—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Nonprofits Community ↔ relates to ↔ Dental

13 Wikipedia bridge articles confirmed in both vertical ledgers. 265 deterministic cross-vertical edges. 7,197 external source links harvested. Every edge provenance-stamped. Every claim auditable.

13 QID Bridge Articles
265 Cross Edges
7,197 External Sources
290 Wikipedia Articles
13 🌲 Evergreen
205 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Nonprofits Community
× Dental
QID Bridge Articles
13
confirmed Wikipedia overlap
Total Cross Edges
265
External Sources Harvested
7,197
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  22 shared tokens
QID Bridge Titles (13)
Boise State UniversityIdahoContinuing educationCollege of Western IdahoTreasure ValleyIdaho State UniversityNampa, IdahoMental healthBoise, IdahoAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitancollegeamongprogramsuniversitycapitalwesternadacanyoneducationpublicnorthstudentsnampatreasurevalleyhome
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:26:17 UTC
Content Hash
680c921fbcc3c547
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
13 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (22): "among", "boise", "business", "college", "compete", "division", "education", "exceeding", "graduate", "health", "idaho", "independent", "institution", "member", "million", "program", "programs", "public", "research", "school".... | URL->A (1): https://boisestate.edu/. | EXACT TITLE in nonprofits_community: "Boise State University". | EXACT TITLE in dental: "Boise State University".
amongboisebusinesscollegecompetedivisioneducationexceedinggraduatehealthidahoindependentinstitutionmembermillionprogramprogramspublicresearchschoolteamsuniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (27): "approximately", "around", "boise", "capital", "contains", "distinct", "early", "geographic", "idaho", "isolated", "land", "linked", "million", "national", "north", "official", "organized", "population", "sector", "separate".... | EXACT TITLE in nonprofits_community: "Idaho". | EXACT TITLE in dental: "Idaho".
approximatelyaroundboisecapitalcontainsdistinctearlygeographicidahoisolatedlandlinkedmillionnationalnorthofficialorganizedpopulationsectorseparatesignificantsmallsuppliestechnologyuseswashingtonwestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (44): "academic", "activities", "age", "agencies", "beyond", "college", "continuing", "credit", "curriculum", "degree", "delivered", "development", "different", "division", "education", "either", "formal", "forms", "frequently", "general".... | EXACT TITLE in nonprofits_community: "Continuing education". | EXACT TITLE in dental: "Continuing education".
academicactivitiesageagenciesbeyondcollegecontinuingcreditcurriculumdegreedelivereddevelopmentdifferentdivisioneducationeitherformalformsfrequentlygeneralgovernmentinitialinstitutionalintegratedleastlifeonlinepartnershipsprofessionalprograms+14
t programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
History In the United Kingdom, Oxford University's Department for Continuing Education was founded in 1878, and the Institute of Continuing Education of Cambridge University dates back to 1873. In the United States, the Chautauqua Institution, originally the Chautauqua Lake Sunday School Assembly, was founded in 1874 "as an educational experiment in out-of-school, vacation learning. It was successful and broadened almost immediately beyond courses for Sunday school teachers to include academic subjects, music, art and physical education." Harvard University traces its origins in continuing education to 1835 when John Lowell Jr. established the Lowell Institute with a mission to provide free public lectures in Boston. In 1909, then-Harvard President A. Lawrence Lowell, who was also a trustee of the Lowell Institute, expanded plans to offer Lowell Institute public courses directly with Harvard. In 1910, Lowell formally established the Havard Extension School, then referred to as the Commission on Extension Courses. The Harvard Extension School now operates under the Faculty of Arts and Sciences and is one of the 13 degree-granting schools that make up Harvard University. The School has remained in continuous operation since 1910. Cornell University was among higher education institutions that began offering university-based continuing education, primarily to teachers, through extension courses in the 1870s. As noted in the Cornell Era of February 16, 1877, the university offered a "Tour of the Great Lakes" program for "teachers and others" under the direction of Professor Theodore B. Comstock, head of Cornell's department of geology. The University of Wisconsin–Madison began its continuing education program in 1907. The New School for Social Research, founded in 1919, was initially devoted to adult education. In 1969, Empire State College, a unit of the State University of New York, was the first institution in the US to exclusively focus on providing higher education to adult learners. In 1976 the University of Florida created its own Division of Continuing Education and most courses were offered on evenings or weekends to accommodate the schedules of working students. The method of delivery of continuing education can include traditional types of classroom lectures and laboratories.
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (32): "academic", "ada", "board", "boise", "campus", "canyon", "classes", "college", "community", "comprehensive", "counties", "credit", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population".... | EXACT TITLE in nonprofits_community: "College of Western Idaho". | EXACT TITLE in dental: "College of Western Idaho".
academicadaboardboisecampuscanyonclassescollegecommunitycomprehensivecountiescreditcwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicresidentssouthweststudentstudentstransfertreasurevalley+2
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "opportunities", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in nonprofits_community: "Treasure Valley". | EXACT TITLE in dental: "Treasure Valley".
associationboisehistoricallyidaholandlocalmetropolitanopportunitiesregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Idaho State University
Q1656608 EXACT TITLE 0.940
QID OVERLAP: Q1656608 in nonprofits_community (tier:evergreen) and dental (tier:evergreen). | SHARED TOKENS (12): "among", "campus", "classes", "enrollment", "idaho", "isu", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in nonprofits_community: "Idaho State University". | EXACT TITLE in dental: "Idaho State University".
amongcampusclassesenrollmentidahoisupercentprogramspublicresearchstudentsuniversity
ted States. Founded in 1901 as the Academy of Idaho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
Nampa, Idaho
Q622633 QID OVERLAP 0.930
QID OVERLAP: Q622633 in nonprofits_community (tier:evergreen) and dental (tier:branch). | SHARED TOKENS (14): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "metropolitan", "nampa", "population", "principal", "student", "university", "western". | URL->A (1): http://www.nampa.com/.
accordingboisecanyoncollegehomeidahomeaningmetropolitannampapopulationprincipalstudentuniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Mental health
Q317309 QID OVERLAP 0.800
QID OVERLAP: Q317309 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (22): "absence", "according", "activities", "affect", "among", "broader", "community", "create", "decisions", "defines", "determines", "health", "individual", "life", "merely", "organization", "professional", "rather", "relationships", "role"....
absenceaccordingactivitiesaffectamongbroadercommunitycreatedecisionsdefinesdetermineshealthindividuallifemerelyorganizationprofessionalratherrelationshipsrolesocialwork
sychological, and social well-being, and it affects how people manage stress and make everyday decisions. From the perspectives of positive psychology or holism, mental health is thus not merely the absence of mental illness. Rather, it is a broader state of well-being that includes an individual's ability to enjoy life and to create a balance between life activities and efforts to achieve psychological resilience.
"The terms mental health promotion and prevention have often been confused. Promotion is defined as intervening to optimize positive mental health by addressing determinants of positive mental health (i.e. protective factors) before a specific mental health problem has been identified, with the ultimate goal of improving the positive mental health of the population. Mental health prevention is defined as intervening to minimize mental health problems (i.e. risk factors) by addressing determinants of mental health problems before a specific mental health problem has been identified in the individual, group, or population of focus with the ultimate goal of reducing the number of future mental health problems in the population." In order to improve mental health, the root of the issue has to be resolved. "Prevention emphasizes the avoidance of risk factors; promotion aims to enhance an individual's ability to achieve a positive sense of self-esteem, mastery, well-being, and social inclusion." Mental health promotion attempts to increase protective factors and healthy behaviors that can help prevent the onset of a diagnosable mental disorder and reduce risk factors that can lead to the development of a mental disorder. Yoga is an example of an activity that calms one's entire body and nerves. According to a study on well-being by Richards, Campania, and Muse-Burke, "mindfulness is considered to be a purposeful state, it may be that those who practice it belief in its importance and value being mindful, so that valuing of self-care activities may influence the intentional component of mindfulness." Akin to surgery, sometimes the body must be further damaged, before it can properly heal Mental health is conventionally defined as a hybrid of the absence of a mental disorder and the presence of well-being. Focus is increasing on preventing mental disorders. Prevention is beginning to appear in mental health strategies, including the 2004 WHO report "Prevention of Mental Disorders", the 2008 EU "Pact for Mental Health" and the 2011 US National Prevention Strategy. Some commentators have argued that a pragmatic and practical approach to mental disorder prevention at work would be to treat it the same way as physical injury prevention. Prevention of a disorder at a young age may significantly decrease the chances that a child will have a disorder later in life, and shall be the most efficient and effective measure from a public health perspective. Prevention may require the regular consultation of a physician for at least twice a year to detect any signs that reveal any mental health concerns. Additionally, social media is becoming a resource for prevention. In 2004, the Mental Health Services Act began to fund marketing initiatives to educate the public on mental health. This California-based project is working to combat the negative perception with mental health and reduce the stigma associated with it. While social media can benefit mental health, it can also lead to deterioration if not managed properly. Limiting social media intake is beneficial. Studies report that patients in mental health care who can access and read their Electronic Health Records (EHR) or Open Notes online experience increased understanding of their mental health, feeling in control of their care, and enhanced trust in their clinicians. Patients' also reported feelings of greater validation, engagement, remembering their care plan, and acquiring a better awareness of potential side effects of their medications, when reading their mental health notes. Other common experiences were that shared mental health notes enhance patient empowerment and augment patient autonomy. Furthermore, recent studies have shown that social media is an effective way to draw attention to mental health issues. By collecting data from Twitter, researchers found that social media presence is heightened after an event relating to behavioral health occurs.
-being, influencing cognition, perception, and behavior. Mental health plays a crucial role in an individual's daily life when managing stress, engaging with others, and contributing to life overall. According to the World Health Organization (WHO), it is a "state of well-being in which the individual realizes their abilities, can cope with the normal stresses of life, can work productively and fruitfully, and can contribute to their community". It likewise determines how an individual handles stress, interpersonal relationships, and decision-making. Mental health includes subjective well-being, perceived self-efficacy, autonomy, competence, intergenerational dependence, and self-actualization of one's intellectual and emotional potential, among others. Mental health also includes emotional, psychological, and social well-being, and it affects how people manage stress and make everyday decisions. From the perspectives of positive psychology or holism, mental health is thus not merely the absence of mental illness. Rather, it is a broader state of well-being that includes an individual's ability to enjoy life and to create a balance between life activities and efforts to achieve psychological resilience.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "employers", "home", "idaho", "locally", "major", "metropolitan", "north", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountiesemployershomeidaholocallymajormetropolitannorthpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "home", "idaho", "local", "metropolitan", "population", "private", "washington".
adaboisecapitaldistricthomeidaholocalmetropolitanpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in nonprofits_community (tier:branch) and dental (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "making", "population".
adaamongboisecapitalidahomakingpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
252 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP252 edges
🌿 BRANCH205 edges
0.500
accreditationadaamericanassociationbasiccarecoveragecurrentdentalestablishedevenincreasingmembersnationalorganizationpopulationprofessionalprovidingpublishesrole
SHARED TOKENS (24): "accreditation", "ada", "american", "association", "basic", "care", "coverage", "current", "dental", "established", "even", "increasing", "members", "national", "organization", "population", "professional", "providing", "publishes", "role".... | EXACT TITLE in dental: "American Dental Association".
0.500
adaamericanassociationclinicalcollegeconditionsdefinesdentaldiagnosisfunctionhealthmaintenanceplanningrecognizedtreatment
SHARED TOKENS (15): "ada", "american", "association", "clinical", "college", "conditions", "defines", "dental", "diagnosis", "function", "health", "maintenance", "planning", "recognized", "treatment". | EXACT TITLE in dental: "Prosthodontics".
0.500
ableadministrationconcentrationcontactcontainsdeliverydentaleffectiveformhoursleastmarketpreparationpreventionprofessionalpurposeremainsystemstherapywestern
SHARED TOKENS (20): "able", "administration", "concentration", "contact", "contains", "delivery", "dental", "effective", "form", "hours", "least", "market", "preparation", "prevention", "professional", "purpose", "remain", "systems", "therapy", "western". | EXACT TITLE in dental: "Fluoride varnish".
0.500
benefitschildrenclinicianscommonlycounselingdefineddevelopmentdifferentdirectearlyfamiliesfamilyfocusedhumanindividualinvolvingissuelong-termmembersparents
SHARED TOKENS (33): "benefits", "children", "clinicians", "commonly", "counseling", "defined", "development", "different", "direct", "early", "families", "family", "focused", "human", "individual", "involving", "issue", "long-term", "members", "parents".... | EXACT TITLE in nonprofits_community: "Family therapy".
0.500
cannotcategorycentercentersemergencyentiregroupsmanagementneedorganizationsplaceplannedprocessprovidepurposeresponseschoolspecificstructuressupport
SHARED TOKENS (23): "cannot", "category", "center", "centers", "emergency", "entire", "groups", "management", "need", "organizations", "place", "planned", "process", "provide", "purpose", "response", "school", "specific", "structures", "support".... | EXACT TITLE in nonprofits_community: "Emergency shelter".
0.500
academicadministrationbusinesscompletiondegreedevelopmentgovernmentgraduatemanagementpolicyprivateprofessionalprogrampublicrequiresrolesspecializedstudentstraininguniversity
SHARED TOKENS (21): "academic", "administration", "business", "completion", "degree", "development", "government", "graduate", "management", "policy", "private", "professional", "program", "public", "requires", "roles", "specialized", "students", "training", "university".... | EXACT TITLE in nonprofits_community: "Master of Public Administration".
0.500
accessactiveadultsageassistanceboardcentercenterscommunitycriticaleventsfacilityfederalfinancialfundinglocalmeansmembersmultiplemunicipal
SHARED TOKENS (33): "access", "active", "adults", "age", "assistance", "board", "center", "centers", "community", "critical", "events", "facility", "federal", "financial", "funding", "local", "means", "members", "multiple", "municipal".... | EXACT TITLE in nonprofits_community: "Senior center".
0.500
ageagencyamongcarechildchildrencommunityconditionsdatadecisionsdegreeexpensesfamiliesfamilygeneralgovernmentgrouphealthhigherhome
SHARED TOKENS (43): "age", "agency", "among", "care", "child", "children", "community", "conditions", "data", "decisions", "degree", "expenses", "families", "family", "general", "government", "group", "health", "higher", "home".... | EXACT TITLE in nonprofits_community: "Foster care".
0.500
Legal aid ↗ Q707748 EXACT TITLE
accessassistancecentralclinicscommunitydeliverydescribesdevelopmentessentialfinancialformsfreegeneralhumanlawlegallowmeansmodelsoutside
SHARED TOKENS (30): "access", "assistance", "central", "clinics", "community", "delivery", "describes", "development", "essential", "financial", "forms", "free", "general", "human", "law", "legal", "low", "means", "models", "outside".... | EXACT TITLE in nonprofits_community: "Legal aid".
0.500
basicboardbusinesscollegecommunitycomprehensivecreatedegreedesigneddistricteducationenrollmentgeneralhealthidahoindustryjoinnorthofficepublic
SHARED TOKENS (29): "basic", "board", "business", "college", "community", "comprehensive", "create", "degree", "designed", "district", "education", "enrollment", "general", "health", "idaho", "industry", "join", "north", "office", "public".... | EXACT TITLE in dental: "College of Eastern Idaho".
0.500
americanassociationdentaleducationexperienceformalgenerallymarketingpositionshapesizespecificthoughtrainingwork
SHARED TOKENS (15): "american", "association", "dental", "education", "experience", "formal", "generally", "marketing", "position", "shape", "size", "specific", "though", "training", "work". | EXACT TITLE in dental: "Cosmetic dentistry".
0.500
actamongauthorizedbuildingcommunitiescommunitycreatedepartmentdevelopmentestablishedfederalgrantgrantshousinglawnationalprogramprovisionsurban
SHARED TOKENS (19): "act", "among", "authorized", "building", "communities", "community", "create", "department", "development", "established", "federal", "grant", "grants", "housing", "law", "national", "program", "provisions", "urban". | EXACT TITLE in nonprofits_community: "Housing and Community Development Act of 1974".
0.500
aroundcommunitycoordinateddesignedfacilityfamilyfoundationsgrantindividualinvestmentlocalmakingplaceprivatesinglesocialsociety
SHARED TOKENS (17): "around", "community", "coordinated", "designed", "facility", "family", "foundations", "grant", "individual", "investment", "local", "making", "place", "private", "single", "social", "society". | EXACT TITLE in nonprofits_community: "Community foundation".
0.500
addressesbenefitsdentaldiagnosisevidencegrowthhealthhigherlifemanagementplanpositionpreventionqualityrequiresmallertreatment
SHARED TOKENS (17): "addresses", "benefits", "dental", "diagnosis", "evidence", "growth", "health", "higher", "life", "management", "plan", "position", "prevention", "quality", "require", "smaller", "treatment". | EXACT TITLE in dental: "Orthodontics".
0.500
activitiesbenefitbusinessescharitabledemonstratedependdonorseducationalentitiesexclusivelyfinancialformimpactincomeindividualinformationinvestmentlawleadershiplegal
SHARED TOKENS (39): "activities", "benefit", "businesses", "charitable", "demonstrate", "depend", "donors", "educational", "entities", "exclusively", "financial", "form", "impact", "income", "individual", "information", "investment", "law", "leadership", "legal".... | EXACT TITLE in nonprofits_community: "Charitable organization".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingdefineddeterminedevelopmentdifferentexceptionsformgoverngovernmentgrowthguideguidelineslandland-uselocalplanningpolicyprocedureproperty
SHARED TOKENS (31): "activities", "building", "defined", "determine", "development", "different", "exceptions", "form", "govern", "government", "growth", "guide", "guidelines", "land", "land-use", "local", "planning", "policy", "procedure", "property".... | EXACT TITLE in nonprofits_community: "Zoning". | EXACT TITLE in dental: "Zoning".
0.500
activitiesagecannotcarecommunityconditionscoordinateddisabilityfacilitiesfocusedhomeincreasinglylifelong-termmedicalmultipleneedneedsolderpractitioners
SHARED TOKENS (26): "activities", "age", "cannot", "care", "community", "conditions", "coordinated", "disability", "facilities", "focused", "home", "increasingly", "life", "long-term", "medical", "multiple", "need", "needs", "older", "practitioners".... | EXACT TITLE in nonprofits_community: "Long-term care".
0.500
approximatelyboisechamberdatadistrictdistrictseitherevenfoundgovernmentidaholegislaturemembersnorthpopulationrepresentingresidentssinglesubsequentwashington
SHARED TOKENS (20): "approximately", "boise", "chamber", "data", "district", "districts", "either", "even", "found", "government", "idaho", "legislature", "members", "north", "population", "representing", "residents", "single", "subsequent", "washington". | EXACT TITLE in dental: "Idaho Legislature".
0.500
ableactionappointmentcentralchildrencontactdefineddentalessentialmaintainedmedicalpatientpractitionerproceduresproducesprofessionalsystemtreatment
SHARED TOKENS (18): "able", "action", "appointment", "central", "children", "contact", "defined", "dental", "essential", "maintained", "medical", "patient", "practitioner", "procedures", "produces", "professional", "system", "treatment". | EXACT TITLE in dental: "Sedation dentistry".
0.500
activitiescharitabledepartmentdevelopmentdistributionestablishedgroupgroupshousinglegallocalmissionnonprofitorganizationorganizationspracticerelatedstatusurban
SHARED TOKENS (19): "activities", "charitable", "department", "development", "distribution", "established", "group", "groups", "housing", "legal", "local", "mission", "nonprofit", "organization", "organizations", "practice", "related", "status", "urban". | EXACT TITLE in nonprofits_community: "Fiscal sponsorship".
0.500
accessaccessibilityamongbasicbehavioralcarechildcommunitiescommunitycomprehensivecontroldeliverydesigneddevelopmentdifferentdisabilitydistributioneducationentireenvironmental
SHARED TOKENS (61): "access", "accessibility", "among", "basic", "behavioral", "care", "child", "communities", "community", "comprehensive", "control", "delivery", "designed", "development", "different", "disability", "distribution", "education", "entire", "environmental".... | EXACT TITLE in nonprofits_community: "Public health". | EXACT TITLE in dental: "Public health".
0.500
actualadministeredamericanapproximatelyassistancebenefitbenefitschildrencontractorscostsdepartmentdependsdirectlydistributeddivisionelectronicexpensesfederalgovernmenthealth
SHARED TOKENS (44): "actual", "administered", "american", "approximately", "assistance", "benefit", "benefits", "children", "contractors", "costs", "department", "depends", "directly", "distributed", "division", "electronic", "expenses", "federal", "government", "health".... | EXACT TITLE in nonprofits_community: "Supplemental Nutrition Assistance Program".
0.500
actcommunityeducationemergencygivinggroupindividuallaborproviderescueresponsespecializedtrainingvolunteerswork
SHARED TOKENS (15): "act", "community", "education", "emergency", "giving", "group", "individual", "labor", "provide", "rescue", "response", "specialized", "training", "volunteers", "work". | EXACT TITLE in nonprofits_community: "Volunteering".
0.500
addressingbusinessescommunitiesconstructiongovernmentgrowthhousinginfrastructurelandlow-incomeprivateprocesspublicrenewalurban
SHARED TOKENS (15): "addressing", "businesses", "communities", "construction", "government", "growth", "housing", "infrastructure", "land", "low-income", "private", "process", "public", "renewal", "urban". | EXACT TITLE in nonprofits_community: "Urban renewal".
0.500
activitiesadditionaladministrativeappliesbarrierscannotcategoriesconditionscontrolcontrolscreatedesigndesignedeffectiveemployeesenvironmentexposureframeworkhealthhuman
SHARED TOKENS (39): "activities", "additional", "administrative", "applies", "barriers", "cannot", "categories", "conditions", "control", "controls", "create", "design", "designed", "effective", "employees", "environment", "exposure", "framework", "health", "human".... | EXACT TITLE in dental: "Personal protective equipment".
0.500
administrativeamongassociationcapacitygeneralgovernmenthistorylegislaturenationalnorthofficialpracticeprimaryrecordsserving
SHARED TOKENS (15): "administrative", "among", "association", "capacity", "general", "government", "history", "legislature", "national", "north", "official", "practice", "primary", "records", "serving". | EXACT TITLE in nonprofits_community: "Secretary of state (U.S. state government)".
0.500
actagainstagecoordinateddatadisclosureeitherenforcementevenformfrequentlygeneralhealthhistoricalhumanindividualissuelawlong-termmodern
SHARED TOKENS (30): "act", "against", "age", "coordinated", "data", "disclosure", "either", "enforcement", "even", "form", "frequently", "general", "health", "historical", "human", "individual", "issue", "law", "long-term", "modern".... | EXACT TITLE in nonprofits_community: "Sexual violence".
0.500
accessaddressingamericanamongbarriersbusinessescapacitycommunitycompetedevelopersdevelopmentearliereducationemployeesemployersformformalformsgovernmenthistorically
SHARED TOKENS (56): "access", "addressing", "american", "among", "barriers", "businesses", "capacity", "community", "compete", "developers", "development", "earlier", "education", "employees", "employers", "form", "formal", "forms", "government", "historically".... | EXACT TITLE in nonprofits_community: "Workforce development".
0.500
accessactivitiesadministrationagencyamericanannouncedapplyingassociationcapacitycenterscontroldepartmentdesigneddisabilityeducationalenvironmentalfederalgovernmenthealthhuman
SHARED TOKENS (47): "access", "activities", "administration", "agency", "american", "announced", "applying", "association", "capacity", "centers", "control", "department", "designed", "disability", "educational", "environmental", "federal", "government", "health", "human".... | EXACT TITLE in dental: "Centers for Disease Control and Prevention".
0.500
ageamongcareclinicalclinicianscombinesconditionsdatadatedeliverydesigneddifferentdigitaleffectiveelectronichealthhealthcarehistoryidentifyimprovements
SHARED TOKENS (44): "age", "among", "care", "clinical", "clinicians", "combines", "conditions", "data", "date", "delivery", "designed", "different", "digital", "effective", "electronic", "health", "healthcare", "history", "identify", "improvements".... | EXACT TITLE in nonprofits_community: "Electronic health record". | EXACT TITLE in dental: "Electronic health record".
0.500
approximatelyboardcampuscollegecommissioncommunitycomprehensiveearlyenrollmentidahonearnorthpublicstatusstudentstogetherwestern
SHARED TOKENS (17): "approximately", "board", "campus", "college", "commission", "community", "comprehensive", "early", "enrollment", "idaho", "near", "north", "public", "status", "students", "together", "western". | EXACT TITLE in dental: "North Idaho College".
0.500
authoritycentercommunitydifferentdirectlyeducationeducationalestateinstitutionlanguagelifelocalschoolschoolsservesstaffstudentsstudy
SHARED TOKENS (18): "authority", "center", "community", "different", "directly", "education", "educational", "estate", "institution", "language", "life", "local", "school", "schools", "serves", "staff", "students", "study". | EXACT TITLE in nonprofits_community: "Community school".
0.500
Pregnancy ↗ Q11995 EXACT TITLE
ageapproximatelyaroundcaredeliverydevelopmentearlyexperienceformgrowthhealthhigherinsidelong-termmedicalmultiplenutritionoutcomesoutsidephysical
SHARED TOKENS (26): "age", "approximately", "around", "care", "delivery", "development", "early", "experience", "form", "growth", "health", "higher", "inside", "long-term", "medical", "multiple", "nutrition", "outcomes", "outside", "physical".... | EXACT TITLE in dental: "Pregnancy".
0.500
actactualagainstageamongbroaderchildchildrencontrolcreatedirectdocumentationearlyestablishedexperiencefamilyfinancialformshealthhigher
SHARED TOKENS (40): "act", "actual", "against", "age", "among", "broader", "child", "children", "control", "create", "direct", "documentation", "early", "established", "experience", "family", "financial", "forms", "health", "higher".... | EXACT TITLE in nonprofits_community: "Domestic violence".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactadultsaffordableamendmentsamericanannualbenefitscarechildrencostscoverageeffectiveeligibilityestablishedexpandedfamiliesfederalfinancialfunding
SHARED TOKENS (60): "access", "act", "adults", "affordable", "amendments", "american", "annual", "benefits", "care", "children", "costs", "coverage", "effective", "eligibility", "established", "expanded", "families", "federal", "financial", "funding".... | EXACT TITLE in nonprofits_community: "Medicaid". | EXACT TITLE in dental: "Medicaid".
0.500
Social work ↗ Q205398 EXACT TITLE
academicadministrationagenciesbasiccharitieschildcollectivecommunitiescommunityconductconductingcounselingdefineddevelopmentdirectlyeducationfamiliesfamilygovernmentgroup
SHARED TOKENS (46): "academic", "administration", "agencies", "basic", "charities", "child", "collective", "communities", "community", "conduct", "conducting", "counseling", "defined", "development", "directly", "education", "families", "family", "government", "group".... | EXACT TITLE in nonprofits_community: "Social work".
0.500
Tooth decay ↗ Q133772 EXACT TITLE
accordingadultsamongapproximatelyaroundavailabilitychildrenconditionscurrentdentaldifferentdissolvingearlierexposureformationfunctionhealthmanagementmillionorganization
SHARED TOKENS (33): "according", "adults", "among", "approximately", "around", "availability", "children", "conditions", "current", "dental", "different", "dissolving", "earlier", "exposure", "formation", "function", "health", "management", "million", "organization".... | EXACT TITLE in dental: "Tooth decay".
0.500
administeredagencyassistanceavailabilitycarecharitieschildrencommonlyconnectedcoverageeducationfacilitiesfamiliesfirefunctiongenerallygovernmentgroupshealthhousing
SHARED TOKENS (36): "administered", "agency", "assistance", "availability", "care", "charities", "children", "commonly", "connected", "coverage", "education", "facilities", "families", "fire", "function", "generally", "government", "groups", "health", "housing".... | EXACT TITLE in nonprofits_community: "Social services". | EXACT TITLE in dental: "Social services".
0.500
Dentistry ↗ Q12128 EXACT TITLE
affectcarecommonlyconditionsdegreedentaldevelopmentdiagnosiseitherevidencefocusedguidehistoryhospitalsinstitutionsmanagementmedicalmodernolderpractices
SHARED TOKENS (32): "affect", "care", "commonly", "conditions", "degree", "dental", "development", "diagnosis", "either", "evidence", "focused", "guide", "history", "hospitals", "institutions", "management", "medical", "modern", "older", "practices".... | EXACT TITLE in dental: "Dentistry".
0.500
accessadultsagainstamericanassociationcarechildrencommissioncompetitiondentaldependenteducationfederalguidelineshealthmedicalmemberoperateoutcomespractice
SHARED TOKENS (28): "access", "adults", "against", "american", "association", "care", "children", "commission", "competition", "dental", "dependent", "education", "federal", "guidelines", "health", "medical", "member", "operate", "outcomes", "practice".... | EXACT TITLE in dental: "Dental therapist".
0.500
activitiesappointmentchurchesestablishmentformformationgenerallyinfrastructurelawmeetingmembershipneedorganizationorganizationspaymentpractice
SHARED TOKENS (16): "activities", "appointment", "churches", "establishment", "form", "formation", "generally", "infrastructure", "law", "meeting", "membership", "need", "organization", "organizations", "payment", "practice". | EXACT TITLE in nonprofits_community: "Religious organization".
0.500
Diabetes ↗ Q12206 EXACT TITLE
adultsaffectingbeyondcommonlyconditionsdeliveryearlierearlyeitherformgrouphealthhealthcarehumanincomelifemajormillionpopulationproduction
SHARED TOKENS (29): "adults", "affecting", "beyond", "commonly", "conditions", "delivery", "earlier", "early", "either", "form", "group", "health", "healthcare", "human", "income", "life", "major", "million", "population", "production".... | EXACT TITLE in dental: "Diabetes".
0.500
adultsaffectaffectingagearoundclinicalconditionsdegreedemonstratedentaldevelopmentdiagnosisearlyfamilyformgenerallyhealthhistorymakingmillion
SHARED TOKENS (27): "adults", "affect", "affecting", "age", "around", "clinical", "conditions", "degree", "demonstrate", "dental", "development", "diagnosis", "early", "family", "form", "generally", "health", "history", "making", "million".... | EXACT TITLE in dental: "Periodontal disease".
0.500
activitiesaffordablecommunitydepartmentdevelopmentfederalgrantgrantshousinginfrastructurelocaloversightprogramprogramsprovidingspecificstatedsubjecturban
SHARED TOKENS (19): "activities", "affordable", "community", "department", "development", "federal", "grant", "grants", "housing", "infrastructure", "local", "oversight", "program", "programs", "providing", "specific", "stated", "subject", "urban". | EXACT TITLE in nonprofits_community: "Community Development Block Grant".
0.500
accordingactadditionaladjacentaffectassociationbridgecannotdentaldependseitherestablishedfederalformfunctionhealthinjurylawlicenselong-term
SHARED TOKENS (45): "according", "act", "additional", "adjacent", "affect", "association", "bridge", "cannot", "dental", "depends", "either", "established", "federal", "form", "function", "health", "injury", "law", "license", "long-term".... | EXACT TITLE in dental: "Dental implant".
0.500
accordingadministrativeamericanauthorityconsolidatedcountiescountsdefineddifferentdistrictdistrictsentitiesformfurthergeographicgovernmentindependentlawleastlocal
SHARED TOKENS (28): "according", "administrative", "american", "authority", "consolidated", "counties", "counts", "defined", "different", "district", "districts", "entities", "form", "further", "geographic", "government", "independent", "law", "least", "local".... | EXACT TITLE in nonprofits_community: "County (United States)". | EXACT TITLE in dental: "County (United States)".
0.500
americanaroundbarriersbrandedcarecommonlydentalfinancialindependentlymanagementofficesorganizationproviderrelationshipsupport
SHARED TOKENS (15): "american", "around", "barriers", "branded", "care", "commonly", "dental", "financial", "independently", "management", "offices", "organization", "provider", "relationship", "support". | EXACT TITLE in dental: "Aspen Dental".
0.500
accessamongbarrierscarecommunitiescoveragedeliverydesignededucationexperiencefundinghealthhealthcarehigherhousingidentifyinfrastructureinsuranceneedsoutcomes
SHARED TOKENS (30): "access", "among", "barriers", "care", "communities", "coverage", "delivery", "designed", "education", "experience", "funding", "health", "healthcare", "higher", "housing", "identify", "infrastructure", "insurance", "needs", "outcomes".... | EXACT TITLE in dental: "Rural health".
0.500
Credit ↗ Q182076 EXACT TITLE
consumercreditdatedebtdeferredeitherfinancialformformalgrouplatermakingmaterialspaymentpropertyprovideresourcestrust
SHARED TOKENS (18): "consumer", "credit", "date", "debt", "deferred", "either", "financial", "form", "formal", "group", "later", "making", "materials", "payment", "property", "provide", "resources", "trust". | EXACT TITLE in nonprofits_community: "Credit". | EXACT TITLE in dental: "Credit".
0.500
differentenforcementevenexecutiveexperiencefamilygeneralgenerallygovernmenthistoricalindividuallawlegalmemberofficesofficialpracticeprincipalpublicrepresents
SHARED TOKENS (21): "different", "enforcement", "even", "executive", "experience", "family", "general", "generally", "government", "historical", "individual", "law", "legal", "member", "offices", "official", "practice", "principal", "public", "represents".... | EXACT TITLE in nonprofits_community: "Attorney general".
0.500
Internship ↗ Q6500754 EXACT TITLE
adultsagenciesbenefitbroadbusinessescareerscollegecurrentdetermineeitheremployeesemployersemploymentexperiencefuturegovernmentgroupsindustryinvestmentmedical
SHARED TOKENS (44): "adults", "agencies", "benefit", "broad", "businesses", "careers", "college", "current", "determine", "either", "employees", "employers", "employment", "experience", "future", "government", "groups", "industry", "investment", "medical".... | EXACT TITLE in nonprofits_community: "Internship".
0.500
benefitbusinesscharitabledevelopmentfundinggovernmentgrantgrantsindividualinstitutionlinkedlocalmissionorganizationpublicpurposeregionalresearchsocialspecific
SHARED TOKENS (21): "benefit", "business", "charitable", "development", "funding", "government", "grant", "grants", "individual", "institution", "linked", "local", "mission", "organization", "public", "purpose", "regional", "research", "social", "specific".... | EXACT TITLE in nonprofits_community: "Grant (money)". | EXACT TITLE in dental: "Grant (money)".
0.500
acquisitionbusinessconsolidatedconsolidationdefinedeitherentitiesfinancialgrouplargersmallersubstantiallytogethertransfertreatment
SHARED TOKENS (15): "acquisition", "business", "consolidated", "consolidation", "defined", "either", "entities", "financial", "group", "larger", "smaller", "substantially", "together", "transfer", "treatment". | EXACT TITLE in nonprofits_community: "Consolidation (business)". | EXACT TITLE in dental: "Consolidation (business)".
0.500
Caregiver ↗ Q553079 EXACT TITLE
activitiesagecannotcarecentersdisabilitydocumentationeitherfamilyformalhealthcarehomehospitalshouseholdindependentlylong-termpersonnelprofessionalsprovideproviders
SHARED TOKENS (24): "activities", "age", "cannot", "care", "centers", "disability", "documentation", "either", "family", "formal", "healthcare", "home", "hospitals", "household", "independently", "long-term", "personnel", "professionals", "provide", "providers".... | EXACT TITLE in nonprofits_community: "Caregiver".
0.500
academicactionactiveaffectamongassociationassociationsbroadcollectivecommunitiescommunitycouncildefineddefinesdevelopersdevelopmenteducationenvironmentalformationgroups
SHARED TOKENS (44): "academic", "action", "active", "affect", "among", "association", "associations", "broad", "collective", "communities", "community", "council", "defined", "defines", "developers", "development", "education", "environmental", "formation", "groups".... | EXACT TITLE in nonprofits_community: "Community development".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationsbridgebroadcareclinicalcliniciansconditionsdatadefinesdigitaleducationelectronicevenfacilitiesfundinghealthhealthcare
SHARED TOKENS (48): "access", "administration", "application", "applications", "bridge", "broad", "care", "clinical", "clinicians", "conditions", "data", "defines", "digital", "education", "electronic", "even", "facilities", "funding", "health", "healthcare".... | EXACT TITLE in dental: "Telehealth".
0.500
americanassessmentassociationcarechildchildrencollegecomprehensivecounselingdentaldevelopmentearlyeducationalessentialestablishgrowthhealthhomeinformationparents
SHARED TOKENS (28): "american", "assessment", "association", "care", "child", "children", "college", "comprehensive", "counseling", "dental", "development", "early", "educational", "essential", "establish", "growth", "health", "home", "information", "parents".... | EXACT TITLE in dental: "Pediatric dentistry".
0.500
Aerosol ↗ Q104541 EXACT TITLE
affectaloneapproximatelyaroundclearconsumerenvironmentformformationformshealthhumanlanguagelargermaterialmeansmedicaloriginatingpathregulations
SHARED TOKENS (25): "affect", "alone", "approximately", "around", "clear", "consumer", "environment", "form", "formation", "forms", "health", "human", "language", "larger", "material", "means", "medical", "originating", "path", "regulations".... | EXACT TITLE in dental: "Aerosol".
0.500
authoritybuildingcodecodescomplianceconstructioncontrolcouncildesigndevelopersdistricteitherenvironmentalestatefacilitygeneralgenerallyhealthinsurancelaw
SHARED TOKENS (43): "authority", "building", "code", "codes", "compliance", "construction", "control", "council", "design", "developers", "district", "either", "environmental", "estate", "facility", "general", "generally", "health", "insurance", "law".... | EXACT TITLE in nonprofits_community: "Building code".
0.500
associationbenefitsbusinesscharitablecommonlycommunitiescommunitydefineddirecteitheressentialestablishedgroupsgrowthhistoricalhistoricallyhospitalsidentifyinstitutionsjoin
SHARED TOKENS (38): "association", "benefits", "business", "charitable", "commonly", "communities", "community", "defined", "direct", "either", "essential", "established", "groups", "growth", "historical", "historically", "hospitals", "identify", "institutions", "join".... | EXACT TITLE in nonprofits_community: "Service club".
0.500
affordabledemandemergencyformalformsgenerallygovernmenthomehouseholdhouseholdshousingincomeleadslocalmarketsnationalownershiprecognizedresponsesocial
SHARED TOKENS (21): "affordable", "demand", "emergency", "formal", "forms", "generally", "government", "home", "household", "households", "housing", "income", "leads", "local", "markets", "national", "ownership", "recognized", "response", "social".... | EXACT TITLE in nonprofits_community: "Affordable housing".
0.500
accessactagenciesbarriersboardcarecentercenterscertificationclinicalclinicscommunitiescommunitycomprehensiveconsumercoveragedefineddefiningfacilitiesfederally
SHARED TOKENS (56): "access", "act", "agencies", "barriers", "board", "care", "center", "centers", "certification", "clinical", "clinics", "communities", "community", "comprehensive", "consumer", "coverage", "defined", "defining", "facilities", "federally".... | EXACT TITLE in dental: "Federally Qualified Health Center".
0.500
Pediatrics ↗ Q123028 EXACT TITLE
adultsageamericancarecenterschildchildrenclinicscoveragegeneralhospitalsinsurancemedicalparentspracticerequiresresearchresourceswork
SHARED TOKENS (19): "adults", "age", "american", "care", "centers", "child", "children", "clinics", "coverage", "general", "hospitals", "insurance", "medical", "parents", "practice", "requires", "research", "resources", "work". | EXACT TITLE in dental: "Pediatrics".
0.500
actadministrationagencyassistanceconditionscostscreditdepartmenteducationemploymentestablishedfederalhealthinjurylaborlawmissionoccupationalprovidingregulations
SHARED TOKENS (25): "act", "administration", "agency", "assistance", "conditions", "costs", "credit", "department", "education", "employment", "established", "federal", "health", "injury", "labor", "law", "mission", "occupational", "providing", "regulations".... | EXACT TITLE in dental: "Occupational Safety and Health Administration".
0.500
activitiesaffordablebuildingconstructioncontractorsfamiliesfinancialfoundationsgenerallygovernmenthousinginfrastructurelaborlow-incomenonprofitoperatesorganizationpracticesupportvolunteer
SHARED TOKENS (21): "activities", "affordable", "building", "construction", "contractors", "families", "financial", "foundations", "generally", "government", "housing", "infrastructure", "labor", "low-income", "nonprofit", "operates", "organization", "practice", "support", "volunteer".... | EXACT TITLE in nonprofits_community: "Habitat for Humanity".
0.500
accordinganalysisapplicationsbuildingcreatecreatingdesigndesigneddigitaldocumentationeitherelectronicevenforminformationmajormaterialsmeansmodelsmodern
SHARED TOKENS (31): "according", "analysis", "applications", "building", "create", "creating", "design", "designed", "digital", "documentation", "either", "electronic", "even", "form", "information", "major", "materials", "means", "models", "modern".... | EXACT TITLE in dental: "Computer-aided design".
0.500
againstassessmentchildrenclearconventionalcreatecurrentdentaldeterminedigitaleffectiveexperienceexperiencedformhoursmakingmodelmovepatientposition
SHARED TOKENS (26): "against", "assessment", "children", "clear", "conventional", "create", "current", "dental", "determine", "digital", "effective", "experience", "experienced", "form", "hours", "making", "model", "move", "patient", "position".... | EXACT TITLE in dental: "Clear aligners".
0.500
accessactiveaffordableageagencyavailabilitybeyondchildrencreatedegreedevelopmentearlyevenexperiencedfamilyfuturegrowthhealthhigherhousehold
SHARED TOKENS (45): "access", "active", "affordable", "age", "agency", "availability", "beyond", "children", "create", "degree", "development", "early", "even", "experienced", "family", "future", "growth", "health", "higher", "household".... | EXACT TITLE in nonprofits_community: "Food security".
0.500
Eviction ↗ Q1893186 EXACT TITLE
amongcommonlyevenhistoricallawlegalpracticeprocedureproceduresprocesspropertyprovisionsrelatedspecificstructurestenantunlawful
SHARED TOKENS (17): "among", "commonly", "even", "historical", "law", "legal", "practice", "procedure", "procedures", "process", "property", "provisions", "related", "specific", "structures", "tenant", "unlawful". | EXACT TITLE in nonprofits_community: "Eviction".
0.500
accordingadditionalcarecreateemployeesemployersenvironmentexposuregeneralgovernmenthealthhumanimplementationimposeinjurylawmillionoccupationalofficialprevention
SHARED TOKENS (30): "according", "additional", "care", "create", "employees", "employers", "environment", "exposure", "general", "government", "health", "human", "implementation", "impose", "injury", "law", "million", "occupational", "official", "prevention".... | EXACT TITLE in dental: "Occupational safety and health".
0.500
activebusinesscapitalcategorycontroldevelopmenteitherexpansionfinancialfinancingfirmsgeneralinvestmentlong-termmanagementoperationalownershippartnershipsprivateprovide
SHARED TOKENS (26): "active", "business", "capital", "category", "control", "development", "either", "expansion", "financial", "financing", "firms", "general", "investment", "long-term", "management", "operational", "ownership", "partnerships", "private", "provide".... | EXACT TITLE in nonprofits_community: "Private equity".
0.500
againstamericanclearcompetecoveringcreatingdifferententireevenmodernmultipleparticipationpatternrequirespecifiedvertical
SHARED TOKENS (16): "against", "american", "clear", "compete", "covering", "creating", "different", "entire", "even", "modern", "multiple", "participation", "pattern", "require", "specified", "vertical". | EXACT TITLE in nonprofits_community: "Bingo (American version)".
0.500
appointmentcoveringdentalexpansionhealthincreasinglyinsidematerialmaterialsoutsideprocedurestrongsubsequenttechnologytreatmentvisible
SHARED TOKENS (16): "appointment", "covering", "dental", "expansion", "health", "increasingly", "inside", "material", "materials", "outside", "procedure", "strong", "subsequent", "technology", "treatment", "visible". | EXACT TITLE in dental: "Crown (dental restoration)".
0.500
additionalagenciesbasicbusinessescarecontactdepartmentemergencyemployeesfacilitiesfirehistoricallyhospitalleastlifemedicalmembersmodeloperatepatient
SHARED TOKENS (38): "additional", "agencies", "basic", "businesses", "care", "contact", "department", "emergency", "employees", "facilities", "fire", "historically", "hospital", "least", "life", "medical", "members", "model", "operate", "patient".... | EXACT TITLE in dental: "Emergency medical services".
0.500
ableassociationsbenefitbusinesscharitieschurchescollectivecommunitydonorsentitiesexceedingexpensesfaithfoundationsfurtherhospitalsinstitutionlocalmeaningmission
SHARED TOKENS (38): "able", "associations", "benefit", "business", "charities", "churches", "collective", "community", "donors", "entities", "exceeding", "expenses", "faith", "foundations", "further", "hospitals", "institution", "local", "meaning", "mission".... | EXACT TITLE in nonprofits_community: "Nonprofit organization".
0.500
accordingbroadercentersconnectedcriticaldeliverydesigndevelopmentdifferentdistincthumanimplyindependentleadsmanagementmaterialneednetworkorganizationorganizational
SHARED TOKENS (36): "according", "broader", "centers", "connected", "critical", "delivery", "design", "development", "different", "distinct", "human", "imply", "independent", "leads", "management", "material", "need", "network", "organization", "organizational".... | EXACT TITLE in nonprofits_community: "Sociotechnical system".
0.500
Form 990 ↗ Q22905923 EXACT TITLE
agenciescomprehensiveformgovernmenthealthcarehospitalsincomeinformationinternalnonprofitorganizationorganizationspublicreportingrequirementsrevenuestatus
SHARED TOKENS (17): "agencies", "comprehensive", "form", "government", "healthcare", "hospitals", "income", "information", "internal", "nonprofit", "organization", "organizations", "public", "reporting", "requirements", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 990".
0.500
Fiduciary ↗ Q537098 EXACT TITLE
actamongapplicablebenefitcapacitycareconductdepartmentdifferentfaithfinancialgrouphigherhistoricallyinvestmentlawlegalobligationsplansposition
SHARED TOKENS (28): "act", "among", "applicable", "benefit", "capacity", "care", "conduct", "department", "different", "faith", "financial", "group", "higher", "historically", "investment", "law", "legal", "obligations", "plans", "position".... | EXACT TITLE in nonprofits_community: "Fiduciary".
0.500
americanassociationcoveragedentaldistrictgroupsindependentinsurancemembermembersmillionnetworkoperatingorganizationsplansprovide
SHARED TOKENS (16): "american", "association", "coverage", "dental", "district", "groups", "independent", "insurance", "member", "members", "million", "network", "operating", "organizations", "plans", "provide". | EXACT TITLE in dental: "Delta Dental".
0.500
administrationcodecoveringdepartmentestatefederalincomeinternallaworganizedprocedurerevenuestatutestatutorytitle
SHARED TOKENS (15): "administration", "code", "covering", "department", "estate", "federal", "income", "internal", "law", "organized", "procedure", "revenue", "statute", "statutory", "title". | EXACT TITLE in nonprofits_community: "Internal Revenue Code".
0.500
alongsideassociationbehavioralboardcareclinicalcollegecomprehensivedegreedentaldiagnosiseducationeducationaleitherhealthhealthcareindependentindependentlyinstructionlicensed
SHARED TOKENS (52): "alongside", "association", "behavioral", "board", "care", "clinical", "college", "comprehensive", "degree", "dental", "diagnosis", "education", "educational", "either", "health", "healthcare", "independent", "independently", "instruction", "licensed".... | EXACT TITLE in dental: "Dental hygienist".
0.500
americanboardcaldwellcampuscounselingfamiliesfundinggovernedidahonorthoperatesoperatingprogramprogramssourcetherapyvolunteer
SHARED TOKENS (17): "american", "board", "caldwell", "campus", "counseling", "families", "funding", "governed", "idaho", "north", "operates", "operating", "program", "programs", "source", "therapy", "volunteer". | EXACT TITLE in nonprofits_community: "Idaho Youth Ranch".
0.480
assistantdentalgroupsmedicalmembersoperatorpatientprovidingrolessupporttherapiststrainingtreatingtreatment
SHARED TOKENS (14): "assistant", "dental", "groups", "medical", "members", "operator", "patient", "providing", "roles", "support", "therapists", "training", "treating", "treatment". | EXACT TITLE in dental: "Dental assistant".
0.480
broadcharitableclaimsestatefoundationsgenerallylegalorganizationplanningprivatepublicreportingrequirementssupport
SHARED TOKENS (14): "broad", "charitable", "claims", "estate", "foundations", "generally", "legal", "organization", "planning", "private", "public", "reporting", "requirements", "support". | EXACT TITLE in nonprofits_community: "Private foundation".
0.480
availabilityconventionaldatadigitaldirectlyformpatientprocessingproducequalitysystemtransferuseswider
SHARED TOKENS (14): "availability", "conventional", "data", "digital", "directly", "form", "patient", "processing", "produce", "quality", "system", "transfer", "uses", "wider". | EXACT TITLE in dental: "Digital radiography".
0.480
aloneassistancechildrenearlierfamiliesfamilyhomeinstitutionsissuepolicypreservationrathertogetherwork
SHARED TOKENS (14): "alone", "assistance", "children", "earlier", "families", "family", "home", "institutions", "issue", "policy", "preservation", "rather", "together", "work". | EXACT TITLE in nonprofits_community: "Family preservation".
0.480
agenciesbusinessescapitalcharitablefinancialformsfoundationsidentificationnonprofitonlineorganizationsprocessrecentthough
SHARED TOKENS (14): "agencies", "businesses", "capital", "charitable", "financial", "forms", "foundations", "identification", "nonprofit", "online", "organizations", "process", "recent", "though". | EXACT TITLE in nonprofits_community: "Fundraising".
0.460
carecommunityfirmsgeneralhealthlawlegalmanagementmedicalplansspecificsystemtreatment
SHARED TOKENS (13): "care", "community", "firms", "general", "health", "law", "legal", "management", "medical", "plans", "specific", "system", "treatment". | EXACT TITLE in nonprofits_community: "Case management".
0.460
businessformgovernmentlifelong-termmaterialpracticesprivateprovidingprovisionpublicqualityrather
SHARED TOKENS (13): "business", "form", "government", "life", "long-term", "material", "practices", "private", "providing", "provision", "public", "quality", "rather". | EXACT TITLE in nonprofits_community: "Philanthropy".
0.460
administeredcashcharitablecharitiesfamiliesfinancialgivingindividualorganizationorganizationsownershipparticipatepublic
SHARED TOKENS (13): "administered", "cash", "charitable", "charities", "families", "financial", "giving", "individual", "organization", "organizations", "ownership", "participate", "public". | EXACT TITLE in nonprofits_community: "Donor-advised fund".
0.460
AmeriCorps ↗ Q511243 EXACT TITLE
actagencycommunitygovernmentindependentitselfmillionnationalofficialprogramstrustvolunteerwork
SHARED TOKENS (13): "act", "agency", "community", "government", "independent", "itself", "million", "national", "official", "programs", "trust", "volunteer", "work". | EXACT TITLE in nonprofits_community: "AmeriCorps".
0.440
activecombinationcommunitydifferentfamiliesfundinghealthhousinglowprofessionalsupportedwork
SHARED TOKENS (12): "active", "combination", "community", "different", "families", "funding", "health", "housing", "low", "professional", "supported", "work". | EXACT TITLE in nonprofits_community: "Supportive housing".
0.440
Form 1023 ↗ Q30589159 EXACT TITLE
applicationcodeformgovinternalnonprofitonlineorganizationsportalrecognitionrevenuestatus
SHARED TOKENS (12): "application", "code", "form", "gov", "internal", "nonprofit", "online", "organizations", "portal", "recognition", "revenue", "status". | EXACT TITLE in nonprofits_community: "Form 1023".
0.400
communitydegreedirecthospitalspracticepracticesprofessionalqualifyingsocialwork
SHARED TOKENS (10): "community", "degree", "direct", "hospitals", "practice", "practices", "professional", "qualifying", "social", "work". | EXACT TITLE in nonprofits_community: "Master of Social Work".
0.380
assistancecannotcharitablechildrenhospitalhospitalsresearchtreatmentuninsured
SHARED TOKENS (9): "assistance", "cannot", "charitable", "children", "hospital", "hospitals", "research", "treatment", "uninsured". | EXACT TITLE in nonprofits_community: "Charitable hospital".
0.380
Trail ↗ Q628179 EXACT TITLE
communitiesgenerallyhistoricallynorthpathroutesharedsmallthough
SHARED TOKENS (9): "communities", "generally", "historically", "north", "path", "route", "shared", "small", "though". | EXACT TITLE in nonprofits_community: "Trail".
0.380
agencybenefitsdepartmentdevelopmentidahoinsurancelabortechnologyworkforce
SHARED TOKENS (9): "agency", "benefits", "department", "development", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in dental: "Idaho Department of Labor".
0.380
accessibilityaddressingcontroldentalenvironmentformmaintenanceproceduresspace
SHARED TOKENS (9): "accessibility", "addressing", "control", "dental", "environment", "form", "maintenance", "procedures", "space". | EXACT TITLE in dental: "Periodontal surgery".
0.380
combinescommunitiescommunitycreatedesignededucationalneedsstudentsuses
SHARED TOKENS (9): "combines", "communities", "community", "create", "designed", "educational", "needs", "students", "uses". | EXACT TITLE in nonprofits_community: "Service-learning".
0.360
Dentist ↗ Q27349 EXACT TITLE
caredentalfocusedhealthoccupationsprofessionalprovidingtherapists
SHARED TOKENS (8): "care", "dental", "focused", "health", "occupations", "professional", "providing", "therapists". | EXACT TITLE in dental: "Dentist".
0.360
agenciesconductdocumentsgenerallygovernmentinformationpublicrecords
SHARED TOKENS (8): "agencies", "conduct", "documents", "generally", "government", "information", "public", "records". | EXACT TITLE in nonprofits_community: "Public records".
0.360
United Way ↗ Q3050859 EXACT TITLE
americanindividuallocalnetworknonprofitorganizationpublicsingle
SHARED TOKENS (8): "american", "individual", "local", "network", "nonprofit", "organization", "public", "single". | EXACT TITLE in nonprofits_community: "United Way". | EXACT TITLE in dental: "United Way".
0.340
distinctformslifemeansprocessratherspecific
SHARED TOKENS (7): "distinct", "forms", "life", "means", "process", "rather", "specific". | EXACT TITLE in dental: "Sterilization (microbiology)".
0.340
carecostsdentaldesignedformhealthinsurance
SHARED TOKENS (7): "care", "costs", "dental", "designed", "form", "health", "insurance". | EXACT TITLE in dental: "Dental insurance".
0.340
childrencreatingdentalhighermaterialsrisktreatment
SHARED TOKENS (7): "children", "creating", "dental", "higher", "materials", "risk", "treatment". | EXACT TITLE in dental: "Dental sealant".
0.320
lawlegalmakingnonprofitofficialrecognition
SHARED TOKENS (6): "law", "legal", "making", "nonprofit", "official", "recognition". | EXACT TITLE in nonprofits_community: "Nonprofit corporation".
0.320
developmentenvironmenthistoricalmaintainspreservationprotect
SHARED TOKENS (6): "development", "environment", "historical", "maintains", "preservation", "protect". | EXACT TITLE in nonprofits_community: "Historic preservation".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in dental: "Idaho Department of Health and Welfare".
0.320
Coalition ↗ Q124964 EXACT TITLE
formationfrequentlygroupgroupstogetherwork
SHARED TOKENS (6): "formation", "frequently", "group", "groups", "together", "work". | EXACT TITLE in nonprofits_community: "Coalition".
0.300
agenciesannouncedcharitiesleadershiplocalmembermembershipnationalnetworkofficeorganizationorganizationspositionsocialuniversity
SHARED TOKENS (15): "agencies", "announced", "charities", "leadership", "local", "member", "membership", "national", "network", "office", "organization", "organizations", "position", "social", "university".
0.300
annualaroundassessmentassistantavailabilitycarechildrendemanddemonstratedentalearlyeducationeffectivegeneralhealthhoursimplementationinstructionlocalneeds
SHARED TOKENS (30): "annual", "around", "assessment", "assistant", "availability", "care", "children", "demand", "demonstrate", "dental", "early", "education", "effective", "general", "health", "hours", "implementation", "instruction", "local", "needs"....
0.300
accessaccordingaffordableannualaroundassessmentassociationcannotcostsdepartmentdevelopmentearlyemergingevenfoundgrantshealthhistoricallyhomehousing
SHARED TOKENS (43): "access", "according", "affordable", "annual", "around", "assessment", "association", "cannot", "costs", "department", "development", "early", "emerging", "even", "found", "grants", "health", "historically", "home", "housing"....
0.300
Food bank ↗ Q113603 KW CROSS HIGH
activeadministrationassistancecharitablecommunitiescommunityconditionscostscreatedependdirectlydistributedistributionemergencyestablishedevenexperiencefinancialgrowthhealthcare
SHARED TOKENS (38): "active", "administration", "assistance", "charitable", "communities", "community", "conditions", "costs", "create", "depend", "directly", "distribute", "distribution", "emergency", "established", "even", "experience", "financial", "growth", "healthcare"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actactivitiesaffordablebenefitcarecontractingcontrolscostsdeliveryearlyestablishmentformsgroupgrowthhealthhealthcareimpactimplementationinsurancelife
SHARED TOKENS (34): "act", "activities", "affordable", "benefit", "care", "contracting", "controls", "costs", "delivery", "early", "establishment", "forms", "group", "growth", "health", "healthcare", "impact", "implementation", "insurance", "life"....
0.300
Oral cancer ↗ Q1143025 KW CROSS HIGH
combinationcommonlydependdependentdeterminediagnosisexposuregeneralhealthlocalregionalriskrolesizetherapy
SHARED TOKENS (15): "combination", "commonly", "depend", "dependent", "determine", "diagnosis", "exposure", "general", "health", "local", "regional", "risk", "role", "size", "therapy".
0.300
Toothache ↗ Q143925 KW CROSS HIGH
actionactivitiesaroundcommonlyconditionsdemanddentaldependsdiagnosisemergencyhistoricallyimpactmedicalmillionresponsestructurestreatment
SHARED TOKENS (17): "action", "activities", "around", "commonly", "conditions", "demand", "dental", "depends", "diagnosis", "emergency", "historically", "impact", "medical", "million", "response", "structures", "treatment".
0.300
accordingactivitiescharitablechildrencodecompetitioneducationalfederalincomeinternallawnonprofitorganizationorganizationsprimarypublicreceiverequirementsrevenuesafety
SHARED TOKENS (20): "according", "activities", "charitable", "children", "code", "competition", "educational", "federal", "income", "internal", "law", "nonprofit", "organization", "organizations", "primary", "public", "receive", "requirements", "revenue", "safety".
0.300
Mutual aid ↗ KW CROSS HIGH
accessbarriersbenefitbeyondcollectivecommunitiescommunityconditionsdistincteducationexecutiveformfoundgrantgroupgroupsleadershipmaterialmeansmeeting
SHARED TOKENS (33): "access", "barriers", "benefit", "beyond", "collective", "communities", "community", "conditions", "distinct", "education", "executive", "form", "found", "grant", "group", "groups", "leadership", "material", "means", "meeting"....
0.300
accordingagenciesamericanassociationsbenefitscommunitiesconsumercostsdentaleffectiveexpandedfurthergroupshealthindividualissuemedicalmillionnationalorganized
SHARED TOKENS (44): "according", "agencies", "american", "associations", "benefits", "communities", "consumer", "costs", "dental", "effective", "expanded", "further", "groups", "health", "individual", "issue", "medical", "million", "national", "organized"....
0.300
actualagencyamericanexecutivefederalfirmsformfreegovernancegovernmentgroupsincreasingincreasinglyindependentindustrylocalmembersmunicipalplaceprofessional
SHARED TOKENS (33): "actual", "agency", "american", "executive", "federal", "firms", "form", "free", "governance", "government", "groups", "increasing", "increasingly", "independent", "industry", "local", "members", "municipal", "place", "professional"....
0.300
administrationagenciesagencyamongapplicantscarecommercialcommissiondifferentenvironmentalfederalgovernmenthealthindividualindustrylicenselicensedlicenseslicensurelinks
SHARED TOKENS (38): "administration", "agencies", "agency", "among", "applicants", "care", "commercial", "commission", "different", "environmental", "federal", "government", "health", "individual", "industry", "license", "licensed", "licenses", "licensure", "links"....
0.300
Charity shop ↗ Q153551 KW CROSS HIGH
buildingbusinesscharitablecompetitivecostsestablishmentfreeincomelowmaintenancemunicipalonlineoperatingorganizationphysicalpublicpurposesocialstatedvolunteers
SHARED TOKENS (20): "building", "business", "charitable", "competitive", "costs", "establishment", "free", "income", "low", "maintenance", "municipal", "online", "operating", "organization", "physical", "public", "purpose", "social", "stated", "volunteers".
0.300
amonganalysisapplicationcareclinicaldatadevelopmentdiagnosishealthhealthcarehumanintelligenceinvolvingjobsmedicalmonitoringpatientplanningprofessionalspublic
SHARED TOKENS (27): "among", "analysis", "application", "care", "clinical", "data", "development", "diagnosis", "health", "healthcare", "human", "intelligence", "involving", "jobs", "medical", "monitoring", "patient", "planning", "professionals", "public"....
0.300
accordingadministeredagencyamongassociationbenefitbenefitsbusinesscarecentralcommunitycostscoveragecoveringdefineddisabilityemployerevidenceexpensesgovernment
SHARED TOKENS (39): "according", "administered", "agency", "among", "association", "benefit", "benefits", "business", "care", "central", "community", "costs", "coverage", "covering", "defined", "disability", "employer", "evidence", "expenses", "government"....
0.300
Trauma-informed care ↗ KW CROSS HIGH
architecturebasicbroadcarecreatingcultureeducationexperiencedexposureframeworkhealthhumanimpactinformationintegratedlawmodelneedorganizationspractice
SHARED TOKENS (30): "architecture", "basic", "broad", "care", "creating", "culture", "education", "experienced", "exposure", "framework", "health", "human", "impact", "information", "integrated", "law", "model", "need", "organizations", "practice"....
0.300
additionalassociationassociationsbusinesscharitiesemploymentenvironmentalformfunctiongovernmentgroupgroupsjoinleastlocalmembersmembershipneedoccupationaloperations
SHARED TOKENS (32): "additional", "association", "associations", "business", "charities", "employment", "environmental", "form", "function", "government", "group", "groups", "join", "least", "local", "members", "membership", "need", "occupational", "operations"....
0.300
accreditationadministrationamericanboardcarecommissiondentaldependseligibilityexpandedgeneralmaintainsmanagementmonitoringparticipationpatientprocedureproceduresprocessprofile
SHARED TOKENS (31): "accreditation", "administration", "american", "board", "care", "commission", "dental", "depends", "eligibility", "expanded", "general", "maintains", "management", "monitoring", "participation", "patient", "procedure", "procedures", "process", "profile"....
0.300
accessadministersadministrationboardestablishedfundingindependentlawlegalmembersmillionnonprofitofficeofficesoperationsorganizationspercentpolicyprocessprograms
SHARED TOKENS (27): "access", "administers", "administration", "board", "established", "funding", "independent", "law", "legal", "members", "million", "nonprofit", "office", "offices", "operations", "organizations", "percent", "policy", "process", "programs"....
0.300
accessaffectagenciesbasicbeyondchildchildrencommunitycomprehensivecreatecreatingdefinesdelivereddesigneddevelopmenteducationeffectiveenvironmentenvironmentaleven
SHARED TOKENS (64): "access", "affect", "agencies", "basic", "beyond", "child", "children", "community", "comprehensive", "create", "creating", "defines", "delivered", "designed", "development", "education", "effective", "environment", "environmental", "even"....
0.300
amongcontactcontainscontroldeterminedirectlyevenfoundhealthhumanidentifiedmeansmedicalpracticeprimaryratherthoughworkers
SHARED TOKENS (18): "among", "contact", "contains", "control", "determine", "directly", "even", "found", "health", "human", "identified", "means", "medical", "practice", "primary", "rather", "though", "workers".
0.300
certificateclinicaldegreedentalgeneralgraduatemedicalpracticeprogramprogramsrecognizedrequiredrequiresspecifictraining
SHARED TOKENS (15): "certificate", "clinical", "degree", "dental", "general", "graduate", "medical", "practice", "program", "programs", "recognized", "required", "requires", "specific", "training".
0.300
Public art ↗ Q557141 KW CROSS HIGH
absenceadjacentcommercialcriticaldirectformfunctiongeneralindependentmaintenancemeaningnearofficialoutsidephysicallyprivateprocessprocurementprofessionalproperty
SHARED TOKENS (27): "absence", "adjacent", "commercial", "critical", "direct", "form", "function", "general", "independent", "maintenance", "meaning", "near", "official", "outside", "physically", "private", "process", "procurement", "professional", "property"....
0.300
academicacquisitionapplicationapplicationsapplyingcaredatadesigndevelopmenthealthhealthcarehospitalsimplementationinformationinstitutionsintelligencemanagementmedicalpatientprocessing
SHARED TOKENS (26): "academic", "acquisition", "application", "applications", "applying", "care", "data", "design", "development", "health", "healthcare", "hospitals", "implementation", "information", "institutions", "intelligence", "management", "medical", "patient", "processing"....
0.300
accordingactionactiveagainstageamongannualautomatedclearcombinationcontainsearlyeitherevidenceformfoundgroupshealthhistoryidentified
SHARED TOKENS (36): "according", "action", "active", "against", "age", "among", "annual", "automated", "clear", "combination", "contains", "early", "either", "evidence", "form", "found", "groups", "health", "history", "identified"....
0.300
actadministrativeauthorizedbusinessescareconcerningcoverageelectronicemployeesemployersentitiesestablishmentfamiliesfamilyfederalgenerallygovernsgroupguidelineshealth
SHARED TOKENS (41): "act", "administrative", "authorized", "businesses", "care", "concerning", "coverage", "electronic", "employees", "employers", "entities", "establishment", "families", "family", "federal", "generally", "governs", "group", "guidelines", "health"....
0.300
School meal ↗ Q1195832 KW CROSS HIGH
adultsaggregateamongaroundbarriersbenefitschildrencoverageeducationlocallow-incomemillionnetprimaryprogramsprovidereceivesafetyschoolschools
SHARED TOKENS (25): "adults", "aggregate", "among", "around", "barriers", "benefits", "children", "coverage", "education", "local", "low-income", "million", "net", "primary", "programs", "provide", "receive", "safety", "school", "schools"....
0.300
accessactivitiesbroadcollectivelycommonlycompetitiondegreedemandenvironmentfacilitiesfreegeneralgenerallyindividualorganizedoutsidephysicalpopulationratherrenewal
SHARED TOKENS (22): "access", "activities", "broad", "collectively", "commonly", "competition", "degree", "demand", "environment", "facilities", "free", "general", "generally", "individual", "organized", "outside", "physical", "population", "rather", "renewal"....
0.300
Sleep apnea ↗ Q213600 KW CROSS HIGH
additionalageanalysisbasiccentralcombinationcomplianceconcentrationconditionscontrolcontrolsdegreedetermineseffectiveeffortevidenceexperiencefamilyflowform
SHARED TOKENS (41): "additional", "age", "analysis", "basic", "central", "combination", "compliance", "concentration", "conditions", "control", "controls", "degree", "determines", "effective", "effort", "evidence", "experience", "family", "flow", "form"....
0.300
affordableapproximatelyassistancecommonlycreatedepartmentdesigneddevelopmentexclusivelyfamiliesfederalgranthomehousingidentificationincomeinvestmentlocallowlow-income
SHARED TOKENS (27): "affordable", "approximately", "assistance", "commonly", "create", "department", "designed", "development", "exclusively", "families", "federal", "grant", "home", "housing", "identification", "income", "investment", "local", "low", "low-income"....
0.300
activitiesadministrationdepartmentdescribeseducationemergencyenforcementgoverningguidelineshealthcarelawlicenselicensingmedicalnationalpracticepractitionerpractitionersprofessionalregulations
SHARED TOKENS (24): "activities", "administration", "department", "describes", "education", "emergency", "enforcement", "governing", "guidelines", "healthcare", "law", "license", "licensing", "medical", "national", "practice", "practitioner", "practitioners", "professional", "regulations"....
0.300
accessaffordableamericananalysischildrencomprehensivecostsdataestablishedfederalgovernmenthealthhigherhistoricallyhistoryhousinglandlordslinkedlow-incomepattern
SHARED TOKENS (33): "access", "affordable", "american", "analysis", "children", "comprehensive", "costs", "data", "established", "federal", "government", "health", "higher", "historically", "history", "housing", "landlords", "linked", "low-income", "pattern"....
0.300
analysisannualclinicalcreatingdatadesigneddigitalestablishesexposureformsfunctiongraphidentifyindustryintegratedinternalmedicalmillionpatientprocedure
SHARED TOKENS (27): "analysis", "annual", "clinical", "creating", "data", "designed", "digital", "establishes", "exposure", "forms", "function", "graph", "identify", "industry", "integrated", "internal", "medical", "million", "patient", "procedure"....
0.300
absencearoundassociationassociationsauthoritycapitalcommunitiescommunitydefineddegreedevelopmentgenerallygeographicgovernancehousingintegrationlegallinkslocalmembership
SHARED TOKENS (43): "absence", "around", "association", "associations", "authority", "capital", "communities", "community", "defined", "degree", "development", "generally", "geographic", "governance", "housing", "integration", "legal", "links", "local", "membership"....
0.300
Municipality ↗ Q15284 KW CROSS HIGH
administrativecommunitiesdistrictdivisionearlygoverninggovernmentincorporationlocalnationalplaceregionalsinglesmallsocialstatus
SHARED TOKENS (16): "administrative", "communities", "district", "division", "early", "governing", "government", "incorporation", "local", "national", "place", "regional", "single", "small", "social", "status".
0.300
Dentures ↗ Q143567 EXACT TITLE
categoriescompleteconventionaldentalsupported
SHARED TOKENS (5): "categories", "complete", "conventional", "dental", "supported". | EXACT TITLE in dental: "Dentures".
0.300
Disinfectant ↗ Q73984 KW CROSS HIGH
buildingcontactdefineddentaldifferenteffectiveformformsfrequentlygenerallyhistoricallyhospitalshumanlifemedicalphysicalpossessprocesssectorsimultaneously
SHARED TOKENS (22): "building", "contact", "defined", "dental", "different", "effective", "form", "forms", "frequently", "generally", "historically", "hospitals", "human", "life", "medical", "physical", "possess", "process", "sector", "simultaneously"....
0.300
accordingactactivitiesapproximatelyassociationassociationscentersconsumercontroldefineddepartmentdevelopmentdirectlyentitiesevenformalfundinggenerallygovernmentgroup
SHARED TOKENS (45): "according", "act", "activities", "approximately", "association", "associations", "centers", "consumer", "control", "defined", "department", "development", "directly", "entities", "even", "formal", "funding", "generally", "government", "group"....
0.300
adjacentapplicationcomplaintsconditionsdatademanddentaldeterminesdevelopmentdiagnosisearlyevenfutureidentifymanagementofficespatientperformancepointpractice
SHARED TOKENS (31): "adjacent", "application", "complaints", "conditions", "data", "demand", "dental", "determines", "development", "diagnosis", "early", "even", "future", "identify", "management", "offices", "patient", "performance", "point", "practice"....
0.300
accesscarecentercenterscentralclinicscommonlycommunitydentalexpandedfamilygeneralgrouphealthhealthcareinternallocallow-incomenetworkplanning
SHARED TOKENS (25): "access", "care", "center", "centers", "central", "clinics", "commonly", "community", "dental", "expanded", "family", "general", "group", "health", "healthcare", "internal", "local", "low-income", "network", "planning"....
0.300
Community art ↗ Q2801695 KW CROSS HIGH
actbusinessescenterscommunitiescommunitydefineddevelopersdistricteventsformlocalmembersnationalnetworksorganizationsparticipationpracticeprofessionalrecentrelated
SHARED TOKENS (24): "act", "businesses", "centers", "communities", "community", "defined", "developers", "district", "events", "form", "local", "members", "national", "networks", "organizations", "participation", "practice", "professional", "recent", "related"....
0.300
actadministrationagenciesapplicationclassificationclassificationscomprehensivecontrolcontrolleddecisionsdeterminedistributionenforcementestablishingfederalinitialisolatedlawmedicalnational
SHARED TOKENS (28): "act", "administration", "agencies", "application", "classification", "classifications", "comprehensive", "control", "controlled", "decisions", "determine", "distribution", "enforcement", "establishing", "federal", "initial", "isolated", "law", "medical", "national"....
0.300
ableaccessaccessibilityaccordingaffectingalonebarriersbenefitsboundarycannotconditionscontrolcreatecurrentdesigneddisabilityevenexperienceextendsformal
SHARED TOKENS (43): "able", "access", "accessibility", "according", "affecting", "alone", "barriers", "benefits", "boundary", "cannot", "conditions", "control", "create", "current", "designed", "disability", "even", "experience", "extends", "formal"....
0.300
affectaffectingageamongexplicitlyformfundinggroupgroupshousingmarketplacesourcestatustreatment
SHARED TOKENS (15): "affect", "affecting", "age", "among", "explicitly", "form", "funding", "group", "groups", "housing", "market", "place", "source", "status", "treatment".
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
addressesaffectagainstamericancarechildrencommunitycomprehensivedifferenteducationeffectiveemergencyemploymententeringevidencefamilyformgovernmenthealthcarehospitals
SHARED TOKENS (54): "addresses", "affect", "against", "american", "care", "children", "community", "comprehensive", "different", "education", "effective", "emergency", "employment", "entering", "evidence", "family", "form", "government", "healthcare", "hospitals"....
0.300
americanassociationcategorycurrentdepartmenteventsfeaturesfinancialgovernmentissuelaterlocalmajorofficeperformancereceivedreceivingresponsereviewsstaff
SHARED TOKENS (22): "american", "association", "category", "current", "department", "events", "features", "financial", "government", "issue", "later", "local", "major", "office", "performance", "received", "receiving", "response", "reviews", "staff"....
0.300
accordingactivitiesadultsaffordableapplicationcarechildrencounselingdatedecisionsdentaldisabilityeducationenvironmentalevengivinghealthhealthcarehomeidentify
SHARED TOKENS (38): "according", "activities", "adults", "affordable", "application", "care", "children", "counseling", "date", "decisions", "dental", "disability", "education", "environmental", "even", "giving", "health", "healthcare", "home", "identify"....
0.300
actanalysisapplicationauthoritycannotcategorycreatedatadecisionsdescribesdesigndifferentevenfeaturesformsfunctiongeneralhealthcarehistoricalhuman
SHARED TOKENS (51): "act", "analysis", "application", "authority", "cannot", "category", "create", "data", "decisions", "describes", "design", "different", "even", "features", "forms", "function", "general", "healthcare", "historical", "human"....
0.300
Art therapy ↗ Q928865 KW CROSS HIGH
actualapproximatelyassessmentclinicalcontrolcouncildifferentdistinctessentialevidencefoundfunctiongrowthhealthlifemeaningnationalpathwaysprocessproviding
SHARED TOKENS (26): "actual", "approximately", "assessment", "clinical", "control", "council", "different", "distinct", "essential", "evidence", "found", "function", "growth", "health", "life", "meaning", "national", "pathways", "process", "providing"....
0.300
Primary care ↗ KW CROSS HIGH
additionalassistantcareclinicalcommonlycontactcontinuingfamilygeneralhealthhealthcarepatientphysicalpointpractitionerprimaryprincipalprofessionalprofessionalsprovider
SHARED TOKENS (23): "additional", "assistant", "care", "clinical", "commonly", "contact", "continuing", "family", "general", "health", "healthcare", "patient", "physical", "point", "practitioner", "primary", "principal", "professional", "professionals", "provider"....
0.300
ableagenciesbenefitbusinesscharitablechildreneducationalevenexpensesformhealthcareincomeinstitutionslegalorganizationpaymentprovideprovidersreducedreferrals
SHARED TOKENS (23): "able", "agencies", "benefit", "business", "charitable", "children", "educational", "even", "expenses", "form", "healthcare", "income", "institutions", "legal", "organization", "payment", "provide", "providers", "reduced", "referrals"....
0.300
administrationaroundbuildingcapitalcontractingcostsdevelopmenteitherevidencefinancialfinancingfundinggovernmenthigherhospitalsincreasinginfrastructureinstitutionsinvestmentlong-term
SHARED TOKENS (37): "administration", "around", "building", "capital", "contracting", "costs", "development", "either", "evidence", "financial", "financing", "funding", "government", "higher", "hospitals", "increasing", "infrastructure", "institutions", "investment", "long-term"....
0.300
administrationassistancebenefitsdepartmentdisabilityeducationalhealthcarehomeinjuryinsurancemedicaloccupationalpersonnelreceivesocial
SHARED TOKENS (15): "administration", "assistance", "benefits", "department", "disability", "educational", "healthcare", "home", "injury", "insurance", "medical", "occupational", "personnel", "receive", "social".
0.300
Biomedical waste ↗ KW CROSS HIGH
activitiescareclinicalclinicscontactcontainingdiagnosisdistinctemergencyenvironmentenvironmentalfacilitiesgeneralhealthhealthcarehomehospitalhospitalshumaninjury
SHARED TOKENS (34): "activities", "care", "clinical", "clinics", "contact", "containing", "diagnosis", "distinct", "emergency", "environment", "environmental", "facilities", "general", "health", "healthcare", "home", "hospital", "hospitals", "human", "injury"....
0.300
administrationagencyamericanassistancebenefitscentersclinicscostsdepartmentdisabilityeducationeligibleemergencyestablishedexecutiveexpandedfacilitiesfamilyfederalfuture
SHARED TOKENS (36): "administration", "agency", "american", "assistance", "benefits", "centers", "clinics", "costs", "department", "disability", "education", "eligible", "emergency", "established", "executive", "expanded", "facilities", "family", "federal", "future"....
0.300
administersagencydepartmentdevelopmentdirectlyexecutivefederalfinancinggovernmenthomehousingmemberprogramreportssocietyurban
SHARED TOKENS (16): "administers", "agency", "department", "development", "directly", "executive", "federal", "financing", "government", "home", "housing", "member", "program", "reports", "society", "urban".
0.300
accordingagainstamongauthorityavailabilitycommonlyconstructiondistrictdistrictsearlyenvironmentalexplicitlyhousinglandlocalmajormetropolitanoperatingplanningproperty
SHARED TOKENS (33): "according", "against", "among", "authority", "availability", "commonly", "construction", "district", "districts", "early", "environmental", "explicitly", "housing", "land", "local", "major", "metropolitan", "operating", "planning", "property"....
0.300
chambercontainingentitiesfuturegenerallymaterialphysicalprimaryprocedureproceduressmallstructuressubsequenttherapytreatment
SHARED TOKENS (15): "chamber", "containing", "entities", "future", "generally", "material", "physical", "primary", "procedure", "procedures", "small", "structures", "subsequent", "therapy", "treatment".
0.300
actamericanapplicableapplieschildchildrencodecommonlyconcerningdevelopmentdifferentenforcementexpandedfamiliesfamilyfederalfinancingfundinghousinglaw
SHARED TOKENS (31): "act", "american", "applicable", "applies", "child", "children", "code", "commonly", "concerning", "development", "different", "enforcement", "expanded", "families", "family", "federal", "financing", "funding", "housing", "law"....
0.300
Health equity ↗ Q1512929 KW CROSS HIGH
ableabsenceaccessaccordingallocatedamongbasiccannotcarecompleteconnecteddefineddescribesdevelopmentdifferentdisabilitydistinctdistributedessentialformal
SHARED TOKENS (43): "able", "absence", "access", "according", "allocated", "among", "basic", "cannot", "care", "complete", "connected", "defined", "describes", "development", "different", "disability", "distinct", "distributed", "essential", "formal"....
0.300
affectaffectingagainstbenefitbenefitsconcerningconditionscreatecreatesdecisionsdirectdisclosureeitherestablishedevidenceexperiencefamilyfinancialgivinghealth
SHARED TOKENS (49): "affect", "affecting", "against", "benefit", "benefits", "concerning", "conditions", "create", "creates", "decisions", "direct", "disclosure", "either", "established", "evidence", "experience", "family", "financial", "giving", "health"....
0.300
Digital divide ↗ Q244752 KW CROSS HIGH
ableaccessaccordingagecommunitiesconnectdatadigitaleducationalgroupshouseholdshousinginformationjobslow-incomematerialmillionopportunitiesproducersreliable
SHARED TOKENS (28): "able", "access", "according", "age", "communities", "connect", "data", "digital", "educational", "groups", "households", "housing", "information", "jobs", "low-income", "material", "million", "opportunities", "producers", "reliable"....
0.300
accessibilityactadaagainstbroadbusinesscostscouncildisabilityeffectiveemployeesemployersidentitylaterlawnationalprovidepublicrecommendedrequirements
SHARED TOKENS (22): "accessibility", "act", "ada", "against", "broad", "business", "costs", "council", "disability", "effective", "employees", "employers", "identity", "later", "law", "national", "provide", "public", "recommended", "requirements"....
0.300
affectaloneanalysisannualaroundbuildingchildrencommonlycontrolenvironmentalexposureflowformhealthhouseholdhumaninsidelifelinkedmajor
SHARED TOKENS (32): "affect", "alone", "analysis", "annual", "around", "building", "children", "commonly", "control", "environmental", "exposure", "flow", "form", "health", "household", "human", "inside", "life", "linked", "major"....
0.300
aroundauthorizedcommunitydefineddevelopmentdirectlydistrictfinancingfutureinfrastructureinvestmentneedprivateprogrampropertypublicrelatedrevenue
SHARED TOKENS (18): "around", "authorized", "community", "defined", "development", "directly", "district", "financing", "future", "infrastructure", "investment", "need", "private", "program", "property", "public", "related", "revenue".
0.300
accessadministrationagainstagencyannouncedcarechildrencommunitiesdepartmenteventsexperiencefederalfinancialgovernmenthealthhumanintegratedisolatedleadershipmaintains
SHARED TOKENS (35): "access", "administration", "against", "agency", "announced", "care", "children", "communities", "department", "events", "experience", "federal", "financial", "government", "health", "human", "integrated", "isolated", "leadership", "maintains"....
0.300
activecommonlyconcentrationcontactcreatedelivereddentaldeterminesdifferenteitherexposurefreehumanmarketprocessproduceprofessionalssmallsmallertreatment
SHARED TOKENS (21): "active", "commonly", "concentration", "contact", "create", "delivered", "dental", "determines", "different", "either", "exposure", "free", "human", "market", "process", "produce", "professionals", "small", "smaller", "treatment"....
0.300
academicaddressesamongcareconnectscontroldeliverydepartmentessentialexpandedguidelineshealthhealthcarehospitalinfrastructurelocalmedicalmonitoringorganizationpractice
SHARED TOKENS (32): "academic", "addresses", "among", "care", "connects", "control", "delivery", "department", "essential", "expanded", "guidelines", "health", "healthcare", "hospital", "infrastructure", "local", "medical", "monitoring", "organization", "practice"....
0.300
administeredadministrativeaffordableagenciesagencyassistanceauthoritycentralcombinationdepartmentdevelopmentdifferentdirectlydistinctfamiliesformgenerallygovernmenthomehousing
SHARED TOKENS (40): "administered", "administrative", "affordable", "agencies", "agency", "assistance", "authority", "central", "combination", "department", "development", "different", "directly", "distinct", "families", "form", "generally", "government", "home", "housing"....
0.300
administeredadministersagencyapproximatelyassistancecommercialcommunitiescurrentdepartmentdirectlyexecutivefederalgovernmentmembernationalneedsnutritionproductionprogramprograms
SHARED TOKENS (26): "administered", "administers", "agency", "approximately", "assistance", "commercial", "communities", "current", "department", "directly", "executive", "federal", "government", "member", "national", "needs", "nutrition", "production", "program", "programs"....
0.300
alongsidecontrolcontrolscreatedesigneducationalmanagementmaterialmodeloperationsplanningprimaryprocessproductionpurposerequiredschoolssimultaneouslysoftwarestorage
SHARED TOKENS (26): "alongside", "control", "controls", "create", "design", "educational", "management", "material", "model", "operations", "planning", "primary", "process", "production", "purpose", "required", "schools", "simultaneously", "software", "storage"....
0.300
accessibilityarchitecturearoundbarriersdifferentdisabilityeducationemployersemploymentenvironmentfunctionshousingindependentinstitutionallegalmultipleopportunitiesorganizationsphysicalprovide
SHARED TOKENS (25): "accessibility", "architecture", "around", "barriers", "different", "disability", "education", "employers", "employment", "environment", "functions", "housing", "independent", "institutional", "legal", "multiple", "opportunities", "organizations", "physical", "provide"....
0.300
actadministeredagainstagenciesapplicantsapproximatelyassistancebenefitschildrencodecommonlydepartmentdevelopmentfamilieshouseholdshousingincomelandlordslocallocally
SHARED TOKENS (38): "act", "administered", "against", "agencies", "applicants", "approximately", "assistance", "benefits", "children", "code", "commonly", "department", "development", "families", "households", "housing", "income", "landlords", "local", "locally"....
0.300
aroundbroadcategoriescommonlydentaldirectdirectlyfunctioninsidematerialsoutsideproceduressinglestructuralstructuresupporttherapy
SHARED TOKENS (17): "around", "broad", "categories", "commonly", "dental", "direct", "directly", "function", "inside", "materials", "outside", "procedures", "single", "structural", "structure", "support", "therapy".
0.300
applyingbenefitbusinesscategorydegreeentitiesformgeneralgroupsidentifylargerlawlegalliabilitylicensedmedicalmultipleordinaryorganizedowner
SHARED TOKENS (29): "applying", "benefit", "business", "category", "degree", "entities", "form", "general", "groups", "identify", "larger", "law", "legal", "liability", "licensed", "medical", "multiple", "ordinary", "organized", "owner"....
0.300
actadministeredadministrationagenciesamericancurrentdebtdepartmentearlyestablishedexecutivefederalfinancialgovernmentinstitutionsinternallicensesmajormembernational
SHARED TOKENS (28): "act", "administered", "administration", "agencies", "american", "current", "debt", "department", "early", "established", "executive", "federal", "financial", "government", "institutions", "internal", "licenses", "major", "member", "national"....
0.300
Nitrous oxide ↗ Q905750 KW CROSS HIGH
amongcommonlyconcentrationdescribesessentialhealthimpactincreasingmajormedicalorganizationsignificantsoilsubstantiallyuses
SHARED TOKENS (15): "among", "commonly", "concentration", "describes", "essential", "health", "impact", "increasing", "major", "medical", "organization", "significant", "soil", "substantially", "uses".
0.300
actamericanassociationauthorityauthorizeddemanddepartmentearlierformationincreasingindustryinformationmarketmarketsmillionorganizationspositionproducerproducersprogram
SHARED TOKENS (25): "act", "american", "association", "authority", "authorized", "demand", "department", "earlier", "formation", "increasing", "industry", "information", "market", "markets", "million", "organizations", "position", "producer", "producers", "program"....
0.300
adaboisecentercentralconnectedcontainsidahoitselfmetropolitannationalpopulationruralstarvalleywestern
SHARED TOKENS (15): "ada", "boise", "center", "central", "connected", "contains", "idaho", "itself", "metropolitan", "national", "population", "rural", "star", "valley", "western".
0.300
accordingactionagainstagencyamericancentercommissionconsumerdatadecisionsdegreedonorseffectiveeligibilityfederalfinancingfoundfundinggeneralgoverned
SHARED TOKENS (46): "according", "action", "against", "agency", "american", "center", "commission", "consumer", "data", "decisions", "degree", "donors", "effective", "eligibility", "federal", "financing", "found", "funding", "general", "governed"....
0.300
collectivecomcommonlycommunitiescommunityconsumerevenexperiencefoundinformationmembersonlinephysicallyprogramprovidingprovisionsrelatedrolesignificantsupport
SHARED TOKENS (24): "collective", "com", "commonly", "communities", "community", "consumer", "even", "experience", "found", "information", "members", "online", "physically", "program", "providing", "provisions", "related", "role", "significant", "support"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
brandedbusinesscapitalchaincompeteconditionsdirectexpansionexplicitlyfinancialgrowthindividualinvestmentlegalliabilitylicenseslicensingmarketmeansmodel
SHARED TOKENS (33): "branded", "business", "capital", "chain", "compete", "conditions", "direct", "expansion", "explicitly", "financial", "growth", "individual", "investment", "legal", "liability", "licenses", "licensing", "market", "means", "model"....
0.300
ableamongcharitablegovernmenthomehospitalslifeneedorganizationprogramprogramsqualityresearchunablevolunteers
SHARED TOKENS (15): "able", "among", "charitable", "government", "home", "hospitals", "life", "need", "organization", "program", "programs", "quality", "research", "unable", "volunteers".
0.300
aloneassistanceavailabilitycannotcaredependdependentemergencyhealthhomehospitalinjurylifelong-termmedicalmultipleoutsidepatientqualifiedquality
SHARED TOKENS (26): "alone", "assistance", "availability", "cannot", "care", "depend", "dependent", "emergency", "health", "home", "hospital", "injury", "life", "long-term", "medical", "multiple", "outside", "patient", "qualified", "quality"....
0.300
ableactivearoundeffectiveformshealthhumanincreasingindividualmeansphysicalprogramspublicseparatelythoughtransportation
SHARED TOKENS (16): "able", "active", "around", "effective", "forms", "health", "human", "increasing", "individual", "means", "physical", "programs", "public", "separately", "though", "transportation".
0.300
amongcontactdevelopmentdistinctenforcementevenexposuregenerallyhealthcarehumanincreasinginjurylawoccupationaloccupationsrecognitionregulationriskthoughworkers
SHARED TOKENS (20): "among", "contact", "development", "distinct", "enforcement", "even", "exposure", "generally", "healthcare", "human", "increasing", "injury", "law", "occupational", "occupations", "recognition", "regulation", "risk", "though", "workers".
0.300
additionalamericanboardcarecertificationcollegecontroldegreedentaldependentdirectlydisabilityeducationenvironmentalhealthhistoryhomehospitalmaintenancemedical
SHARED TOKENS (29): "additional", "american", "board", "care", "certification", "college", "control", "degree", "dental", "dependent", "directly", "disability", "education", "environmental", "health", "history", "home", "hospital", "maintenance", "medical"....
0.300
accessamongarounddatadegreedentaldiagnosisdigitaldistinctincreasinglyintegratedmedicalpatientplanningregionsinglesoftwarespecializedtechnologytherapy
SHARED TOKENS (22): "access", "among", "around", "data", "degree", "dental", "diagnosis", "digital", "distinct", "increasingly", "integrated", "medical", "patient", "planning", "region", "single", "software", "specialized", "technology", "therapy"....
0.300
carecombinationdepartmentemergencyevengeneraloperatingpatientpointpractitionerprocedureproceduresprotectrequiredsystemunitview
SHARED TOKENS (17): "care", "combination", "department", "emergency", "even", "general", "operating", "patient", "point", "practitioner", "procedure", "procedures", "protect", "required", "system", "unit", "view".
0.300
actadministrationagencyauthoritycontrolcurrentdepartmentdirectlyemployeesfederalhealthhouseholdhumanlaboratoriesmedicalofficesprescriptionprimarypublicregulated
SHARED TOKENS (27): "act", "administration", "agency", "authority", "control", "current", "department", "directly", "employees", "federal", "health", "household", "human", "laboratories", "medical", "offices", "prescription", "primary", "public", "regulated"....
0.300
amongappliesassociationcharitablechildrencodecommunitycompetitiondonorseducationalentitiesexclusivelyfederalformfoundationsgrantincomeindividualnationalnonprofit
SHARED TOKENS (31): "among", "applies", "association", "charitable", "children", "code", "community", "competition", "donors", "educational", "entities", "exclusively", "federal", "form", "foundations", "grant", "income", "individual", "national", "nonprofit"....
0.300
activitiesagainstagencyboardbusinessdegreeexecutivegeneralgoverninggovernmentidentificationinstitutionitselflawmanagementmembersmembershipnonprofitorganizationownership
SHARED TOKENS (23): "activities", "against", "agency", "board", "business", "degree", "executive", "general", "governing", "government", "identification", "institution", "itself", "law", "management", "members", "membership", "nonprofit", "organization", "ownership"....
0.300
actionalonearoundcollectivecommunitycouncilcreatecross-sectordefineddifferentearlierfocusedformframeworkgroupidentifiesimpactindependentinstitutionalinstitutions
SHARED TOKENS (42): "action", "alone", "around", "collective", "community", "council", "create", "cross-sector", "defined", "different", "earlier", "focused", "form", "framework", "group", "identifies", "impact", "independent", "institutional", "institutions"....
0.300
additionalaroundclinicalcommonlycomprehensivecontrolledconventionalcriticaldentaldevelopmentdifferentdigitalelectronicenvironmentalexposurefurtherhistoricallymaterialmodernneeds
SHARED TOKENS (31): "additional", "around", "clinical", "commonly", "comprehensive", "controlled", "conventional", "critical", "dental", "development", "different", "digital", "electronic", "environmental", "exposure", "further", "historically", "material", "modern", "needs"....
0.300
accordingactaffordableagainstallocatedalongsideamericanassistancebenefitsbusinessbusinessescarechildchildrenclassificationconsolidatedcreditdirectdistributioneducation
SHARED TOKENS (41): "according", "act", "affordable", "against", "allocated", "alongside", "american", "assistance", "benefits", "business", "businesses", "care", "child", "children", "classification", "consolidated", "credit", "direct", "distribution", "education"....
0.300
3D printing ↗ Q229367 KW CROSS HIGH
constructioncontrolcreatingdigitalinternallayermaterialmodelpointprocessproduceproductionstructurestechnologytogetheruses
SHARED TOKENS (16): "construction", "control", "creating", "digital", "internal", "layer", "material", "model", "point", "process", "produce", "production", "structures", "technology", "together", "uses".
🫐 BERRY47 edges
0.280
Civil society ↗ Q181865 KW CROSS HIGH
aggregateamongbusinesscentraldistinctfamilygeneralgovernmentindependentinstitutionsorganizationsprivatesectorsociety
SHARED TOKENS (14): "aggregate", "among", "business", "central", "distinct", "family", "general", "government", "independent", "institutions", "organizations", "private", "sector", "society".
0.280
Fluoride ↗ Q44793182 EXACT TITLE
productionsizewaterwhose
SHARED TOKENS (4): "production", "size", "water", "whose". | EXACT TITLE in dental: "Fluoride".
0.280
cashcharitablecommonlydefinedestablishgivinginternallawplannedplanningpropertyrevenuerulesspecific
SHARED TOKENS (14): "cash", "charitable", "commonly", "defined", "establish", "giving", "internal", "law", "planned", "planning", "property", "revenue", "rules", "specific".
0.280
Raffle ↗ Q1761269 EXACT TITLE
againstcharitablecompetitionspecific
SHARED TOKENS (4): "against", "charitable", "competition", "specific". | EXACT TITLE in nonprofits_community: "Raffle".
0.280
collegenetworkprivateuniversity
SHARED TOKENS (4): "college", "network", "private", "university". | EXACT TITLE in dental: "Carrington College".
0.280
Malocclusion ↗ Q1320428 KW CROSS HIGH
accordingassessmentbenefitclassificationdatesdentalformalimpactmeetingmodernpatientpopulationrelationshiptreatment
SHARED TOKENS (14): "according", "assessment", "benefit", "classification", "dates", "dental", "formal", "impact", "meeting", "modern", "patient", "population", "relationship", "treatment".
0.260
adjacentbridgedental
SHARED TOKENS (3): "adjacent", "bridge", "dental". | EXACT TITLE in nonprofits_community: "Bridge (dentistry)". | EXACT TITLE in dental: "Bridge (dentistry)".
0.260
Wisdom tooth ↗ Q202517 KW CROSS HIGH
adultsagecarecommonlyearlygenerallyhealthhumanmovenationalspacethoughtreatment
SHARED TOKENS (13): "adults", "age", "care", "commonly", "early", "generally", "health", "human", "move", "national", "space", "though", "treatment".
0.260
actamericancapitaldesignedimpactincomeinvestmentjobsleastoperateoutcomesprogramqualified
SHARED TOKENS (13): "act", "american", "capital", "designed", "impact", "income", "investment", "jobs", "least", "operate", "outcomes", "program", "qualified".
0.240
businessdesigneddiscoveryelectronicfirmslawmanagementoperationspracticerecordssoftwaretrust
SHARED TOKENS (12): "business", "designed", "discovery", "electronic", "firms", "law", "management", "operations", "practice", "records", "software", "trust".
0.240
activitiescenterchurchescommunitygroupinformationlocalmemberspublicsocialsupportthough
SHARED TOKENS (12): "activities", "center", "churches", "community", "group", "information", "local", "members", "public", "social", "support", "though".
0.240
affectingarounddentaldiagnosisdifferentfunctionsmedicalregionrelatedrolestructuresstudy
SHARED TOKENS (12): "affecting", "around", "dental", "diagnosis", "different", "functions", "medical", "region", "related", "role", "structures", "study".
0.240
businessesconstructioncontractingfederalgovernmentlocalmarketsprocurementpropertypublicrealsuppliers
SHARED TOKENS (12): "businesses", "construction", "contracting", "federal", "government", "local", "markets", "procurement", "property", "public", "real", "suppliers".
0.240
controldatadifferentdigitaldisclosureforminformationlegalpublicrelationshiptechnologyuses
SHARED TOKENS (12): "control", "data", "different", "digital", "disclosure", "form", "information", "legal", "public", "relationship", "technology", "uses".
0.240
controlleddecisionsdefinesdistributedeffectiveessentialgovernancelong-termoperatedorganizationsperformancepractices
SHARED TOKENS (12): "controlled", "decisions", "defines", "distributed", "effective", "essential", "governance", "long-term", "operated", "organizations", "performance", "practices".
0.240
assistancecashdesignedfamiliesfeenetprogramspublicsafetyschoolsocialworks
SHARED TOKENS (12): "assistance", "cash", "designed", "families", "fee", "net", "programs", "public", "safety", "school", "social", "works".
0.220
adaboisecanyoncountieselmoreidahometropolitanregiontreasurevalleywashington
SHARED TOKENS (11): "ada", "boise", "canyon", "counties", "elmore", "idaho", "metropolitan", "region", "treasure", "valley", "washington".
0.220
distinctentryfrequentlygoverninggovernmentinternallawlegalnationalparticipateregulations
SHARED TOKENS (11): "distinct", "entry", "frequently", "governing", "government", "internal", "law", "legal", "national", "participate", "regulations".
0.220
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahometropolitanpopulationschoolschoolssharedstar
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "idaho", "metropolitan", "population", "school", "schools", "shared", "star".
0.220
Dental braces ↗ Q143977 KW CROSS HIGH
dentaleitherevenformhealthneedneedspositionstructuraltogetherview
SHARED TOKENS (11): "dental", "either", "even", "form", "health", "need", "needs", "position", "structural", "together", "view".
0.210
treatment
SHARED TOKENS (1): "treatment". | EXACT TITLE in dental: "Oral and maxillofacial surgery".
0.200
decisionselectronicexperienceformonlineprofessionalpurchasingreviewreviewssites
SHARED TOKENS (10): "decisions", "electronic", "experience", "form", "online", "professional", "purchasing", "review", "reviews", "sites".
0.200
activitiescharitablecharitiesformfurthergivinggroupprivateratheruses
SHARED TOKENS (10): "activities", "charitable", "charities", "form", "further", "giving", "group", "private", "rather", "uses".
0.200
boisecentercontainsextendsfederallyidahometropolitanpopulationrecognizedvalley
SHARED TOKENS (10): "boise", "center", "contains", "extends", "federally", "idaho", "metropolitan", "population", "recognized", "valley".
0.200
Endowment ↗ Q16775552 EXACT TITLE
EXACT TITLE in nonprofits_community: "Endowment".
0.200
boisecompletionestablishedextendshomeidahonorthpopulationruralvalley
SHARED TOKENS (10): "boise", "completion", "established", "extends", "home", "idaho", "north", "population", "rural", "valley".
0.180
Periodontology ↗ Q938196 KW CROSS HIGH
affectaroundconditionsdentaldiagnosisplacementpreventionstructurestreatment
SHARED TOKENS (9): "affect", "around", "conditions", "dental", "diagnosis", "placement", "prevention", "structures", "treatment".
0.180
absencecommonlyentirefunctiongenerallocalpathwaysprovidingspecific
SHARED TOKENS (9): "absence", "commonly", "entire", "function", "general", "local", "pathways", "providing", "specific".
0.180
accordingaroundhomeintegrationleadslocallong-termmillionoutside
SHARED TOKENS (9): "according", "around", "home", "integration", "leads", "local", "long-term", "million", "outside".
0.180
affordablehealthhousingincreasingoutcomesregulationssafesupplyzoning
SHARED TOKENS (9): "affordable", "health", "housing", "increasing", "outcomes", "regulations", "safe", "supply", "zoning".
0.180
constructioncreatedentalmajormemberpatientprescriptionprescriptionstechnology
SHARED TOKENS (9): "construction", "create", "dental", "major", "member", "patient", "prescription", "prescriptions", "technology".
0.160
Sales tax ↗ Q11055488 KW CROSS HIGH
consumerdirectlyeducationgoverningpointproviderelatedseller
SHARED TOKENS (8): "consumer", "directly", "education", "governing", "point", "provide", "related", "seller".
0.160
cannotcaredentalhomepracticeprofessionalprofessionalstreatment
SHARED TOKENS (8): "cannot", "care", "dental", "home", "practice", "professional", "professionals", "treatment".
0.160
affordableemergencyhousinglong-termpopulationresidentssupporttemporary
SHARED TOKENS (8): "affordable", "emergency", "housing", "long-term", "population", "residents", "support", "temporary".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitanpercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "percent", "population".
0.140
agencycommunitiesdepartmentgovernmentpolicyprovidepublic
SHARED TOKENS (7): "agency", "communities", "department", "government", "policy", "provide", "public".
0.140
councilestablishedhomeidahomakingpopulationrural
SHARED TOKENS (7): "council", "established", "home", "idaho", "making", "population", "rural".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
benefitscharitableestablishedorganizationspecifictrust
SHARED TOKENS (6): "benefits", "charitable", "established", "organization", "specific", "trust".
0.120
conventionaldentalestablishinvolvingproceduretherapy
SHARED TOKENS (6): "conventional", "dental", "establish", "involving", "procedure", "therapy".
0.120
datadentaldigitalmodelsoftwaresource
SHARED TOKENS (6): "data", "dental", "digital", "model", "software", "source".
0.120
agenciesmillionnetworknonprofitorganizationrevenue
SHARED TOKENS (6): "agencies", "million", "network", "nonprofit", "organization", "revenue".
0.100
boisehomeidahometropolitanpopulation
SHARED TOKENS (5): "boise", "home", "idaho", "metropolitan", "population".
0.100
commonlycreatedentalspaceunable
SHARED TOKENS (5): "commonly", "create", "dental", "space", "unable".
0.100
Special-use permit ↗ KW CROSS HIGH
applicabledistrictlanduseszoning
SHARED TOKENS (5): "applicable", "district", "land", "uses", "zoning".
0.100
Gingivitis ↗ Q673083 KW CROSS HIGH
aroundformformsresponsetreatment
SHARED TOKENS (5): "around", "form", "forms", "response", "treatment".
0.100
boisecommunityidahometropolitanpopulation
SHARED TOKENS (5): "boise", "community", "idaho", "metropolitan", "population".
◈ Frequently Asked Questions
Nonprofits Community × Dental — Treasure Valley
HAIKU · HIGH GATE
Which nonprofit organizations in Ada County provide dental services or oral health education?
Several Ada County nonprofits coordinate dental outreach through partnerships with Boise State University's public health programs and College of Western Idaho continuing education offerings. These organizations serve the Boise metropolitan population through clinics in Boise and Meridian that combine preventive dental care with mental health support services.
How do dental nonprofits in Canyon County connect with educational institutions?
Dental nonprofits operating in Nampa and Caldwell collaborate with College of Western Idaho on continuing education programs that train volunteers and staff in oral health delivery. Idaho State University also partners with Canyon County organizations to expand dental services within the Treasure Valley's growing population.
What role do Treasure Valley nonprofits play in addressing dental access across Ada and Canyon counties?
Nonprofits in the Boise, Meridian, Nampa, and Caldwell areas work to close dental gaps by operating public clinics and connecting residents to university-based dental education programs. These organizations receive continuing education support from College of Western Idaho and coordinate regional coverage across both Ada and Canyon counties.
How do mental health and dental nonprofits coordinate services in the Treasure Valley?
Mental health nonprofits in Boise and Ada County recognize that oral health significantly impacts overall wellness and refer clients to dental partners within the nonprofit community. College of Western Idaho's public health continuing education programs teach integrated care approaches that Treasure Valley nonprofits apply across Nampa, Caldwell, and surrounding areas.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Nonprofits Community × Dental 13 QID bridges 265 edges 7,197 ext links 2026-07-17 22:26:17 UTC 8b0cc5c138f5d226
Nonprofits Community corridor ↗ Dental corridor ↗ Dental × Nonprofits Community ↗ boisestandard.org/standard ↗
Parent Corridors
Nonprofits Community × All Other Verticals