", "hospital", "hospitals", "people", "research", "treatment", "type". | EXACT TITLE in nonprofits_community: "Charitable hospital".
0.420
agechildrenearlyeducationfederallyorganizationsprivateprogramroleschoolvoluntary
SHARED TOKENS (11): "age", "children", "early", "education", "federally", "organizations", "private", "program", "role", "school", "voluntary". | EXACT TITLE in childcare_family: "Pre-kindergarten".
0.420
activityamongcampusenrollmentidahopercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (11): "activity", "among", "campus", "enrollment", "idaho", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in nonprofits_community: "Idaho State University". | EXACT TITLE in childcare_family: "Idaho State University".
0.400
conditionseducationenforcementfireknowledgepracticespreventionreduceresponsethem
SHARED TOKENS (10): "conditions", "education", "enforcement", "fire", "knowledge", "practices", "prevention", "reduce", "response", "them". | EXACT TITLE in childcare_family: "Fire prevention".
0.400
activitieschurchesformgenerallyinfrastructurelaworganizationorganizationsplacespractice
SHARED TOKENS (10): "activities", "churches", "form", "generally", "infrastructure", "law", "organization", "organizations", "places", "practice". | EXACT TITLE in nonprofits_community: "Religious organization".
0.400
combinescommunitiescommunitycreatedesignededucationallearningneedsstudentsuses
SHARED TOKENS (10): "combines", "communities", "community", "create", "designed", "educational", "learning", "needs", "students", "uses". | EXACT TITLE in nonprofits_community: "Service-learning".
0.400
acquisitionbusinesscontextdefinedentitiesfinancialgrouplargertransfertreatment
SHARED TOKENS (10): "acquisition", "business", "context", "defined", "entities", "financial", "group", "larger", "transfer", "treatment". | EXACT TITLE in nonprofits_community: "Consolidation (business)".
0.400
Prenatal care ↗ EXACT TITLE
availabilitycareformhealthhealthcaremedicalnutritionparentscreeningtype
SHARED TOKENS (10): "availability", "care", "form", "health", "healthcare", "medical", "nutrition", "parent", "screening", "type". | EXACT TITLE in childcare_family: "Prenatal care".
0.380
incorporatedjurisdictionlawlegalmakingnonprofitofficialownerstreated
SHARED TOKENS (9): "incorporated", "jurisdiction", "law", "legal", "making", "nonprofit", "official", "owners", "treated". | EXACT TITLE in nonprofits_community: "Nonprofit corporation".
0.380
communitydirecthospitalspracticepracticesprofessionalqualifyingsocialwork
SHARED TOKENS (9): "community", "direct", "hospitals", "practice", "practices", "professional", "qualifying", "social", "work". | EXACT TITLE in nonprofits_community: "Master of Social Work".
0.380
Trail ↗ Q628179 EXACT TITLE
communitiesgenerallyhistoricallynorthpathplacessharedsmallthough
SHARED TOKENS (9): "communities", "generally", "historically", "north", "path", "places", "shared", "small", "though". | EXACT TITLE in nonprofits_community: "Trail".
0.380
businesscostsemployersknowledgeorganizationrecruitmentretentiontrainingworkforce
SHARED TOKENS (9): "business", "costs", "employers", "knowledge", "organization", "recruitment", "retention", "training", "workforce". | EXACT TITLE in childcare_family: "Employee retention".
0.380
Form 1023 ↗ Q30589159 EXACT TITLE
applicationcodeformgovnonprofitorganizationsportalrevenuestatus
SHARED TOKENS (9): "application", "code", "form", "gov", "nonprofit", "organizations", "portal", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 1023".
0.370
aroundassetsbusinesscapitalcentralequityfoodgrouphealthmanagementprivate
SHARED TOKENS (11): "around", "assets", "business", "capital", "central", "equity", "food", "group", "health", "management", "private". | URL->B (1): https://www.roarkcapital.com/portfolio.
0.360
agenciesdocumenteddocumentsgenerallyinformationjurisdictionpublicrecords
SHARED TOKENS (8): "agencies", "documented", "documents", "generally", "information", "jurisdiction", "public", "records". | EXACT TITLE in nonprofits_community: "Public records".
0.360
United Way ↗ Q3050859 EXACT TITLE
donationsindividuallocalnetworknonprofitorganizationpublicsingle
SHARED TOKENS (8): "donations", "individual", "local", "network", "nonprofit", "organization", "public", "single". | EXACT TITLE in nonprofits_community: "United Way".
0.320
Coalition ↗ Q124964 EXACT TITLE
economicfrequentlygroupgroupspeoplework
SHARED TOKENS (6): "economic", "frequently", "group", "groups", "people", "work". | EXACT TITLE in nonprofits_community: "Coalition".
0.300
agenciesannouncedbeginningleadershiplocalnationalnetworkofficeorganizationorganizationsphilanthropypositionsocialuniversityvoluntary
SHARED TOKENS (15): "agencies", "announced", "beginning", "leadership", "local", "national", "network", "office", "organization", "organizations", "philanthropy", "position", "social", "university", "voluntary".
0.300
accessadvocatesaffordableannualaroundassessmentassociationcannotchoicecostcostsdepartmentdevelopmentearlyeconomicevenfoodfoundgrantshealth
SHARED TOKENS (53): "access", "advocates", "affordable", "annual", "around", "assessment", "association", "cannot", "choice", "cost", "costs", "department", "development", "early", "economic", "even", "food", "found", "grants", "health"....
0.300
activearounddonationseligiblefaithfundinggrantsgrouplistlocallymissionorganizationorganizationssocialstafftypevolunteerswhose
SHARED TOKENS (18): "active", "around", "donations", "eligible", "faith", "funding", "grants", "group", "list", "locally", "mission", "organization", "organizations", "social", "staff", "type", "volunteers", "whose".
0.300
Food bank ↗ Q113603 KW CROSS HIGH
activeadministrationassistancebegancommunitiescommunityconditionscostscreatecrisisdependdirectlydistributioneconomicestablishedevenexperiencefinancialfoodgrowth
SHARED TOKENS (44): "active", "administration", "assistance", "began", "communities", "community", "conditions", "costs", "create", "crisis", "depend", "directly", "distribution", "economic", "established", "even", "experience", "financial", "food", "growth"....
0.300
activitieschildrencodeeducationalfederalincomeindividualslawnonprofitorganizationorganizationsprimarypublicreceiverequirementsrevenuesafetytype
SHARED TOKENS (18): "activities", "children", "code", "educational", "federal", "income", "individuals", "law", "nonprofit", "organization", "organizations", "primary", "public", "receive", "requirements", "revenue", "safety", "type".
0.300
Mutual aid ↗ KW CROSS HIGH
accessbarriersbenefitbeyondcommunitiescommunityconditionsdistincteconomiceducationexchangeexecutivefoodformfoundgrantgroupgroupshelpleadership
SHARED TOKENS (35): "access", "barriers", "benefit", "beyond", "communities", "community", "conditions", "distinct", "economic", "education", "exchange", "executive", "food", "form", "found", "grant", "group", "groups", "help", "leadership"....
0.300
activityadvocacyadvocatesagencyexecutivefederalfirmsformfreegroupsincreasinglyindependentindustryinfluencelocalmunicipalprofessionalpublicrecordregistered
SHARED TOKENS (28): "activity", "advocacy", "advocates", "agency", "executive", "federal", "firms", "form", "free", "groups", "increasingly", "independent", "industry", "influence", "local", "municipal", "professional", "public", "record", "registered"....
0.300
beginningcarechildconditionsdefineddescribesdistinctearlyfacilityfunctionhealthhospitalhoursleastlong-termmedicalorganizationorganizationsoutcomesproblem
SHARED TOKENS (27): "beginning", "care", "child", "conditions", "defined", "describes", "distinct", "early", "facility", "function", "health", "hospital", "hours", "least", "long-term", "medical", "organization", "organizations", "outcomes", "problem"....
0.300
administrationagenciesagencyamongapplicantscarecommercialdifferentfederalhealthindividualindividualsindustryjurisdictionlicenselicensedlicenseslicensurelinksmedical
SHARED TOKENS (34): "administration", "agencies", "agency", "among", "applicants", "care", "commercial", "different", "federal", "health", "individual", "individuals", "industry", "jurisdiction", "license", "licensed", "licenses", "licensure", "links", "medical"....
0.300
Charity shop ↗ Q153551 KW CROSS HIGH
buildingbusinesscostsdonatedfeesfreeincomelimitedmaintenancemunicipaloperatingorganizationphysicalpublicpurposesocialstatedtypevolunteers
SHARED TOKENS (19): "building", "business", "costs", "donated", "fees", "free", "income", "limited", "maintenance", "municipal", "operating", "organization", "physical", "public", "purpose", "social", "stated", "type", "volunteers".
0.300
Adoption ↗ Q180472 KW CROSS HIGH
carechildcomprehensivecontractsdesignedformalgovernedgoverningguardianshiphistoricallylegalparentparentsprocessrequiresrightsspecifiedstatussystemstransfer
SHARED TOKENS (20): "care", "child", "comprehensive", "contracts", "designed", "formal", "governed", "governing", "guardianship", "historically", "legal", "parent", "parents", "process", "requires", "rights", "specified", "status", "systems", "transfer".
0.300
Trauma-informed care ↗ KW CROSS HIGH
architecturebasicbodycarechoicecreatingeducationexposureframeworkhealthindividualsinformationlawmodelorganizationspatternspeoplepracticepresentprocessing
SHARED TOKENS (30): "architecture", "basic", "body", "care", "choice", "creating", "education", "exposure", "framework", "health", "individuals", "information", "law", "model", "organizations", "patterns", "people", "practice", "present", "processing"....
0.300
additionalassociationbodybusinesscontextdepartmentsemploymentformfunctiongroupgroupsincorporatedindividualsleastlocaloperationsorganizationorganizationspeopleprofessional
SHARED TOKENS (33): "additional", "association", "body", "business", "context", "departments", "employment", "form", "function", "group", "groups", "incorporated", "individuals", "least", "local", "operations", "organization", "organizations", "people", "professional"....
0.300
accessadministrationcreatedestablishedfundfundingindependentlawlegalnonprofitofficeoperationsorganizationsotherwisepercentpolicyprocessprogramsprovidingregional
SHARED TOKENS (23): "access", "administration", "created", "established", "fund", "funding", "independent", "law", "legal", "nonprofit", "office", "operations", "organizations", "otherwise", "percent", "policy", "process", "programs", "providing", "regional"....
0.300
accesschildchildrenconditionscreatescurriculumdatademonstratesdescribesdevelopmentaldisabilitiesdisabilitydocumentdocumentseducationeducationaleducatorseligibleexperiencefederal
SHARED TOKENS (49): "access", "child", "children", "conditions", "creates", "curriculum", "data", "demonstrates", "describes", "developmental", "disabilities", "disability", "document", "documents", "education", "educational", "educators", "eligible", "experience", "federal"....
0.300
Public art ↗ Q557141 KW CROSS HIGH
absenceadjacentcommercialcreatedcreationdirectformfunctiongeneralindependentmaintenancemeaningmedianearofficialoutsideprivateprocessprocurementprofessional
SHARED TOKENS (25): "absence", "adjacent", "commercial", "created", "creation", "direct", "form", "function", "general", "independent", "maintenance", "meaning", "media", "near", "official", "outside", "private", "process", "procurement", "professional"....
0.300
actcarechildchildrencommunitiescustodyfamiliesfederalfostergovernsjurisdictionlawplacementproceedingsresultingwelfare
SHARED TOKENS (16): "act", "care", "child", "children", "communities", "custody", "families", "federal", "foster", "governs", "jurisdiction", "law", "placement", "proceedings", "resulting", "welfare".
0.300
applicableassistancecasecommunitiescredentialsdescribeddevelopmenteducationformalfoundinformalinstitutionsknowledgelearningmentoringpracticeprofessionalprojectschoolsstudy
SHARED TOKENS (21): "applicable", "assistance", "case", "communities", "credentials", "described", "development", "education", "formal", "found", "informal", "institutions", "knowledge", "learning", "mentoring", "practice", "professional", "project", "schools", "study"....
0.300
activitiesactivityadministrationadministrativeagenciescontrolcreateddecisionsdivisioneconomiceducationenforcementexecutiveexpandedgenerallygoverningincreaseinfluenceitselflaw
SHARED TOKENS (30): "activities", "activity", "administration", "administrative", "agencies", "control", "created", "decisions", "division", "economic", "education", "enforcement", "executive", "expanded", "generally", "governing", "increase", "influence", "itself", "law"....
0.300
allowavailabilityconsumerfeegeneralhigherinformationmultipleneedsoperatorparticipatingprimaryprocessproviderssinglesitetypetypes
SHARED TOKENS (18): "allow", "availability", "consumer", "fee", "general", "higher", "information", "multiple", "needs", "operator", "participating", "primary", "process", "providers", "single", "site", "type", "types".
0.300
accessadditionaladultsageassociatedcarechildrenconnectedcontroldefinesearlyeducationalexperiencefacehealthhigherincomelaborlegallylevels
SHARED TOKENS (32): "access", "additional", "adults", "age", "associated", "care", "children", "connected", "control", "defines", "early", "educational", "experience", "face", "health", "higher", "income", "labor", "legally", "levels"....
0.300
School meal ↗ Q1195832 KW CROSS HIGH
addressadultsamongaroundbarriersbeginningchildrencrisiseducationfoodhelplocallow-incomemealprimaryprogramsprovidereceivereducesafety
SHARED TOKENS (30): "address", "adults", "among", "around", "barriers", "beginning", "children", "crisis", "education", "food", "help", "local", "low-income", "meal", "primary", "programs", "provide", "receive", "reduce", "safety"....
0.300
accessactivitiesactivitycompletedcreateddemandfacilitiesfreegeneralgenerallyindividualoutsidephysicalpopulationratherrecreationrenewalriskrivertraining
SHARED TOKENS (20): "access", "activities", "activity", "completed", "created", "demand", "facilities", "free", "general", "generally", "individual", "outside", "physical", "population", "rather", "recreation", "renewal", "risk", "river", "training".
0.300
affordableassistanceblockcreatedepartmentdesigneddevelopmentfamiliesfederalgranthomehousingincomeinvestmentlocallow-incomeoperatingpartnershippartnershipsprogram
SHARED TOKENS (24): "affordable", "assistance", "block", "create", "department", "designed", "development", "families", "federal", "grant", "home", "housing", "income", "investment", "local", "low-income", "operating", "partnership", "partnerships", "program"....
0.300
accessaffordableanalysischildrencomprehensivecostcostscrisisdatadocumentedeconomicestablishedfederalhealthhigherhistoricallyhistoryhomelessnesshousinginstability
SHARED TOKENS (39): "access", "affordable", "analysis", "children", "comprehensive", "cost", "costs", "crisis", "data", "documented", "economic", "established", "federal", "health", "higher", "historically", "history", "homelessness", "housing", "instability"....
0.300
activityadministrationadultsagealoneassociationchildrencirculationconditionscurrentearlyflowfunctiongeneralleastoutcomesprovidepurposeratherrequires
SHARED TOKENS (22): "activity", "administration", "adults", "age", "alone", "association", "children", "circulation", "conditions", "current", "early", "flow", "function", "general", "least", "outcomes", "provide", "purpose", "rather", "requires"....
0.300
absenceaddressadvocacyaroundassociationauthoritycapitalciviccommunitiescommunitycontextdefineddevelopmentengagementfostergenerallygeographicgeographicallyhousinglegal
SHARED TOKENS (46): "absence", "address", "advocacy", "around", "association", "authority", "capital", "civic", "communities", "community", "context", "defined", "development", "engagement", "foster", "generally", "geographic", "geographically", "housing", "legal"....
0.300
Municipality ↗ Q15284 KW CROSS HIGH
administrativebodycommunitiescorporatedistrictdivisionearlyexchangegoverningjurisdictionjurisdictionslimitedlocalnationalpermittingplacesregionalsinglesmallsocial
SHARED TOKENS (21): "administrative", "body", "communities", "corporate", "district", "division", "early", "exchange", "governing", "jurisdiction", "jurisdictions", "limited", "local", "national", "permitting", "places", "regional", "single", "small", "social"....
0.300
actactivitiesaddressassociationcentersclubsconsumercontroldefineddepartmentdevelopmentdirectlyeconomicentitiesevenformalfundinggenerallygroupgroups
SHARED TOKENS (45): "act", "activities", "address", "association", "centers", "clubs", "consumer", "control", "defined", "department", "development", "directly", "economic", "entities", "even", "formal", "funding", "generally", "group", "groups"....
0.300
certificationcompleteemployerexchangeformalfoundlaborlicenseoutsidepeopleplacementpracticeprofessionalregulatedrolesstudysystemtraining
SHARED TOKENS (18): "certification", "complete", "employer", "exchange", "formal", "found", "labor", "license", "outside", "people", "placement", "practice", "professional", "regulated", "roles", "study", "system", "training".
0.300
abuseagechildchildrencommunitiesdevelopmentdevelopmentaldisabilitiesearlyeducationalfamiliesinterventionlimitedmissionphysicalreceiveresourcesrisksocialsupport
SHARED TOKENS (22): "abuse", "age", "child", "children", "communities", "development", "developmental", "disabilities", "early", "educational", "families", "intervention", "limited", "mission", "physical", "receive", "resources", "risk", "social", "support"....
0.300
accesscarecentercenterscentralclientscommunitycoveredexpandedfamilygeneralgrouphealthhealthcarelivinglocallow-incomenetworkpeopleplanning
SHARED TOKENS (23): "access", "care", "center", "centers", "central", "clients", "community", "covered", "expanded", "family", "general", "group", "health", "healthcare", "living", "local", "low-income", "network", "people", "planning"....
0.300
childrenclubscodedevelopmenthealthleadershiplocalnetworknonprofitoperatesorganizationprogramsprovidingregionalsafeservessupporttitleyouth
SHARED TOKENS (19): "children", "clubs", "code", "development", "health", "leadership", "local", "network", "nonprofit", "operates", "organization", "programs", "providing", "regional", "safe", "serves", "support", "title", "youth".
0.300
actadministeredageassistancechildrendisabilitiesdisabilityeducationfederalfreegeneralindividualindividualsinformationlawlearningleastnationalneedsparent
SHARED TOKENS (31): "act", "administered", "age", "assistance", "children", "disabilities", "disability", "education", "federal", "free", "general", "individual", "individuals", "information", "law", "learning", "least", "national", "needs", "parent"....
0.300
Community art ↗ Q2801695 KW CROSS HIGH
actbusinessescenterscommunitiescommunitycorporatecreatedcreativedefineddevelopersdistricteventsforminvolvedlocalmedianationalnetworksorganizationsparticipation
SHARED TOKENS (26): "act", "businesses", "centers", "communities", "community", "corporate", "created", "creative", "defined", "developers", "district", "events", "form", "involved", "local", "media", "national", "networks", "organizations", "participation"....
0.300
accessaccessibilityaddressaffectingalonebarriersboundarycannotconditionscontrolcreatecurrentdesigneddevelopmentaldisabilitiesdisabilityevenexperienceextendsformal
SHARED TOKENS (46): "access", "accessibility", "address", "affecting", "alone", "barriers", "boundary", "cannot", "conditions", "control", "create", "current", "designed", "developmental", "disabilities", "disability", "even", "experience", "extends", "formal"....
0.300
actadditionaladministeredcarecategorieschildcovereddepartmentdivisioneligibleemployeremployersexcludedfacefamilyhourslaborlawleastmajor
SHARED TOKENS (29): "act", "additional", "administered", "care", "categories", "child", "covered", "department", "division", "eligible", "employer", "employers", "excluded", "face", "family", "hours", "labor", "law", "least", "major"....
0.300
Play therapy ↗ Q1542331 KW CROSS HIGH
accountassessmentbodycarechildrencodescontextdevelopmentdevelopmentalessentialgenerallyhealthindividualinstitutionsinterventionknowledgeneedspeoplepracticeprocess
SHARED TOKENS (29): "account", "assessment", "body", "care", "children", "codes", "context", "development", "developmental", "essential", "generally", "health", "individual", "institutions", "intervention", "knowledge", "needs", "people", "practice", "process"....
0.300
abuseadultsagechildchildrendisabilitylawlegallypeoplepolicereportreportingrequiredrisksubjectvulnerable
SHARED TOKENS (16): "abuse", "adults", "age", "child", "children", "disability", "law", "legally", "people", "police", "report", "reporting", "required", "risk", "subject", "vulnerable".
0.300
affectaffectingageamongexplicitlyfaceformfundinggroupgroupshousingmarketpatternssourcestatustreatment
SHARED TOKENS (16): "affect", "affecting", "age", "among", "explicitly", "face", "form", "funding", "group", "groups", "housing", "market", "patterns", "source", "status", "treatment".
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
addressaddressesaffectagainstcarechildrencommunitycomprehensivecostdifferenteducationemploymentfamilyformhealthcarehomelesshomelessnesshospitalshousehousehold
SHARED TOKENS (57): "address", "addresses", "affect", "against", "care", "children", "community", "comprehensive", "cost", "different", "education", "employment", "family", "form", "healthcare", "homeless", "homelessness", "hospitals", "house", "household"....
0.300
associationblockcategorycreatedcrisiscurrentdepartmenteventsfinancialincorporatedlocalmajorofficeprogrammingrecreationresponsesecondstaffsupportingurban
SHARED TOKENS (20): "association", "block", "category", "created", "crisis", "current", "department", "events", "financial", "incorporated", "local", "major", "office", "programming", "recreation", "response", "second", "staff", "supporting", "urban".
0.300
actanalysisapplicationauthoritycannotcategorycomplexitycreatedatadecisionsdescribesdesigndifferentevenfunctionfunctioninggeneralhealthcareidentifiedidentify
SHARED TOKENS (44): "act", "analysis", "application", "authority", "cannot", "category", "complexity", "create", "data", "decisions", "describes", "design", "different", "even", "function", "functioning", "general", "healthcare", "identified", "identify"....
0.300
communitiescomplaintsconnectedcontrolcustomerdatadigitalfeesgroupindividualinfluencemanagementmarketingmarketsnetworksnodesorganizationspeoplerelatedresults
SHARED TOKENS (26): "communities", "complaints", "connected", "control", "customer", "data", "digital", "fees", "group", "individual", "influence", "management", "marketing", "markets", "networks", "nodes", "organizations", "people", "related", "results"....
0.300
actaddressingamongcrisesdecisionsdepartmentdivisioneconomicfinancialgroupgroupshelpidentifiedindividualleadershiporganizationorganizationsrequireresourcesretention
SHARED TOKENS (23): "act", "addressing", "among", "crises", "decisions", "department", "division", "economic", "financial", "group", "groups", "help", "identified", "individual", "leadership", "organization", "organizations", "require", "resources", "retention"....
0.300
Art therapy ↗ Q928865 KW CROSS HIGH
allowassessmentclientsclinicalcontrolcreationcreativedifferentdistinctessentialfoundfunctiongrowthhealthhelpmeaningmedianationalpatternspeople
SHARED TOKENS (30): "allow", "assessment", "clients", "clinical", "control", "creation", "creative", "different", "distinct", "essential", "found", "function", "growth", "health", "help", "meaning", "media", "national", "patterns", "people"....
0.300
authoritybuildingbusinesscapitalcenterscommercialcontainingestatefarmfunctionshousingincomeinvestmentlandleastlevelslocalmedicalmultipleoffice
SHARED TOKENS (27): "authority", "building", "business", "capital", "centers", "commercial", "containing", "estate", "farm", "functions", "housing", "income", "investment", "land", "least", "levels", "local", "medical", "multiple", "office"....
0.300
capitalconsumerequitypartnersprivate
SHARED TOKENS (5): "capital", "consumer", "equity", "partners", "private". | EXACT TITLE in childcare_family: "Sycamore Partners".
0.300
additionaladultsagenciescarechildrendisabilitiesdisabilityfamilyhealthhomeindividualinstitutionallong-termneedspeopleratherrequiredresidentialsupportvoluntary
SHARED TOKENS (20): "additional", "adults", "agencies", "care", "children", "disabilities", "disability", "family", "health", "home", "individual", "institutional", "long-term", "needs", "people", "rather", "required", "residential", "support", "voluntary".
0.300
controldatadifferentdigitalforminformationlegalotherwiseprotectionpublicrelationshiptechnologythemtypesuses
SHARED TOKENS (15): "control", "data", "different", "digital", "form", "information", "legal", "otherwise", "protection", "public", "relationship", "technology", "them", "types", "uses".
0.300
administrationadvocatesaroundarrangementassetsbuildingcapitalcostcostsdevelopmentfinancialfinancingfundinghigherhospitalsinfrastructureinstitutionsinvestmentinvolvementlong-term
SHARED TOKENS (39): "administration", "advocates", "around", "arrangement", "assets", "building", "capital", "cost", "costs", "development", "financial", "financing", "funding", "higher", "hospitals", "infrastructure", "institutions", "investment", "involvement", "long-term"....
0.300
customerdesigneddistinctfamilyinfluenceinformationinitiativeinvolvementmarketingprimaryprocessreferralreferralssharetype
SHARED TOKENS (15): "customer", "designed", "distinct", "family", "influence", "information", "initiative", "involvement", "marketing", "primary", "process", "referral", "referrals", "share", "type".
0.300
First aid ↗ Q133981 KW CROSS HIGH
assistanceassociatedbasiccareearlygenerallyguidancehealthhelpindividualmedicalmovepeoplepreservationprofessionalprovisionpublicregulationrelationshiprequire
SHARED TOKENS (27): "assistance", "associated", "basic", "care", "early", "generally", "guidance", "health", "help", "individual", "medical", "move", "people", "preservation", "professional", "provision", "public", "regulation", "relationship", "require"....
0.300
administrationagencyassistancecasecenterscostcostsdepartmentdisabilityeducationeligibleestablishedexecutiveexpandedfacilitiesfamilyfederalfuturehealthcarehome
SHARED TOKENS (29): "administration", "agency", "assistance", "case", "centers", "cost", "costs", "department", "disability", "education", "eligible", "established", "executive", "expanded", "facilities", "family", "federal", "future", "healthcare", "home"....
0.300
Child abuse ↗ Q167191 KW CROSS HIGH
abuseactcaregiverchildchildrencommunitiesdifferentfamilieshomejurisdictionsorganizationsparentphysicalreportingrequirementsresultsschoolstherefore
SHARED TOKENS (18): "abuse", "act", "caregiver", "child", "children", "communities", "different", "families", "home", "jurisdictions", "organizations", "parent", "physical", "reporting", "requirements", "results", "schools", "therefore".
0.300
agencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalfinancinghomehousehousingprogramreportssocietyurban
SHARED TOKENS (15): "agency", "department", "departments", "development", "directly", "executive", "federal", "financing", "home", "house", "housing", "program", "reports", "society", "urban".
0.300
Respite care ↗ Q7315937 KW CROSS HIGH
abuseadultsamongcarecaregiverchildchildrendescribeddisabilitiesdisabilityexperiencefamiliesfamilyfinancialfundhealthhealthcarehelphomelong-term
SHARED TOKENS (35): "abuse", "adults", "among", "care", "caregiver", "child", "children", "described", "disabilities", "disability", "experience", "families", "family", "financial", "fund", "health", "healthcare", "help", "home", "long-term"....
0.300
abuseactactivitiesaddressingassistancecenterchildchildrencomprehensivedataestablishestablishedfederalfinancialidentifiesinformationlawnationalofficeprevention
SHARED TOKENS (26): "abuse", "act", "activities", "addressing", "assistance", "center", "child", "children", "comprehensive", "data", "establish", "established", "federal", "financial", "identifies", "information", "law", "national", "office", "prevention"....
0.300
actapplicablechildchildrencodedevelopmentdifferentdisabilitiesenforcementexpandedfamiliesfamilyfederalfinancingforcefundinghousinglawmakesnational
SHARED TOKENS (29): "act", "applicable", "child", "children", "code", "development", "different", "disabilities", "enforcement", "expanded", "families", "family", "federal", "financing", "force", "funding", "housing", "law", "makes", "national"....
0.300
accessibilityactadaagainstbusinesscostscovereddisabilitiesdisabilityemployersfinalhouseidentityindividualslawnationalprotectionprovidepublicrequirements
SHARED TOKENS (22): "accessibility", "act", "ada", "against", "business", "costs", "covered", "disabilities", "disability", "employers", "final", "house", "identity", "individuals", "law", "national", "protection", "provide", "public", "requirements"....
0.300
activityaffectaffectingagainstassociatedbenefitclientsconditionscontextcreatecreatesdecisionsdirectestablishedexistsexperiencefamilyfinancialhealthidentified
SHARED TOKENS (52): "activity", "affect", "affecting", "against", "associated", "benefit", "clients", "conditions", "context", "create", "creates", "decisions", "direct", "established", "exists", "experience", "family", "financial", "health", "identified"....
0.300
Digital divide ↗ Q244752 KW CROSS HIGH
accessagecommunitiesconnectdatadigitaleducationalfacegroupshomelesshousinginformationlimitedlivinglow-incomematerialmediapeopleresourcesrural
SHARED TOKENS (26): "access", "age", "communities", "connect", "data", "digital", "educational", "face", "groups", "homeless", "housing", "information", "limited", "living", "low-income", "material", "media", "people", "resources", "rural"....
0.300
aroundcommunitydefineddevelopmentdirectlydistricteconomicfinancingfutureinfrastructureinvestmentprivateprogramprojectpropertypublicrelatedrevenuesubsidy
SHARED TOKENS (19): "around", "community", "defined", "development", "directly", "district", "economic", "financing", "future", "infrastructure", "investment", "private", "program", "project", "property", "public", "related", "revenue", "subsidy".
0.300
administeredagencyagricultureassistancecommercialcommunitiescurrentdepartmentdirectlyexecutivefederalfoodnationalneedsnutritionprogramprogramsreportsresourcesrural
SHARED TOKENS (22): "administered", "agency", "agriculture", "assistance", "commercial", "communities", "current", "department", "directly", "executive", "federal", "food", "national", "needs", "nutrition", "program", "programs", "reports", "resources", "rural"....
0.300
abuseaccessibilityadvocatesarchitecturearoundbarriersdifferentdisabilitiesdisabilityeducationemployersemploymentequityfacefunctionshousingindependentindividualsinstitutionallegal
SHARED TOKENS (31): "abuse", "accessibility", "advocates", "architecture", "around", "barriers", "different", "disabilities", "disability", "education", "employers", "employment", "equity", "face", "functions", "housing", "independent", "individuals", "institutional", "legal"....
0.300
actadministeredagainstagenciesapplicantsassistancechildrencodedepartmentdevelopmentdisabilitiesfamilieshousingincomeindividualslandlordslocallocallylow-incomemajor
SHARED TOKENS (36): "act", "administered", "against", "agencies", "applicants", "assistance", "children", "code", "department", "development", "disabilities", "families", "housing", "income", "individuals", "landlords", "local", "locally", "low-income", "major"....
0.300
advocatesbusinesscertificationconsumercreatescustomereconomicentryformfreefrequentlygeneralgrowthhealthhigherindividualindividualslawleastlicense
SHARED TOKENS (43): "advocates", "business", "certification", "consumer", "creates", "customer", "economic", "entry", "form", "free", "frequently", "general", "growth", "health", "higher", "individual", "individuals", "law", "least", "license"....
0.300
actadministeredadministrationagenciesappearcirculationcurrentdepartmentdepartmentsearlyestablishedexecutivefederalfinancefinancialinstitutionslicenseslimitedmajormatters
SHARED TOKENS (27): "act", "administered", "administration", "agencies", "appear", "circulation", "current", "department", "departments", "early", "established", "executive", "federal", "finance", "financial", "institutions", "licenses", "limited", "major", "matters"....
0.300
acquisitionamongchildchildrencontextdevelopmentdevelopmentaldifferenteducationalexecutiveexpandedexplainfunctionsidentityindividualinfluencelanguagemajorphysicalresearch
SHARED TOKENS (23): "acquisition", "among", "child", "children", "context", "development", "developmental", "different", "educational", "executive", "expanded", "explain", "functions", "identity", "individual", "influence", "language", "major", "physical", "research"....
0.300
actagricultureassociationauthoritybodycampaignscovereddemanddepartmentfundsindustryinformationmarketmarketsmechanismorganizationspositionprogramprogramsresearch
SHARED TOKENS (22): "act", "agriculture", "association", "authority", "body", "campaigns", "covered", "demand", "department", "funds", "industry", "information", "market", "markets", "mechanism", "organizations", "position", "program", "programs", "research"....
0.300
Pediatrics ↗ Q123028 KW CROSS HIGH
adultsagecarecenterschildchildrengeneralhospitalsinsurancemedicalparentspeoplepracticerequiresresearchresourceswork
SHARED TOKENS (17): "adults", "age", "care", "centers", "child", "children", "general", "hospitals", "insurance", "medical", "parents", "people", "practice", "requires", "research", "resources", "work".
0.300
adaboisecentercentralconnectedcontainshistoricidahoitselfnationalpopulationrecreationruralstarvalleywestern
SHARED TOKENS (16): "ada", "boise", "center", "central", "connected", "contains", "historic", "idaho", "itself", "national", "population", "recreation", "rural", "star", "valley", "western".
0.300
againstagencyallowcampaignscasecenterconsumercorporatedatadecisionsdonateddonationseligibilityfederalfinancefinancingfoundfundingfundsgeneral
SHARED TOKENS (50): "against", "agency", "allow", "campaigns", "case", "center", "consumer", "corporate", "data", "decisions", "donated", "donations", "eligibility", "federal", "finance", "financing", "found", "funding", "funds", "general"....
0.300
allowcomcommunitiescommunityconsumerevenexchangeexperiencefoundinformationprogramprovidingprovisionsrelatedrolesignificantsupportsystemsystemsuses
SHARED TOKENS (20): "allow", "com", "communities", "community", "consumer", "even", "exchange", "experience", "found", "information", "program", "providing", "provisions", "related", "role", "significant", "support", "system", "systems", "uses".
0.300
Child neglect ↗ Q559562 KW CROSS HIGH
abuseactagebasiccarecaregiverchildchildrendecisionsdefiningdependsdifferentdirecteducationalemploymentestablishedfederalformhealthhousing
SHARED TOKENS (37): "abuse", "act", "age", "basic", "care", "caregiver", "child", "children", "decisions", "defining", "depends", "different", "direct", "educational", "employment", "established", "federal", "form", "health", "housing"....
0.300
amongfoodhomehomeshospitalsindividualsinsecuritymealorganizationprogramprogramsqualityreduceresearchvolunteers
SHARED TOKENS (15): "among", "food", "home", "homes", "hospitals", "individuals", "insecurity", "meal", "organization", "program", "programs", "quality", "reduce", "research", "volunteers".
0.300
abuseadvocatescasechildchildrencontactexperienceinformationinvolvedlegalmaintainingmultiplenationalneedsorganizationprocessprovideprovidersprovidingremain
SHARED TOKENS (24): "abuse", "advocates", "case", "child", "children", "contact", "experience", "information", "involved", "legal", "maintaining", "multiple", "national", "needs", "organization", "process", "provide", "providers", "providing", "remain"....
0.300
activeactivityaroundhealthincreaseindividuallevelspeoplephysicalprogramspublicratesseparatelythoughtransportation
SHARED TOKENS (15): "active", "activity", "around", "health", "increase", "individual", "levels", "people", "physical", "programs", "public", "rates", "separately", "though", "transportation".
0.300
actactivitiesadministrationadvocacyallowanalysisassociatedcapacitycarechildcareclientscontactcontrolcreatecustomerdefinededucationemployerfamilyhealth
SHARED TOKENS (45): "act", "activities", "administration", "advocacy", "allow", "analysis", "associated", "capacity", "care", "childcare", "clients", "contact", "control", "create", "customer", "defined", "education", "employer", "family", "health"....
0.300
Kinship care ↗ Q5595400 KW CROSS HIGH
adultsallowarrangementcarechildchildrencommunitiescustodyexperiencefamiliesfamilyformalfosterhomeincreaseinvolvedlegalparentsplacementreduce
SHARED TOKENS (24): "adults", "allow", "arrangement", "care", "child", "children", "communities", "custody", "experience", "families", "family", "formal", "foster", "home", "increase", "involved", "legal", "parents", "placement", "reduce"....
0.300
amongassociatedassociationchildrencodecommunitycorporatedonationseducationalentitiesfederalformfosterfoundationfundfundsgrantincomeindividualnational
SHARED TOKENS (34): "among", "associated", "association", "children", "code", "community", "corporate", "donations", "educational", "entities", "federal", "form", "foster", "foundation", "fund", "funds", "grant", "income", "individual", "national"....
0.300
advocacyanti-povertyassistancecashdesignedfamiliesfeefoodindividualsprogramspublicsafetyschoolsocialvulnerable
SHARED TOKENS (15): "advocacy", "anti-poverty", "assistance", "cash", "designed", "families", "fee", "food", "individuals", "programs", "public", "safety", "school", "social", "vulnerable".
0.300
actadministeredagainstamongchildrencreatedcreatingdirectearlyestablishedfamiliesfederalhealthcareinsurancelaborlawmajornationalolderpeople
SHARED TOKENS (30): "act", "administered", "against", "among", "children", "created", "creating", "direct", "early", "established", "families", "federal", "healthcare", "insurance", "labor", "law", "major", "national", "older", "people"....
0.300
activitiesagainstagencybodybusinesscorporateexecutivegeneralgoverninginstitutionitselfjurisdictionlawmanagementnonprofitorganizationownershipresponsibilitystrategictype
SHARED TOKENS (21): "activities", "against", "agency", "body", "business", "corporate", "executive", "general", "governing", "institution", "itself", "jurisdiction", "law", "management", "nonprofit", "organization", "ownership", "responsibility", "strategic", "type"....
0.300
alignedalonearoundcommunitycreatedefineddifferentequityformframeworkgrouphouseidentifiesindependentinstitutionalinstitutionsisolatedleadershiplearningnetwork
SHARED TOKENS (34): "aligned", "alone", "around", "community", "create", "defined", "different", "equity", "form", "framework", "group", "house", "identifies", "independent", "institutional", "institutions", "isolated", "leadership", "learning", "network"....
0.300
Trinity Health ↗ KW CROSS HIGH
carecomprehensivecontinuingfacilitieshealthhealthcarehomehospitalhospitalsidaholivingnetworknorthoperatesoperatingpeoplesupportsystem
SHARED TOKENS (18): "care", "comprehensive", "continuing", "facilities", "health", "healthcare", "home", "hospital", "hospitals", "idaho", "living", "network", "north", "operates", "operating", "people", "support", "system".
0.300
activitiesactivityafter-schoolattendancebuildingcarecenterchildrenchurchcommercialcommunitydifferentearlyeducationalexperiencefinalhigherinsideleadershiporganizations
SHARED TOKENS (37): "activities", "activity", "after-school", "attendance", "building", "care", "center", "children", "church", "commercial", "community", "different", "early", "educational", "experience", "final", "higher", "inside", "leadership", "organizations"....
0.300
actapprovalsbuildingcommercialconstructioncontextcostscreatescreationdefineddesigndevelopersdevelopmentdifferdifferenteconomicestateexchangefinancialfinancing
SHARED TOKENS (43): "act", "approvals", "building", "commercial", "construction", "context", "costs", "creates", "creation", "defined", "design", "developers", "development", "differ", "different", "economic", "estate", "exchange", "financial", "financing"....
0.300
actaddressaffordableagainstalongsideassistancebusinessbusinessescarechildchildrenclassificationdirectdistributioneconomiceducationeligibilityexpandedfinalfinancial
SHARED TOKENS (37): "act", "address", "affordable", "against", "alongside", "assistance", "business", "businesses", "care", "child", "children", "classification", "direct", "distribution", "economic", "education", "eligibility", "expanded", "final", "financial"....
🫐 BERRY39 edges
0.280
Fire safety ↗ Q2997557 KW CROSS HIGH
buildingchildrencodesconstructiondepartmentdivisionfirepracticespreventionreduceresultssafetyschoolsstructures
SHARED TOKENS (14): "building", "children", "codes", "construction", "department", "division", "fire", "practices", "prevention", "reduce", "results", "safety", "schools", "structures".
0.280
Civil society ↗ Q181865 KW CROSS HIGH
amongbusinesscentralcivicdistinctfamilygeneralindependentindividualsinstitutionsorganizationsprivatesectorsociety
SHARED TOKENS (14): "among", "business", "central", "civic", "distinct", "family", "general", "independent", "individuals", "institutions", "organizations", "private", "sector", "society".
0.280
Raffle ↗ Q1761269 EXACT TITLE
againstfundspeoplethem
SHARED TOKENS (4): "against", "funds", "people", "them". | EXACT TITLE in nonprofits_community: "Raffle".
0.280
actcapitalcreateddesignedeconomicfundsincomeinvestmentleastloweroperateoutcomesprogramqualified
SHARED TOKENS (14): "act", "capital", "created", "designed", "economic", "funds", "income", "investment", "least", "lower", "operate", "outcomes", "program", "qualified".
0.260
activitiescenterchurchesclubscommunitygroupinformationlocalpublicsocialsupportthoughyouth
SHARED TOKENS (13): "activities", "center", "churches", "clubs", "community", "group", "information", "local", "public", "social", "support", "though", "youth".
0.260
administrationassistancedepartmentdisabilityeducationalhealthcarehomeinsurancelivingmedicalpersonnelreceivesocial
SHARED TOKENS (13): "administration", "assistance", "department", "disability", "educational", "healthcare", "home", "insurance", "living", "medical", "personnel", "receive", "social".
0.240
adaboisecanyoncountieshomeidaholargernampapercentpopulationtreasurevalley
SHARED TOKENS (12): "ada", "boise", "canyon", "counties", "home", "idaho", "larger", "nampa", "percent", "population", "treasure", "valley".
0.240
activitybusinessbusinessescategoriescategorycodedirectoryfunctioninformationsearchsizetype
SHARED TOKENS (12): "activity", "business", "businesses", "categories", "category", "code", "directory", "function", "information", "search", "size", "type".
0.240
beginningcashdefinedequityestablishlawplanningpropertyrevenuerulestypetypes
SHARED TOKENS (12): "beginning", "cash", "defined", "equity", "establish", "law", "planning", "property", "revenue", "rules", "type", "types".
0.240
actchildcreatesemployeremploymenthourslaborlawpeoplestandardswagework
SHARED TOKENS (12): "act", "child", "creates", "employer", "employment", "hours", "labor", "law", "people", "standards", "wage", "work".
0.220
businesscasedesigneddiscoveryfirmsintakelawmanagementoperationspracticerecords
SHARED TOKENS (11): "business", "case", "designed", "discovery", "firms", "intake", "law", "management", "operations", "practice", "records".
0.220
childchildrencoveringeducationgeneralindividualparentparentsprogramprogramstraining
SHARED TOKENS (11): "child", "children", "covering", "education", "general", "individual", "parent", "parents", "program", "programs", "training".
0.220
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahopopulationschoolschoolssharedstar
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "house", "idaho", "population", "school", "schools", "shared", "star".
0.220
Sales tax ↗ Q11055488 KW CROSS HIGH
allowbodyconsumerdirectlyeducationfoodfundsgoverningpointproviderelated
SHARED TOKENS (11): "allow", "body", "consumer", "directly", "education", "food", "funds", "governing", "point", "provide", "related".
0.220
affordableassociatedhealthhomelesshousinginsecurityoutcomessafestablesupplyzoning
SHARED TOKENS (11): "affordable", "associated", "health", "homeless", "housing", "insecurity", "outcomes", "safe", "stable", "supply", "zoning".
0.220
boisecoveredestablishedextendshomeidahonorthpopulationriverruralvalley
SHARED TOKENS (11): "boise", "covered", "established", "extends", "home", "idaho", "north", "population", "river", "rural", "valley".
0.210
idaho
SHARED TOKENS (1): "idaho". | EXACT TITLE in childcare_family: "Frank R. Gooding".
0.200
boiseconsumercreateddatademandidahomajormarketservedtechnology
SHARED TOKENS (10): "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "served", "technology".
0.200
Endowment ↗ Q16775552 EXACT TITLE
EXACT TITLE in nonprofits_community: "Endowment".
0.200
agenciesfoodnetworknonprofitorganizationpantriespeoplerevenuesecondshelters
SHARED TOKENS (10): "agencies", "food", "network", "nonprofit", "organization", "pantries", "people", "revenue", "second", "shelters".
0.200
affordablehomelesshousinglong-termpeoplepopulationresidentssheltersupporttemporary
SHARED TOKENS (10): "affordable", "homeless", "housing", "long-term", "people", "population", "residents", "shelter", "support", "temporary".
0.180
Single parent ↗ Q1204559 KW CROSS HIGH
alonechildchildrenfamilyhouseholdparentpartnersinglesupport
SHARED TOKENS (9): "alone", "child", "children", "family", "household", "parent", "partner", "single", "support".
0.180
distinctentryfrequentlygoverninglawlegalmattersnationalrights
SHARED TOKENS (9): "distinct", "entry", "frequently", "governing", "law", "legal", "matters", "national", "rights".
0.180
businessesconstructionfederallocalmarketsprocurementpropertypublicreal
SHARED TOKENS (9): "businesses", "construction", "federal", "local", "markets", "procurement", "property", "public", "real".
0.180
aroundhomeindividualslocallong-termoutsidepeoplethemvoluntary
SHARED TOKENS (9): "around", "home", "individuals", "local", "long-term", "outside", "people", "them", "voluntary".
0.180
associatedboisecentercontainsextendsfederallyidahopopulationvalley
SHARED TOKENS (9): "associated", "boise", "center", "contains", "extends", "federally", "idaho", "population", "valley".
0.180
corporatedecisionsdefinesdistributedessentiallong-termoperatedorganizationspractices
SHARED TOKENS (9): "corporate", "decisions", "defines", "distributed", "essential", "long-term", "operated", "organizations", "practices".
0.160
adaboisecanyoncountiesidahoregiontreasurevalley
SHARED TOKENS (8): "ada", "boise", "canyon", "counties", "idaho", "region", "treasure", "valley".
0.160
agencycommunitiesdepartmentdepartmentsjurisdictionspolicyprovidepublic
SHARED TOKENS (8): "agency", "communities", "department", "departments", "jurisdictions", "policy", "provide", "public".
0.160
activitieseducationgrouplearningpracticesprogramsresidentialschool
SHARED TOKENS (8): "activities", "education", "group", "learning", "practices", "programs", "residential", "school".
0.160
Unemployment ↗ Q41171 KW CROSS HIGH
ageemploymentforcepeopleratherseekingspecifiedwork
SHARED TOKENS (8): "age", "employment", "force", "people", "rather", "seeking", "specified", "work".
0.160
childchildrendevelopmentfamiliesinfluencepopulationpreventiontreatment
SHARED TOKENS (8): "child", "children", "development", "families", "influence", "population", "prevention", "treatment".
0.160
caldwellcanyondistrictextendsidaholandnampaschool
SHARED TOKENS (8): "caldwell", "canyon", "district", "extends", "idaho", "land", "nampa", "school".
0.140
adaboiseidahomunicipalpopulationsecondseparate
SHARED TOKENS (7): "ada", "boise", "idaho", "municipal", "population", "second", "separate".
0.140
establishedhomeidahomakingpopulationruralsecond
SHARED TOKENS (7): "established", "home", "idaho", "making", "population", "rural", "second".
0.120
activitiesformgroupprivateratheruses
SHARED TOKENS (6): "activities", "form", "group", "private", "rather", "uses".
0.120
Food drive ↗ Q5465459 KW CROSS HIGH
cannotfoodformgroupindividualspeople
SHARED TOKENS (6): "cannot", "food", "form", "group", "individuals", "people".
0.100
assetsbodyestablishedjurisdictionsorganization
SHARED TOKENS (5): "assets", "body", "established", "jurisdictions", "organization".
0.100
actfamilieslawpublicsafe
SHARED TOKENS (5): "act", "families", "law", "public", "safe".
◈ Frequently Asked Questions
Nonprofits Community × Childcare Family — Treasure Valley
HAIKU · HIGH GATE
How do Treasure Valley nonprofits address childcare access for families in foster care?
Nonprofits in the Boise area coordinate case management services with family therapy providers to support children and parents navigating foster care transitions. Organizations working through social work credentials and child protection frameworks help local families secure affordable childcare while managing the public health and mental health needs that often accompany placement changes.
What continuing education do Treasure Valley nonprofits offer to childcare providers on child protection?
College of Western Idaho and Boise State University partner with Treasure Valley nonprofits to deliver training in child protection standards and case management practices for childcare professionals. These programs ensure that local providers understand Idaho child welfare law and can identify risks while maintaining family-centered approaches in their work.
How do nonprofits in the Treasure Valley connect food security to childcare family services?
Boise-area nonprofits integrate food security initiatives into childcare programming, recognizing that Treasure Valley families cannot afford quality care when basic nutrition is unstable. Local organizations measure both childcare access and meal provision among the population to demonstrate how community development requires addressing these interconnected needs simultaneously.
Which philanthropy models support both nonprofit development and childcare expansion in Boise?
Treasure Valley philanthropic organizations fund nonprofit capacity building while simultaneously investing in childcare infrastructure, understanding that social work agencies and childcare providers serve overlapping populations in the Boise community. This dual-investment approach strengthens both nonprofit sustainability and the local childcare market's ability to serve low-income families.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nonprofits Community × Childcare Family 27 QID bridges 249 edges 6,655 ext links 2026-07-17 22:25:47 UTC 42e51ea51ce9dcfa
Nonprofits Community corridor ↗ Childcare Family corridor ↗ Childcare Family × Nonprofits Community ↗ boisestandard.org/standard ↗
Parent Corridors
Nonprofits Community × All Other Verticals