—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Procurement Public Spending

17 Wikipedia bridge articles confirmed in both vertical ledgers. 298 deterministic cross-vertical edges. 8,557 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
298 Cross Edges
8,557 External Sources
358 Wikipedia Articles
17 🌲 Evergreen
141 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Procurement Public Spending
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
298
External Sources Harvested
8,557
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (17)
IdahoContractBoise State UniversityIdaho LegislatureTreasure ValleyTortAdministrative lawMergers and acquisitionsNampa, IdahoPrivate equityBoise, IdahoAda County, IdahoGarden City, IdahoMeridian, IdahoCanyon County, IdahoCaldwell, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadawestbusinesslegalgovernmentlargestseparatewesterncivilcollegepubliccanyonhomeagriculturallandnationalproducts
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:49:19 UTC
Content Hash
eaec9413240150e1
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in legal (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (15): "agricultural", "agriculture", "associated", "best", "boise", "idaho", "land", "largest", "national", "population", "products", "separate", "technology", "west", "western". | EXACT TITLE in legal: "Idaho". | EXACT TITLE in procurement_public_spending: "Idaho".
agriculturalagricultureassociatedbestboiseidaholandlargestnationalpopulationproductsseparatetechnologywestwestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
C
Q93288 EXACT TITLE 1.000
QID OVERLAP: Q93288 in legal (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (16): "adoption", "agreements", "business", "civil", "code", "commercial", "framework", "general", "governed", "independent", "judicial", "legal", "litigation", "national", "obligations", "rights". | EXACT TITLE in legal: "Contract". | EXACT TITLE in procurement_public_spending: "Contract".
adoptionagreementsbusinesscivilcodecommercialframeworkgeneralgovernedindependentjudiciallegallitigationnationalobligationsrights
een different types of contracts, and Roman-Dutch law is largely based on the writings of renaissance-era Dutch jurists and case law applying general principles of Roman law prior to the Netherlands' adoption of the Napoleonic Code. The UNIDROIT Principles of International Commercial Contracts, published in 2016, aim to provide a general harmonised framework for international contracts, independent of the divergences between national laws, as well as a statement of common contractual principles for arbitrators and judges to apply where national laws are lacking. Notably, the Principles reject the doctrine of consideration, arguing that elimination of the doctrine "bring[s] about greater certainty and reduce litigation" in international trade. The Principles also rejected the abstraction principle on the grounds that it and similar doctrines are "not easily compatible with modern business perceptions and practice". Contract law can be contrasted with tort law (also referred to in some jurisdictions as the law of delicts), the other major area of the law of obligations. While tort law generally deals with private duties and obligations that exist by operation of law, and provide remedies for civil wrongs committed between individuals not in a pre-existing legal relationship, contract law provides for the creation and enforcement of duties and obligations through a prior agreement between parties.
or rescission. A binding agreement between actors in international law is known as a treaty. Contract law, the field of the law of obligations concerned with contracts, is based on the principle that agreements must be honoured. Like other areas of private law, contract law varies between jurisdictions. In general, contract law is exercised and governed either under common law jurisdictions, civil law jurisdictions, or mixed-law jurisdictions that combine elements of both common and civil law. Common law jurisdictions typically require contracts to include consideration in order to be valid, whereas civil and most mixed-law jurisdictions solely require a meeting of the minds between the parties. Within the overarching category of civil law jurisdictions, there are several distinct varieties of contract law with their own distinct criteria: the German tradition is characterised by the unique doctrine of abstraction, systems based on the Napoleonic Code are characterised by their systematic distinction between different types of contracts, and Roman-Dutch law is largely based on the writings of renaissance-era Dutch jurists and case law applying general principles of Roman law prior to the Netherlands' adoption of the Napoleonic Code. The UNIDROIT Principles of International Commercial Contracts, published in 2016, aim to provide a general harmonised framework for international contracts, independent of the divergences between national laws, as well as a statement of common contractual principles for arbitrators and judges to apply where national laws are lacking. Notably, the Principles reject the doctrine of consideration, arguing that elimination of the doctrine "bring[s] about greater certainty and reduce litigation" in international trade. The Principles also rejected the abstraction principle on the grounds that it and similar doctrines are "not easily compatible with modern business perceptions and practice". Contract law can be contrasted with tort law (also referred to in some jurisdictions as the law of delicts), the other major area of the law of obligations. While tort law generally deals with private duties and obligations that exist by operation of law, and provide remedies for civil wrongs committed between individuals not in a pre-existing legal relationship, contract law provides for the creation and enforcement of duties and obligations through a prior agreement between parties.
A contract is often evidenced in writing or by deed. The general rule is that a person who signs a contractual document will be bound by the terms in that document. This rule is referred to as the rule in L'Estrange v Graucob or the "signature rule". This rule was approved by the High Court of Australia in Toll (FGCT) Pty Ltd v Alphapharm Pty Ltd. The rule typically binds a signatory to a contract regardless of whether they have actually read it, provided the document is contractual in nature. However, defences such as duress or unconscionability may enable the signer to avoid the obligation. Further, reasonable notice of a contract's terms must be given to the other party prior to their entry into the contract. Written contracts have typically been preferred in common law legal systems. In 1677 England passed the Statute of Frauds which influenced similar statute of frauds laws in the United States and other countries such as Australia. In general, the Uniform Commercial Code as adopted in the United States requires a written contract for tangible product sales in excess of $500, and for real estate contracts to be written. If the contract is not required by law to be written, an oral contract is generally valid and legally binding. The United Kingdom has since replaced the original Statute of Frauds, but written contracts are still required for various circumstances such as land (through the Law of Property Act 1925). Apart from using a written document, a valid contract may generally be made orally or even by conduct. An oral contract may also be called a parol contract or a verbal contract, with "verbal" meaning "spoken" rather than "in words", an established usage in British English with regards to contracts and agreements, and common although somewhat deprecated as "loose" in American English. An unwritten, unspoken contract, also known as "a contract implied by the acts of the parties", which can be legally implied either from the facts or as required in law. Implied-in-fact contracts are real contracts under which parties receive the "benefit of the bargain".
Boise State University
EXACT TITLE 0.960
QID OVERLAP: Q891082 in legal (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (13): "among", "boise", "business", "college", "education", "idaho", "independent", "program", "public", "school", "total", "university", "west". | EXACT TITLE in procurement_public_spending: "Boise State University".
amongboisebusinesscollegeeducationidahoindependentprogrampublicschooltotaluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho Legislature
Q4256974 EXACT TITLE 0.920
QID OVERLAP: Q4256974 in legal (tier:evergreen) and procurement_public_spending (tier:branch). | SHARED TOKENS (11): "boise", "data", "district", "districts", "government", "idaho", "lower", "population", "representing", "residents", "single". | EXACT TITLE in legal: "Idaho Legislature".
boisedatadistrictdistrictsgovernmentidaholowerpopulationrepresentingresidentssingle
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in legal (tier:evergreen) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (11): "agricultural", "association", "boise", "idaho", "land", "local", "lower", "resources", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in procurement_public_spending: "Treasure Valley".
agriculturalassociationboiseidaholandlocallowerresourcestreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
T
Q158970 EXACT TITLE 0.860
QID OVERLAP: Q158970 in legal (tier:berry) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (8): "civil", "code", "established", "legal", "liability", "obligations", "resulting", "separate". | EXACT TITLE in procurement_public_spending: "Tort".
civilcodeestablishedlegalliabilityobligationsresultingseparate
A tort is a civil wrong, other than breach of contract, that causes a claimant to suffer loss or harm, resulting in legal liability for the person who commits the tortious act. Tort law can be contrasted with criminal law, which deals with criminal wrongs that are punishable by the state. While criminal law aims to punish individuals who commit crimes, tort law aims to compensate individuals who suffer harm as a result of the actions of others. Some wrongful acts, such as assault and battery, can result in both a civil lawsuit and a criminal prosecution in countries where the civil and criminal legal systems are separate. Tort law may also be contrasted with contract law, which provides civil remedies after breach of a duty that arises from a contract. Obligations in both tort and criminal law are more fundamental and are imposed regardless of whether the parties have a contract. While tort law in civil law jurisdictions largely derives from Roman law, common law jurisdictions derive their tort law from customary English tort law. In civil law jurisdictions based on civil codes, both contractual and tortious or delictual liability is typically outlined in a civil code based on Roman Law principles. Tort law is referred to as the law of delict in Scots and Roman Dutch law, and resembles tort law in common law jurisdictions in that rules regarding civil liability are established primarily by precedent and theory rather than an exhaustive code. However, like other civil law jurisdictions, the underlying principles are drawn from Roman law. A handful of jurisdictions have codified a mixture of common and civil law jurisprudence either due to their colonial past (e.g. Québec, St Lucia, Mauritius) or due to influence from multiple legal traditions when their civil codes were drafted (e.g. Mainland China, the Philippines, and Thailand).
nish individuals who commit crimes, tort law aims to compensate individuals who suffer harm as a result of the actions of others. Some wrongful acts, such as assault and battery, can result in both a civil lawsuit and a criminal prosecution in countries where the civil and criminal legal systems are separate. Tort law may also be contrasted with contract law, which provides civil remedies after breach of a duty that arises from a contract. Obligations in both tort and criminal law are more fundamental and are imposed regardless of whether the parties have a contract. While tort law in civil law jurisdictions largely derives from Roman law, common law jurisdictions derive their tort law from customary English tort law. In civil law jurisdictions based on civil codes, both contractual and tortious or delictual liability is typically outlined in a civil code based on Roman Law principles. Tort law is referred to as the law of delict in Scots and Roman Dutch law, and resembles tort law in common law jurisdictions in that rules regarding civil liability are established primarily by precedent and theory rather than an exhaustive code. However, like other civil law jurisdictions, the underlying principles are drawn from Roman law. A handful of jurisdictions have codified a mixture of common and civil law jurisprudence either due to their colonial past (e.g. Québec, St Lucia, Mauritius) or due to influence from multiple legal traditions when their civil codes were drafted (e.g. Mainland China, the Philippines, and Thailand).
, can result in both a civil lawsuit and a criminal prosecution in countries where the civil and criminal legal systems are separate. Tort law may also be contrasted with contract law, which provides civil remedies after breach of a duty that arises from a contract. Obligations in both tort and criminal law are more fundamental and are imposed regardless of whether the parties have a contract. While tort law in civil law jurisdictions largely derives from Roman law, common law jurisdictions derive their tort law from customary English tort law. In civil law jurisdictions based on civil codes, both contractual and tortious or delictual liability is typically outlined in a civil code based on Roman Law principles. Tort law is referred to as the law of delict in Scots and Roman Dutch law, and resembles tort law in common law jurisdictions in that rules regarding civil liability are established primarily by precedent and theory rather than an exhaustive code. However, like other civil law jurisdictions, the underlying principles are drawn from Roman law. A handful of jurisdictions have codified a mixture of common and civil law jurisprudence either due to their colonial past (e.g. Québec, St Lucia, Mauritius) or due to influence from multiple legal traditions when their civil codes were drafted (e.g. Mainland China, the Philippines, and Thailand).
Administrative law
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (20): "administrative", "agencies", "bodies", "changes", "civil", "courts", "created", "education", "environment", "environmental", "expanded", "government", "itself", "judicial", "legal", "orders", "public", "review", "strong", "system".
administrativeagenciesbodieschangescivilcourtscreatededucationenvironmentenvironmentalexpandedgovernmentitselfjudiciallegalorderspublicreviewstrongsystem
Administrative law is a division of law governing the activities of executive branch agencies of government. Administrative law includes executive branch rulemaking (executive branch rules are generally referred to as "regulations"), adjudication, and the enforcement of laws.
g of administrative units of government that are part of the executive branch in such areas as international trade, manufacturing, the environment, taxation, broadcasting, immigration, and transport. Administrative law expanded greatly during the 20th century, as legislative bodies worldwide created more government agencies to regulate the social, economic and political spheres of human interaction. Civil law countries often have specialized administrative courts that review these decisions.
20th century, as legislative bodies worldwide created more government agencies to regulate the social, economic and political spheres of human interaction. Civil law countries often have specialized administrative courts that review these decisions. In the last fifty years, administrative law, in many countries of the civil law tradition, has opened itself to the influence of rules posed by supranational legal orders, in which judicial principles have strong importance: it has led, for one, to changes in some traditional concepts of the administrative law model, as has happened with the public procurements or with judicial control of administrative activity and, for another, has built a supranational or international public administration, as in the environmental sector or with reference to education, for which, within the United Nations' system, it has been possible to assist to a further increase of administrative structure devoted to coordinate the States' activity in that sector.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (19): "assets", "business", "combined", "competitive", "department", "entity", "federal", "governed", "government", "legal", "market", "operating", "operations", "requires", "review", "single", "strategic", "transaction", "transactions".
assetsbusinesscombinedcompetitivedepartmententityfederalgovernedgovernmentlegalmarketoperatingoperationsrequiresreviewsinglestrategictransactiontransactions
l terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Acquisition An acquisition/takeover is the purchase of one business or company by another company or other business entity. Specific acquisition targets can be identified through myriad avenues, including market research, trade expos, sent up from internal business units, or supply chain analysis. Such purchase may be of 100%, or nearly 100%, of the assets or ownership equity of the acquired entity. A consolidation/amalgamation occurs when two companies combine to form a new enterprise altogether, and neither of the previous companies remains independently owned. Acquisitions are divided into "private" and "public" acquisitions, depending on whether the acquiree or merging company (also termed a target) is or is not publicly listed. Some public companies rely on acquisitions as an important value creation strategy. An additional dimension or categorization consists of whether an acquisition is friendly or hostile. Achieving acquisition success has proven to be very difficult, while various studies have shown that 50% of acquisitions were unsuccessful. "Serial acquirers" appear to be more successful with M&A than companies who make acquisitions only occasionally (see Douma & Schreuder, 2013, chapter 13). The new forms of buy out created since the 2008 financial crisis are based on serial type acquisitions known as an ECO Buyout which is a co-community ownership buy out and the new generation buy outs of the MIBO (Management Involved or Management & Institution Buy Out) and MEIBO (Management & Employee Involved Buy Out). Whether a purchase is perceived as being "friendly" or "hostile" depends significantly on how the proposed acquisition is communicated to and perceived by the target company's board of directors, employees, and shareholders. It is normal for M&A deal communications to take place in a so-called "confidentiality bubble", wherein the flow of information is restricted pursuant to confidentiality agreements. In the case of a friendly transaction, the companies cooperate in negotiations; in the case of a hostile deal, the board and/or management of the target is unwilling to be bought or the target's board has no prior knowledge of the offer. Hostile acquisitions can, and often do, ultimately become "friendly" as the acquirer secures endorsement of the transaction from the board of the acquiree company. This usually requires an improvement in the terms of the offer and/or through negotiation. "Acquisition" usually refers to a purchase of a smaller firm by a larger one. Sometimes, however, a smaller firm will acquire management control of a larger and/or longer-established company and retain the name of the latter for the post-acquisition combined entity. This is known as a reverse takeover. Another type of acquisition is the reverse merger, a form of transaction that enables a private company to be publicly listed in a relatively short time frame. A reverse merger is a type of merger where a privately held company, typically one with promising prospects and a need for financing, acquires a publicly listed shell company that has few assets and no significant business operations. The combined evidence suggests that the shareholders of acquired firms realize significant positive "abnormal returns," while shareholders of the acquiring company are most likely to experience a negative wealth effect. Most studies indicate that M&A transactions have a positive net effect, with investors in both the buyer and target companies seeing positive returns. This suggests that M&A creates economic value, likely by transferring assets to more efficient management teams who can better utilize them.
The buyer buys the shares, and therefore control, of the target company being purchased. Ownership control of the company in turn conveys effective control over the assets of the company, but since the company is acquired intact as a going concern, this form of transaction carries with it all of the liabilities accrued by that business over its past and all of the risks that company faces in its commercial environment and corporate environment The buyer buys the assets of the target company. The cash the target receives from the sell-off is paid back to its shareholders by dividend or through liquidation. This type of transaction leaves the target company as an empty shell, if the buyer buys out the entire assets. A buyer often structures the transaction as an asset purchase to "cherry-pick" the assets that it wants and leave out the assets and liabilities that it does not. This can be particularly important where foreseeable liabilities may include future, unquantified damage awards such as those that could arise from litigation over defective products, employee benefits or terminations, or environmental damage. A disadvantage of this structure is the tax that many jurisdictions, particularly outside the United States, impose on transfers of the individual assets, whereas stock transactions can frequently be structured as like-kind exchanges or other arrangements that are tax-free or tax-neutral, both to the buyer and to the seller's shareholders. The terms "demerger", "spin-off" and "spin-out" are sometimes used to indicate a situation where one company splits into two, generating a second company which may or may not become separately listed on a stock exchange. As per knowledge-based views, firms can generate greater values through the retention of knowledge-based resources which they generate and integrate. Extracting technological benefits during and after acquisition is an ever-challenging issue because of organizational differences.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "population", "principal", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannampapopulationprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
P
Q476115 QID OVERLAP 0.720
QID OVERLAP: Q476115 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (11): "active", "business", "changes", "development", "finance", "financial", "firms", "general", "press", "products", "public".
activebusinesschangesdevelopmentfinancefinancialfirmsgeneralpressproductspublic
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Boise, Idaho
Q35775 QID OVERLAP 0.700
QID OVERLAP: Q35775 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (10): "ada", "annual", "boise", "counties", "home", "idaho", "population", "technology", "treasure", "valley".
adaannualboisecountieshomeidahopopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in legal (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "district", "home", "idaho", "jurisdiction", "largest", "local", "population".
adaboisedistricthomeidahojurisdictionlargestlocalpopulation
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.660
QID OVERLAP: Q1516892 in legal (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (8): "ada", "boise", "government", "idaho", "municipal", "nearly", "population", "separate".
adaboisegovernmentidahomunicipalnearlypopulationseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "cities", "idaho", "meridian", "population".
adaamongboisecitiesidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in legal (tier:branch) and procurement_public_spending (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in legal (tier:branch) and procurement_public_spending (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
281 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP281 edges
🌿 BRANCH141 edges
0.500
Corporation ↗ Q167037 EXACT TITLE
businesscorporationentityestablishedjointjurisdictionlegalliabilitylocalobligationsofficeofficerownerspublicrecognizedregistrationsingleworkers
SHARED TOKENS (18): "business", "corporation", "entity", "established", "joint", "jurisdiction", "legal", "liability", "local", "obligations", "office", "officer", "owners", "public", "recognized", "registration", "single", "workers". | EXACT TITLE in legal: "Corporation". | EXACT TITLE in procurement_public_spending: "Corporation".
0.500
Architect ↗ Q42973 EXACT TITLE
architecturechiefconstructiondevelopmenteducationexperienceinstitutionsjurisdictionlicenseplansprincipalprofessionalpublicsafetytraining
SHARED TOKENS (15): "architecture", "chief", "construction", "development", "education", "experience", "institutions", "jurisdiction", "license", "plans", "principal", "professional", "public", "safety", "training". | EXACT TITLE in legal: "Architect". | EXACT TITLE in procurement_public_spending: "Architect".
0.500
accessagenciescreateddevelopmentenvironmentenvironmentalfirmsgeneralindustrialinstitutionsmaintainphysicalpublicservingstandardssupplywater
SHARED TOKENS (17): "access", "agencies", "created", "development", "environment", "environmental", "firms", "general", "industrial", "institutions", "maintain", "physical", "public", "serving", "standards", "supply", "water". | EXACT TITLE in procurement_public_spending: "Infrastructure".
0.500
amongcasesestablishedexperiencefinancialformshomeofficepartnerpartnersphysicalpowerrelationshipsresourcestechnology
SHARED TOKENS (15): "among", "cases", "established", "experience", "financial", "forms", "home", "office", "partner", "partners", "physical", "power", "relationships", "resources", "technology". | EXACT TITLE in legal: "Domestic violence".
0.500
assetscarryconstructionemploymentenvironmentalgovernmentmunicipalphysicalpreservationprojectspublicsafetysupplywaterworks
SHARED TOKENS (15): "assets", "carry", "construction", "employment", "environmental", "government", "municipal", "physical", "preservation", "projects", "public", "safety", "supply", "water", "works". | EXACT TITLE in procurement_public_spending: "Public works".
0.500
analysisarchitectureassociatedcompleteenvironmentgeneralgenerategrowthhistoryknowledgeoperationsplanningprocessingreachrepresentationsafetysupport
SHARED TOKENS (17): "analysis", "architecture", "associated", "complete", "environment", "general", "generate", "growth", "history", "knowledge", "operations", "planning", "processing", "reach", "representation", "safety", "support". | EXACT TITLE in procurement_public_spending: "Artificial intelligence".
0.500
bestcasesclaimslandlegalpossessionpropertypublicregistrationrepresentingrequiredrightsservesstatutestitle
SHARED TOKENS (15): "best", "cases", "claims", "land", "legal", "possession", "property", "public", "registration", "representing", "required", "rights", "serves", "statutes", "title". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in procurement_public_spending: "Title (property)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilconstructiondevelopmentenvironmentformsgovernmenthistorylandlegalplanningprofessionalpropertyrequiredstructuraltotalwork
SHARED TOKENS (17): "analysis", "civil", "construction", "development", "environment", "forms", "government", "history", "land", "legal", "planning", "professional", "property", "required", "structural", "total", "work". | EXACT TITLE in procurement_public_spending: "Surveying".
0.500
approvalsbusinesscreateddatadepartmentfinanciallegalliabilityordersprocessingreceivedrequiredreviewsupplysystemtransactions
SHARED TOKENS (16): "approvals", "business", "created", "data", "department", "financial", "legal", "liability", "orders", "processing", "received", "required", "review", "supply", "system", "transactions". | EXACT TITLE in procurement_public_spending: "Accounts payable".
0.500
authoritycannotcasescivilcourtsdeterminesestablishedfinalissuesitselfjurisdictionlegallowerpowerreviewsystem
SHARED TOKENS (16): "authority", "cannot", "cases", "civil", "courts", "determines", "established", "final", "issues", "itself", "jurisdiction", "legal", "lower", "power", "review", "system". | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebeyonddefensedepartmentemploymentfeegrowthknowledgelowerphysicalpresenceprogramprojectsrequiredrequiressectionsecurityspecialtytotal
SHARED TOKENS (22): "additional", "agriculture", "beyond", "defense", "department", "employment", "fee", "growth", "knowledge", "lower", "physical", "presence", "program", "projects", "required", "requires", "section", "security", "specialty", "total".... | EXACT TITLE in legal: "H-1B visa".
0.500
amongchiefdatadevelopmentfinancefinancialindustrialinstitutionsinsurancelargelegalmarketsnationalofficerplansprofessionalprogramprojectpublicsafety
SHARED TOKENS (25): "among", "chief", "data", "development", "finance", "financial", "industrial", "institutions", "insurance", "large", "legal", "markets", "national", "officer", "plans", "professional", "program", "project", "public", "safety".... | EXACT TITLE in procurement_public_spending: "Risk management".
0.500
administrativeagenciesassetsbodiesbusinesschiefdatadepartmentsfederalfinancialgovernancegovernmentindependentlocalofficeroperationsorganizationsprofessionalprofessionalsrecognized
SHARED TOKENS (26): "administrative", "agencies", "assets", "bodies", "business", "chief", "data", "departments", "federal", "financial", "governance", "government", "independent", "local", "officer", "operations", "organizations", "professional", "professionals", "recognized".... | EXACT TITLE in procurement_public_spending: "Internal audit".
0.500
americanannualassociationbarboisebusinessclasscollegeeducationemploymentenvironmentalestablishedidahonewsplansprogrampropertypublicreportresources
SHARED TOKENS (23): "american", "annual", "association", "bar", "boise", "business", "class", "college", "education", "employment", "environmental", "established", "idaho", "news", "plans", "program", "property", "public", "report", "resources".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
Accounting ↗ Q4116214 EXACT TITLE
analysisbodiesbusinesscouncilfinancialfirmsformshistoryoperationsorganizationsplansprocessingprofessionalreportsstandardssupportsystemtransactions
SHARED TOKENS (18): "analysis", "bodies", "business", "council", "financial", "firms", "forms", "history", "operations", "organizations", "plans", "processing", "professional", "reports", "standards", "support", "system", "transactions". | EXACT TITLE in procurement_public_spending: "Accounting".
0.500
Airport ↗ Q1248784 EXACT TITLE
activecommercialcomplexenvironmentalexperiencegenerallandlargelocalmaintainoperationssafetyservingsourcessupportsystemtraffic
SHARED TOKENS (17): "active", "commercial", "complex", "environmental", "experience", "general", "land", "large", "local", "maintain", "operations", "safety", "serving", "sources", "support", "system", "traffic". | EXACT TITLE in procurement_public_spending: "Airport".
0.500
Mediation ↗ Q223871 EXACT TITLE
agreementsamongassistanceauthoritycivilcommercialdifferencesformformsindependentissueslegallicensingneedsprofessionalreachtraining
SHARED TOKENS (17): "agreements", "among", "assistance", "authority", "civil", "commercial", "differences", "form", "forms", "independent", "issues", "legal", "licensing", "needs", "professional", "reach", "training". | EXACT TITLE in legal: "Mediation".
0.500
amongcompensationcreatedemployeesemploymentensureformgeneralinsuranceliabilitymandatorymedicaloutsidepaymentplanssecuritysystemwageworkers
SHARED TOKENS (19): "among", "compensation", "created", "employees", "employment", "ensure", "form", "general", "insurance", "liability", "mandatory", "medical", "outside", "payment", "plans", "security", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
accessassociationcompetitivedevelopmentfinancialformsgeneralgovernmentlocalmunicipalnetworkoperatingoperationsplanningpublicregionalrequiredserves
SHARED TOKENS (18): "access", "association", "competitive", "development", "financial", "forms", "general", "government", "local", "municipal", "network", "operating", "operations", "planning", "public", "regional", "required", "serves". | EXACT TITLE in procurement_public_spending: "Public transport".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyoncommercialconstructioncreatedhistoryidaholargelargestlowernationalprojectspublicrunssectionvalleywestwestern
SHARED TOKENS (19): "agencies", "american", "canyon", "commercial", "construction", "created", "history", "idaho", "large", "largest", "lower", "national", "projects", "public", "runs", "section", "valley", "west", "western". | EXACT TITLE in legal: "Snake River".
0.500
agenciesagreementscompensationdevelopmentenvironmentenvironmentalgrowthissuesjudicialjurisdictionkeylegalnationalnationallyneedsorganizationspreservationresourceresourcesrights
SHARED TOKENS (22): "agencies", "agreements", "compensation", "development", "environment", "environmental", "growth", "issues", "judicial", "jurisdiction", "key", "legal", "national", "nationally", "needs", "organizations", "preservation", "resource", "resources", "rights".... | EXACT TITLE in legal: "Environmental law".
0.500
adoptionappliesassetsbusinesscivilcodecommercialdistrictemploymentfinancefinancialfoodframeworkgeneralgoverninsuranceissuesjurisdictionlegalmarkets
SHARED TOKENS (32): "adoption", "applies", "assets", "business", "civil", "code", "commercial", "district", "employment", "finance", "financial", "food", "framework", "general", "govern", "insurance", "issues", "jurisdiction", "legal", "markets".... | EXACT TITLE in legal: "Commercial law".
0.500
annualassetsbusinesscorporationemployeesgovernmenthomelargelicensemedicalnetoperationsorganizationsprofessionalsservingsupportwork
SHARED TOKENS (17): "annual", "assets", "business", "corporation", "employees", "government", "home", "large", "license", "medical", "net", "operations", "organizations", "professionals", "serving", "support", "work". | EXACT TITLE in procurement_public_spending: "Small business".
0.500
compensationdevelopmentexpandedfeefinalgovernmentlandlegalownerspaymentpowerpropertypublictitletotal
SHARED TOKENS (15): "compensation", "development", "expanded", "fee", "final", "government", "land", "legal", "owners", "payment", "power", "property", "public", "title", "total". | EXACT TITLE in legal: "Eminent domain".
0.500
adaboisecanyoncollegecountiesdevelopmenteducationgovernedidaholargenampapopulationpublicresidentssouthwesttreasurevalleywestern
SHARED TOKENS (18): "ada", "boise", "canyon", "college", "counties", "development", "education", "governed", "idaho", "large", "nampa", "population", "public", "residents", "southwest", "treasure", "valley", "western". | EXACT TITLE in procurement_public_spending: "College of Western Idaho".
0.500
casescivilcouncilcreateddevelopmentfinancialjointjurisdictionmaintenanceneedsobligationspaymentrecognizedrequiredrequiresreviewrightssinglesupport
SHARED TOKENS (19): "cases", "civil", "council", "created", "development", "financial", "joint", "jurisdiction", "maintenance", "needs", "obligations", "payment", "recognized", "required", "requires", "review", "rights", "single", "support". | EXACT TITLE in legal: "Child support".
0.480
Arbitration ↗ Q207946 EXACT TITLE
alternativeclasscommercialcourtsemploymententityformjudiciallocalmandatorymattersreviewrightstransactions
SHARED TOKENS (14): "alternative", "class", "commercial", "courts", "employment", "entity", "form", "judicial", "local", "mandatory", "matters", "review", "rights", "transactions". | EXACT TITLE in legal: "Arbitration".
0.480
attorneysbarcompletecontinuingdevelopmentdistricteducationlegallicensesmaintainmandatoryoutsideprofessionalrequired
SHARED TOKENS (14): "attorneys", "bar", "complete", "continuing", "development", "district", "education", "legal", "licenses", "maintain", "mandatory", "outside", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.480
Trust (law) ↗ Q854022 EXACT TITLE
assetsbusinesscreatedentityestablishedfederalgovernedjurisdictionlegalownerspropertypublicrequiressingle
SHARED TOKENS (14): "assets", "business", "created", "entity", "established", "federal", "governed", "jurisdiction", "legal", "owners", "property", "public", "requires", "single". | EXACT TITLE in legal: "Trust (law)".
0.480
businesscommercialcorporationemployeesenvironmentfinancialgovernancegovernslegalmarketmattersorganizationsrightssystem
SHARED TOKENS (14): "business", "commercial", "corporation", "employees", "environment", "financial", "governance", "governs", "legal", "market", "matters", "organizations", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.480
additionalcalendarcorporationdefenseeducationentityfeesfinancialgovernmenthealthcareinstitutionsitselfprogramrequires
SHARED TOKENS (14): "additional", "calendar", "corporation", "defense", "education", "entity", "fees", "financial", "government", "healthcare", "institutions", "itself", "program", "requires". | EXACT TITLE in procurement_public_spending: "Government budget".
0.480
adaboisecombinedcommercialdepartmentgeneralidahojointnationalofficeroperatesrightssupportwestern
SHARED TOKENS (14): "ada", "boise", "combined", "commercial", "department", "general", "idaho", "joint", "national", "officer", "operates", "rights", "support", "western". | EXACT TITLE in procurement_public_spending: "Boise Airport".
0.460
alongsideanalysisappliesbusinesscommercialconstructionfirmsknowledgeplanningprofessionalprojectprojectsquality
SHARED TOKENS (13): "alongside", "analysis", "applies", "business", "commercial", "construction", "firms", "knowledge", "planning", "professional", "project", "projects", "quality". | EXACT TITLE in procurement_public_spending: "Construction management".
0.460
civilenvironmentalgovernsissuesjurisdictionlandlegalpersonalpropertypublicrelationshipsrightsseparate
SHARED TOKENS (13): "civil", "environmental", "governs", "issues", "jurisdiction", "land", "legal", "personal", "property", "public", "relationships", "rights", "separate". | EXACT TITLE in legal: "Property law".
0.460
Complaint ↗ Q836925 EXACT TITLE
associatedauthoritycasescivilcourtsdefensefederalgovernlegallitigationpowerstatutessupport
SHARED TOKENS (13): "associated", "authority", "cases", "civil", "courts", "defense", "federal", "govern", "legal", "litigation", "power", "statutes", "support". | EXACT TITLE in procurement_public_spending: "Complaint".
0.460
authoritybestconstructiongovernmentgroupgrowthkeylocalorganizationspublicqualitysupplyworks
SHARED TOKENS (13): "authority", "best", "construction", "government", "group", "growth", "key", "local", "organizations", "public", "quality", "supply", "works". | EXACT TITLE in procurement_public_spending: "Government procurement".
0.460
assistancecannotcasescounselestablishedfederalfreegovernmentlegalofficepublicrepresentationrequires
SHARED TOKENS (13): "assistance", "cannot", "cases", "counsel", "established", "federal", "free", "government", "legal", "office", "public", "representation", "requires". | EXACT TITLE in legal: "Public defender".
0.460
accessagenciesalternativebeyondcasescitiesformgovernmentlocaloperatesorganizationspublicserving
SHARED TOKENS (13): "access", "agencies", "alternative", "beyond", "cases", "cities", "form", "government", "local", "operates", "organizations", "public", "serving". | EXACT TITLE in procurement_public_spending: "Paratransit".
0.440
Divorce ↗ Q93190 EXACT TITLE
accessauthoritycivildebtdistributionissueslegalpartnerpropertyrequiredrequiressupport
SHARED TOKENS (12): "access", "authority", "civil", "debt", "distribution", "issues", "legal", "partner", "property", "required", "requires", "support". | EXACT TITLE in legal: "Divorce".
0.440
americanconstructioncontractordevelopersgenerallaborlargelicensingprojectprojectsresponsiblework
SHARED TOKENS (12): "american", "construction", "contractor", "developers", "general", "labor", "large", "licensing", "project", "projects", "responsible", "work". | EXACT TITLE in legal: "General contractor". | EXACT TITLE in procurement_public_spending: "General contractor".
0.440
Lawyer ↗ Q40348 EXACT TITLE
bareducationjurisdictionknowledgelegalmattersprofessionalrequiredrightssystemtrainingwork
SHARED TOKENS (12): "bar", "education", "jurisdiction", "knowledge", "legal", "matters", "professional", "required", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.440
Zoning ↗ Q702232 EXACT TITLE
developmentformgoverngovernmentgrowthindustriallandland-uselocalplanningpropertysingle
SHARED TOKENS (12): "development", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "planning", "property", "single". | EXACT TITLE in legal: "Zoning".
0.440
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilcourtsentityestablishedgovernmentjudicialjurisdictionlegalmatterspower
SHARED TOKENS (12): "administrative", "authority", "civil", "courts", "entity", "established", "government", "judicial", "jurisdiction", "legal", "matters", "power". | EXACT TITLE in legal: "Court". | EXACT TITLE in procurement_public_spending: "Court".
0.440
Logistics ↗ Q177777 EXACT TITLE
civilfoodmaterialneedsphysicalplanningproductsprofessionalpublicresourceresourcessupply
SHARED TOKENS (12): "civil", "food", "material", "needs", "physical", "planning", "products", "professional", "public", "resource", "resources", "supply". | EXACT TITLE in procurement_public_spending: "Logistics".
0.440
Real estate ↗ Q684740 EXACT TITLE
businesscommercialentitygeneralgovernmentlandlegalpersonalpropertypublicresourceswater
SHARED TOKENS (12): "business", "commercial", "entity", "general", "government", "land", "legal", "personal", "property", "public", "resources", "water". | EXACT TITLE in legal: "Real estate".
0.440
authoritycasesconstitutionalcontestedfederalgovernmentlandpopulationpowerrightsstatutesstatutory
SHARED TOKENS (12): "authority", "cases", "constitutional", "contested", "federal", "government", "land", "population", "power", "rights", "statutes", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.430
boisecreatedidahooperations
SHARED TOKENS (4): "boise", "created", "idaho", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.420
amongdevelopmentfinancialgovernmentlegalnationalpropertyrightssystemtransactiontransactions
SHARED TOKENS (11): "among", "development", "financial", "government", "legal", "national", "property", "rights", "system", "transaction", "transactions". | EXACT TITLE in legal: "Real estate transaction".
0.420
Patent ↗ Q253623 EXACT TITLE
agreementsamongclaimsformsindustriallegalnationalpropertypublicrightstechnology
SHARED TOKENS (11): "agreements", "among", "claims", "forms", "industrial", "legal", "national", "property", "public", "rights", "technology". | EXACT TITLE in legal: "Patent".
0.420
Bridge ↗ Q12280 EXACT TITLE
complexconstructionenvironmentformsindustriallocalnetworkphysicalstrongsupporttraffic
SHARED TOKENS (11): "complex", "construction", "environment", "forms", "industrial", "local", "network", "physical", "strong", "support", "traffic". | EXACT TITLE in procurement_public_spending: "Bridge".
0.420
associatedcomplexdemandformsgovernmenthomelocalmarketsnationalrecognizedsupply
SHARED TOKENS (11): "associated", "complex", "demand", "forms", "government", "home", "local", "markets", "national", "recognized", "supply". | EXACT TITLE in procurement_public_spending: "Affordable housing".
0.420
Probate ↗ Q6500369 EXACT TITLE
assetsclaimscontestedcourtsjudicialjurisdictionlegalpersonalpowerpropertypublic
SHARED TOKENS (11): "assets", "claims", "contested", "courts", "judicial", "jurisdiction", "legal", "personal", "power", "property", "public". | EXACT TITLE in legal: "Probate".
0.420
adaboisecanyonidahooperatespublicregionalschoolservingtreasurevalley
SHARED TOKENS (11): "ada", "boise", "canyon", "idaho", "operates", "public", "regional", "school", "serving", "treasure", "valley". | EXACT TITLE in procurement_public_spending: "Valley Regional Transit".
0.420
americanemployeesensuregroupheadquarterednationaloperatingoperationsservingsouthwesttotal
SHARED TOKENS (11): "american", "employees", "ensure", "group", "headquartered", "national", "operating", "operations", "serving", "southwest", "total". | EXACT TITLE in procurement_public_spending: "Cox Enterprises".
0.410
chiefcourtsidaho
SHARED TOKENS (3): "chief", "courts", "idaho". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.400
commercialformformsitselfordersplanningproductsrequiredresourcesystem
SHARED TOKENS (10): "commercial", "form", "forms", "itself", "orders", "planning", "products", "required", "resource", "system". | EXACT TITLE in procurement_public_spending: "Purchase order".
0.400
businesscontractorgeneralitselflowerobligationsprojectpublicsubcontractorssupport
SHARED TOKENS (10): "business", "contractor", "general", "itself", "lower", "obligations", "project", "public", "subcontractors", "support". | EXACT TITLE in legal: "Subcontractor". | EXACT TITLE in procurement_public_spending: "Subcontractor".
0.400
Assault ↗ Q365680 EXACT TITLE
civilcombinedcontactlegalliabilityofficerphysicalseparatesinglesystem
SHARED TOKENS (10): "civil", "combined", "contact", "legal", "liability", "officer", "physical", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.400
americancasescivilconcentratedgeneraljudiciallegalreviewsinglesystem
SHARED TOKENS (10): "american", "cases", "civil", "concentrated", "general", "judicial", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.400
assetsauthoritycivilcommercialcreateddepartmentfederalgovernmentstandardstraffic
SHARED TOKENS (10): "assets", "authority", "civil", "commercial", "created", "department", "federal", "government", "standards", "traffic". | EXACT TITLE in procurement_public_spending: "Federal Aviation Administration".
0.400
civilconstructioneducationoperationsplanningprofessionalprojectprojectsqualityrequires
SHARED TOKENS (10): "civil", "construction", "education", "operations", "planning", "professional", "project", "projects", "quality", "requires". | EXACT TITLE in procurement_public_spending: "Construction engineering".
0.400
Highway ↗ Q269949 EXACT TITLE
accessamericancodecoversgovernmentlandlegalpublicrightssystem
SHARED TOKENS (10): "access", "american", "code", "covers", "government", "land", "legal", "public", "rights", "system". | EXACT TITLE in procurement_public_spending: "Highway".
0.380
americancasesentitylegalliabilitymedicalpersonalpropertyquality
SHARED TOKENS (9): "american", "cases", "entity", "legal", "liability", "medical", "personal", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.380
Inventory ↗ Q815410 EXACT TITLE
americanbusinessnetworkproductsprojectsrequiredsupplysystemwork
SHARED TOKENS (9): "american", "business", "network", "products", "projects", "required", "supply", "system", "work". | EXACT TITLE in procurement_public_spending: "Inventory".
0.380
Green card ↗ Q6676995 EXACT TITLE
amongcarrycasesfederalformgeneralregistrationresidentsworkers
SHARED TOKENS (9): "among", "carry", "cases", "federal", "form", "general", "registration", "residents", "workers". | EXACT TITLE in legal: "Green card".
0.380
Law firm ↗ Q613142 EXACT TITLE
assistancebusinesscasescivilentitylegalmattersrightstransactions
SHARED TOKENS (9): "assistance", "business", "cases", "civil", "entity", "legal", "matters", "rights", "transactions". | EXACT TITLE in legal: "Law firm".
0.380
Procurement ↗ Q829492 EXACT TITLE
bestbodiesbusinesscompetitiveensuregovernmentpublicqualityworks
SHARED TOKENS (9): "best", "bodies", "business", "competitive", "ensure", "government", "public", "quality", "works". | EXACT TITLE in procurement_public_spending: "Procurement".
0.380
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlegalprofessionalschoolsystemuniversity
SHARED TOKENS (9): "college", "department", "education", "jurisdiction", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.360
accessadoptionbestcontactjointlegalphysicalrights
SHARED TOKENS (8): "access", "adoption", "best", "contact", "joint", "legal", "physical", "rights". | EXACT TITLE in legal: "Child custody".
0.360
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivillegalobligationspropertyrightsstatutory
SHARED TOKENS (8): "among", "assets", "civil", "legal", "obligations", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.360
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmenthomeindustriallandlayermaterialwater
SHARED TOKENS (8): "beyond", "environment", "home", "industrial", "land", "layer", "material", "water". | EXACT TITLE in legal: "Aquifer".
0.360
associatedbeyonddatadevelopmentknowledgeprojectsrelationshipsrepresentation
SHARED TOKENS (8): "associated", "beyond", "data", "development", "knowledge", "projects", "relationships", "representation". | EXACT TITLE in procurement_public_spending: "Knowledge graph".
0.360
agreementscasescivilgovernlegalpropertyrightssupport
SHARED TOKENS (8): "agreements", "cases", "civil", "govern", "legal", "property", "rights", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.360
analysisarchitectureconstructionenvironmentallandlandscapeplanningquality
SHARED TOKENS (8): "analysis", "architecture", "construction", "environmental", "land", "landscape", "planning", "quality". | EXACT TITLE in procurement_public_spending: "Landscape architect".
0.360
constructionitselflabornamespersonalpropertysecuritytitle
SHARED TOKENS (8): "construction", "itself", "labor", "names", "personal", "property", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.360
civilcourtsfinaljurisdictionlegallowerreviewsingle
SHARED TOKENS (8): "civil", "courts", "final", "jurisdiction", "legal", "lower", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.360
achdadadistrictentityestablishedgovernmentidahoindependent
SHARED TOKENS (8): "achd", "ada", "district", "entity", "established", "government", "idaho", "independent". | EXACT TITLE in procurement_public_spending: "Ada County Highway District".
0.360
bestbusinesscomplexcontractorsfinalformneedsquality
SHARED TOKENS (8): "best", "business", "complex", "contractors", "final", "form", "needs", "quality". | EXACT TITLE in procurement_public_spending: "Request for proposal".
0.360
Creditor ↗ Q157165 EXACT TITLE
assetsdebtfinancialgeneralgovernmentpropertyrepresentssecurity
SHARED TOKENS (8): "assets", "debt", "financial", "general", "government", "property", "represents", "security". | EXACT TITLE in legal: "Creditor".
0.340
assetscomplexlegalneedsnetplanningproperty
SHARED TOKENS (7): "assets", "complex", "legal", "needs", "net", "planning", "property". | EXACT TITLE in legal: "Estate planning".
0.340
Immigration law ↗ EXACT TITLE
governmentlegalmaintainmattersnationalrightsstatutes
SHARED TOKENS (7): "government", "legal", "maintain", "matters", "national", "rights", "statutes". | EXACT TITLE in legal: "Immigration law".
0.340
Pro bono ↗ Q127537 EXACT TITLE
freelegalpaymentprofessionalprofessionalspublicwork
SHARED TOKENS (7): "free", "legal", "payment", "professional", "professionals", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.340
appropriationlandlegallowerpropertyrightsstrong
SHARED TOKENS (7): "appropriation", "land", "legal", "lower", "property", "rights", "strong". | EXACT TITLE in legal: "Intellectual property".
0.340
Jury ↗ Q837675 EXACT TITLE
bodiescivilgrouplegalprofessionalsinglesystem
SHARED TOKENS (7): "bodies", "civil", "group", "legal", "professional", "single", "system". | EXACT TITLE in legal: "Jury".
0.320
associateddataordersplanningresourcestrategic
SHARED TOKENS (6): "associated", "data", "orders", "planning", "resource", "strategic". | EXACT TITLE in procurement_public_spending: "E-procurement".
0.320
Adoption ↗ Q180472 EXACT TITLE
adoptiongovernedlegalrequiresrightsstatutes
SHARED TOKENS (6): "adoption", "governed", "legal", "requires", "rights", "statutes". | EXACT TITLE in legal: "Adoption". | EXACT TITLE in procurement_public_spending: "Adoption".
0.320
agriculturalenvironmentindustrialmunicipalresultingwater
SHARED TOKENS (6): "agricultural", "environment", "industrial", "municipal", "resulting", "water". | EXACT TITLE in procurement_public_spending: "Wastewater treatment".
0.320
agenciesgovernmentjurisdictionpublicrecordstransactions
SHARED TOKENS (6): "agencies", "government", "jurisdiction", "public", "records", "transactions". | EXACT TITLE in procurement_public_spending: "Public records".
0.320
cannotlegalmedicalprofessionalrecognizedstandards
SHARED TOKENS (6): "cannot", "legal", "medical", "professional", "recognized", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.320
Carahsoft ↗ Q5037630 EXACT TITLE
americanfederalheadquarteredinstitutionslocaltechnology
SHARED TOKENS (6): "american", "federal", "headquartered", "institutions", "local", "technology". | EXACT TITLE in procurement_public_spending: "Carahsoft".
0.300
activeamericancollegecontinuingdemandeducationexperiencefinancialfirmsgrowthlaborlicenselicensingmaintainprofessionalpublicrequiredtitle
SHARED TOKENS (18): "active", "american", "college", "continuing", "demand", "education", "experience", "financial", "firms", "growth", "labor", "license", "licensing", "maintain", "professional", "public", "required", "title".
0.300
casescivilpropertyseparatesystem
SHARED TOKENS (5): "cases", "civil", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.300
agreementsamonganalysisbusinesschangescommercialcomplexconstructionemployeesfinanciallegalnearlyorderspartnersprofessionalsprojectspropertypublicreport
SHARED TOKENS (19): "agreements", "among", "analysis", "business", "changes", "commercial", "complex", "construction", "employees", "financial", "legal", "nearly", "orders", "partners", "professionals", "projects", "property", "public", "report".
0.300
businesschangesdistributioneducationemploymentfeesfinalfirmsgovernmenthealthcareissueslicensingnationalneedspopulationpowerpublicresourcessecurity
SHARED TOKENS (19): "business", "changes", "distribution", "education", "employment", "fees", "final", "firms", "government", "healthcare", "issues", "licensing", "national", "needs", "population", "power", "public", "resources", "security".
0.300
additionalanalysisassistancebestdescriptiondevelopmentexpertisefirmsgenerallegalmarketsorganizationsrelationshipstechnologywork
SHARED TOKENS (15): "additional", "analysis", "assistance", "best", "description", "development", "expertise", "firms", "general", "legal", "markets", "organizations", "relationships", "technology", "work".
0.300
annualbusinesscompletedebtdevelopmentemployeesentityfinancefinancialfirmsformgrowthhistoryinstitutionalmarketmarketsoperatingoperationspublicsources
SHARED TOKENS (24): "annual", "business", "complete", "debt", "development", "employees", "entity", "finance", "financial", "firms", "form", "growth", "history", "institutional", "market", "markets", "operating", "operations", "public", "sources"....
0.300
agreementschangescompensationemployeesemploymentgroupreachrepresentingrightssafetysecuritysingletrainingwageworkworkers
SHARED TOKENS (16): "agreements", "changes", "compensation", "employees", "employment", "group", "reach", "representing", "rights", "safety", "security", "single", "training", "wage", "work", "workers".
0.300
businessentitygovernmentprogramtechnology
SHARED TOKENS (5): "business", "entity", "government", "program", "technology". | EXACT TITLE in procurement_public_spending: "Disadvantaged business enterprise".
0.300
administrativeassociationcivilclassensureformgroupkeylegalorganizationspersonalphysicalpressrightssafetysystem
SHARED TOKENS (16): "administrative", "association", "civil", "class", "ensure", "form", "group", "key", "legal", "organizations", "personal", "physical", "press", "rights", "safety", "system".
0.300
americanassociationauthoritybestchangescitiescontesteddevelopmentdistrictsenvironmentallandland-useneedsphysicalplanningprojectregionalresourceswater
SHARED TOKENS (19): "american", "association", "authority", "best", "changes", "cities", "contested", "development", "districts", "environmental", "land", "land-use", "needs", "physical", "planning", "project", "regional", "resources", "water".
0.300
accessamericanamongbestchangescitiesdevelopersdevelopmenteducationemployeesformformsgovernmenthistoryhomeissuesneedsnetworkpublicresidents
SHARED TOKENS (25): "access", "american", "among", "best", "changes", "cities", "developers", "development", "education", "employees", "form", "forms", "government", "history", "home", "issues", "needs", "network", "public", "residents"....
0.300
agreementsconstitutionalemployeesemploymentfederalfeegeneralgovernmentlaborlocalpublicrepresentationrequiredsecuritystatuteswork
SHARED TOKENS (16): "agreements", "constitutional", "employees", "employment", "federal", "fee", "general", "government", "labor", "local", "public", "representation", "required", "security", "statutes", "work".
0.300
analysiscarrycasesenvironmentestablishedgeneralgovernmentlegallicenselicensedlocalmaintenanceplansproductsprofessionalprojectprojectspropertypublicreports
SHARED TOKENS (23): "analysis", "carry", "cases", "environment", "established", "general", "government", "legal", "license", "licensed", "local", "maintenance", "plans", "products", "professional", "project", "projects", "property", "public", "reports"....
0.300
accessbestcannotentityfederalformsgovernmentlargelocalmarketoperatesproductspublicrepresentsstatewidesupplywater
SHARED TOKENS (17): "access", "best", "cannot", "entity", "federal", "forms", "government", "large", "local", "market", "operates", "products", "public", "represents", "statewide", "supply", "water".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationbarcasescivilcompleteconstitutionalcourtsdepartmenteducationfederallegallicensedlitigationmattersnationalofficeprofessional
SHARED TOKENS (27): "additional", "alongside", "american", "association", "bar", "cases", "civil", "complete", "constitutional", "courts", "department", "education", "federal", "legal", "licensed", "litigation", "matters", "national", "office", "professional"....
0.300
agenciescivilconstructiondepartmentsenvironmentfirmsgovernmentmaintenancemunicipalnationalphysicalprofessionalpublicstructuralworks
SHARED TOKENS (15): "agencies", "civil", "construction", "departments", "environment", "firms", "government", "maintenance", "municipal", "national", "physical", "professional", "public", "structural", "works".
0.300
amongcompetitivedemanddepartmentdistributionintegrationissueslowernetoperationspartnersplanningproductsrequiredsupplysystemtotal
SHARED TOKENS (17): "among", "competitive", "demand", "department", "distribution", "integration", "issues", "lower", "net", "operations", "partners", "planning", "products", "required", "supply", "system", "total".
0.300
activeadministrativeamericancasescourtscoveringcreateddistrictdistrictsfederalheadquarteredidahojudicialjurisdictionlargesttotalwestern
SHARED TOKENS (17): "active", "administrative", "american", "cases", "courts", "covering", "created", "district", "districts", "federal", "headquartered", "idaho", "judicial", "jurisdiction", "largest", "total", "western".
0.300
Open data ↗ Q309901 KW CROSS HIGH
accesscreateddataeducationestablishedformformsgovgovernmentgrowthinstitutionsitselfknowledgelicenselicensedpropertyresourcesrights
SHARED TOKENS (18): "access", "created", "data", "education", "established", "form", "forms", "gov", "government", "growth", "institutions", "itself", "knowledge", "license", "licensed", "property", "resources", "rights".
0.300
codedefendingemployeesemploymentenvironmentformgeneralkeylegalorganizationspersonalphysicalprofessionalrelationshipswork
SHARED TOKENS (15): "code", "defending", "employees", "employment", "environment", "form", "general", "key", "legal", "organizations", "personal", "physical", "professional", "relationships", "work".
0.300
agreementsamongbusinesscasescompetitivecourtscoversemployeeslaborleavelegalmarketmarketssupportsystemworkers
SHARED TOKENS (16): "agreements", "among", "business", "cases", "competitive", "courts", "covers", "employees", "labor", "leave", "legal", "market", "markets", "support", "system", "workers".
0.300
americanappliescivilconstitutionaleducationequallyfederalgovernmentitselfjurisdictionlargelocalrequiresrightssection
SHARED TOKENS (15): "american", "applies", "civil", "constitutional", "education", "equally", "federal", "government", "itself", "jurisdiction", "large", "local", "requires", "rights", "section".
0.300
activeagenciesalternativeassociatedcasescompetitivedistributionemploymentfirmsindustrialissueslandmarketpowerratetotalwork
SHARED TOKENS (17): "active", "agencies", "alternative", "associated", "cases", "competitive", "distribution", "employment", "firms", "industrial", "issues", "land", "market", "power", "rate", "total", "work".
0.300
Invoice ↗ Q190581 EXACT TITLE
commerciallargepaymentproductstransaction
SHARED TOKENS (5): "commercial", "large", "payment", "products", "transaction". | EXACT TITLE in procurement_public_spending: "Invoice".
0.300
businessdistributionidahooperatespower
SHARED TOKENS (5): "business", "distribution", "idaho", "operates", "power". | EXACT TITLE in procurement_public_spending: "Idaho Power".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationcannotcompletecontractorscourtsdebtfeefeeslegalpaymentprincipalpropertysecuritystatutorytitle
SHARED TOKENS (15): "association", "cannot", "complete", "contractors", "courts", "debt", "fee", "fees", "legal", "payment", "principal", "property", "security", "statutory", "title".
0.300
associationbusinesscorporationentityformgovernedlegalliabilitylicensemedicaloperatingoperationsownersphysicalprofessionalrequiredrightssingle
SHARED TOKENS (18): "association", "business", "corporation", "entity", "form", "governed", "legal", "liability", "license", "medical", "operating", "operations", "owners", "physical", "professional", "required", "rights", "single".
0.300
activeamericanassociationcasescommercialcreateddevelopmentformgoverngovernedgovernsgrowthindustrialjurisdictionlandlargelegallocalownersplanning
SHARED TOKENS (24): "active", "american", "association", "cases", "commercial", "created", "development", "form", "govern", "governed", "governs", "growth", "industrial", "jurisdiction", "land", "large", "legal", "local", "owners", "planning"....
0.300
activecannotcaseschaptercodecourtscreateddistrictdistrictsfederalgoverngovernmentitselfjudicialjurisdictionmatterssystemwest
SHARED TOKENS (18): "active", "cannot", "cases", "chapter", "code", "courts", "created", "district", "districts", "federal", "govern", "government", "itself", "judicial", "jurisdiction", "matters", "system", "west".
0.300
chapterclaimscodecourtsdebtfinancialformgeneralpersonalplanspowerpropertysectionstatutesstatutorytitle
SHARED TOKENS (16): "chapter", "claims", "code", "courts", "debt", "financial", "form", "general", "personal", "plans", "power", "property", "section", "statutes", "statutory", "title".
0.300
activeadministrativeagenciesannualcasescitiescourtscoversdistrictestablishedfederalfinaljurisdictionlargelegalnationalpopulationreviewsecuritystrong
SHARED TOKENS (22): "active", "administrative", "agencies", "annual", "cases", "cities", "courts", "covers", "district", "established", "federal", "final", "jurisdiction", "large", "legal", "national", "population", "review", "security", "strong"....
0.300
associationattorneysbarbusinesscasescouncilgeneraljurisdictionlegalmandatoryorganizationsphysicalprofessionalpublicresponsibleseparateserving
SHARED TOKENS (17): "association", "attorneys", "bar", "business", "cases", "council", "general", "jurisdiction", "legal", "mandatory", "organizations", "physical", "professional", "public", "responsible", "separate", "serving".
0.300
businesscasescommercialdefensefeefinancialformgeneralindependentinstitutionalinsurancelandlargelegalnearlyoutsidepaymentpropertyrateregistration
SHARED TOKENS (25): "business", "cases", "commercial", "defense", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "land", "large", "legal", "nearly", "outside", "payment", "property", "rate", "registration"....
0.300
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycasescivilcourtsdefensefinalformsjudiciallegallocalpublicresourcesservesstandards
SHARED TOKENS (15): "agreements", "authority", "cases", "civil", "courts", "defense", "final", "forms", "judicial", "legal", "local", "public", "resources", "serves", "standards".
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
casescivilcourtsdeterminesindependentjurisdictionlargelegalmattersphysicalpublicrequiredreviewseparatespecial
SHARED TOKENS (15): "cases", "civil", "courts", "determines", "independent", "jurisdiction", "large", "legal", "matters", "physical", "public", "required", "review", "separate", "special".
0.300
accessbusinesscommercialdatadepartmentsdevelopmentfinancegenerallargemarketneedsnetworkoperationsordersoutsidepayrollplanningplansrequiredresource
SHARED TOKENS (24): "access", "business", "commercial", "data", "departments", "development", "finance", "general", "large", "market", "needs", "network", "operations", "orders", "outside", "payroll", "planning", "plans", "required", "resource"....
0.300
assistancecarrycollectivelyentityfederalfinancialformgeneralgovernmentlocalorganizationsoutsideprojectspropertypublicsupport
SHARED TOKENS (16): "assistance", "carry", "collectively", "entity", "federal", "financial", "form", "general", "government", "local", "organizations", "outside", "projects", "property", "public", "support".
0.300
agenciesamongbestbusinesscasescompetitivecontractorsentityenvironmentfilesformgenerategovernmentlegalmarketmarketsorganizationspaymentpdfproducts
SHARED TOKENS (23): "agencies", "among", "best", "business", "cases", "competitive", "contractors", "entity", "environment", "files", "form", "generate", "government", "legal", "market", "markets", "organizations", "payment", "pdf", "products"....
0.300
CARES Act ↗ Q88815228 KW CROSS HIGH
additionalbusinessclasscompensationdevelopmenthistorylargestleavelocalnearlyofficeprogramsecuritysingletotal
SHARED TOKENS (15): "additional", "business", "class", "compensation", "development", "history", "largest", "leave", "local", "nearly", "office", "program", "security", "single", "total".
0.300
developmentdifferencesenvironmentfirmslabormarketneedsoperationsorderspaymentplanningprofessionalsrepresentsstrategicsupplysupporttotaltransactions
SHARED TOKENS (18): "development", "differences", "environment", "firms", "labor", "market", "needs", "operations", "orders", "payment", "planning", "professionals", "represents", "strategic", "supply", "support", "total", "transactions".
0.300
Annexation ↗ Q194465 EXACT TITLE
bodieslegalphysicalrecognizedtitle
SHARED TOKENS (5): "bodies", "legal", "physical", "recognized", "title". | EXACT TITLE in legal: "Annexation".
0.300
bestbeyondbusinesscasescontractorsformsgovernmentneedspublicresponsiblesourcessupplysystemtechnologyworks
SHARED TOKENS (15): "best", "beyond", "business", "cases", "contractors", "forms", "government", "needs", "public", "responsible", "sources", "supply", "system", "technology", "works".
0.300
agenciesauthoritycouncilcourtscreatedenvironmentenvironmentalestablishedfederalfinalgovernmentnationalqualityreportsrequirementrequires
SHARED TOKENS (16): "agencies", "authority", "council", "courts", "created", "environment", "environmental", "established", "federal", "final", "government", "national", "quality", "reports", "requirement", "requires".
0.300
administeredagenciesamericandebtdepartmentdepartmentsestablishedfederalfinancefinancialgovernmentinstitutionslicensesmattersnationalofficepresenceresponsiblestatutorysystem
SHARED TOKENS (20): "administered", "agencies", "american", "debt", "department", "departments", "established", "federal", "finance", "financial", "government", "institutions", "licenses", "matters", "national", "office", "presence", "responsible", "statutory", "system".
0.300
adoptionauthoritycasescodecourtsdistrictfederalgovernedgovernsjudicialjurisdictionpropertyrightssectiontitle
SHARED TOKENS (15): "adoption", "authority", "cases", "code", "courts", "district", "federal", "governed", "governs", "judicial", "jurisdiction", "property", "rights", "section", "title".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accesschiefdatafinancialgovernmentlargestlicenseofficeofficeronlinepersonalprogramrecordsreportresourcesresponsiblesecuritytechnologyuniversity
SHARED TOKENS (19): "access", "chief", "data", "financial", "government", "largest", "license", "office", "officer", "online", "personal", "program", "records", "report", "resources", "responsible", "security", "technology", "university".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
administrativeamericananalysisassistanceassociationbarbodiesbusinesscasescorporationcourtscreateddepartmentseducationentityenvironmentestablishedexperienceexpertiseforms
SHARED TOKENS (42): "administrative", "american", "analysis", "assistance", "association", "bar", "bodies", "business", "cases", "corporation", "courts", "created", "departments", "education", "entity", "environment", "established", "experience", "expertise", "forms"....
0.300
agreementsconstitutionalfoodformformsfreelegalmaterialnationalorganizationspowerpublicrecognizedrightssecurityspecial
SHARED TOKENS (16): "agreements", "constitutional", "food", "form", "forms", "free", "legal", "material", "national", "organizations", "power", "public", "recognized", "rights", "security", "special".
0.300
departmentfederalofficeprogrampublic
SHARED TOKENS (5): "department", "federal", "office", "program", "public". | EXACT TITLE in procurement_public_spending: "Federal Highway Administration".
0.300
alternativechangescompleteconstructioncontactcontractorentityformsjointlegalprojectprojectsresponsibleschedulesinglesubcontractorssystemwork
SHARED TOKENS (18): "alternative", "changes", "complete", "construction", "contact", "contractor", "entity", "forms", "joint", "legal", "project", "projects", "responsible", "schedule", "single", "subcontractors", "system", "work".
0.300
Probate court ↗ Q7246899 KW CROSS HIGH
assetsauthoritycasescontestedcountiescourtscreateddeterminesdistributiondistrictissuesjudicialjurisdictionmatterspersonalpropertystatutory
SHARED TOKENS (17): "assets", "authority", "cases", "contested", "counties", "courts", "created", "determines", "distribution", "district", "issues", "judicial", "jurisdiction", "matters", "personal", "property", "statutory".
🫐 BERRY140 edges
0.280
amongannualchangesclaimscourtsgovernmentgrouphistorylegaloutsideprogramrepresentationsectiontotal
SHARED TOKENS (14): "among", "annual", "changes", "claims", "courts", "government", "group", "history", "legal", "outside", "program", "representation", "section", "total".
0.280
agenciesappliesassociationcasescivilconstitutionalexpandedfinanceformsfreegovernmentpressrightsschool
SHARED TOKENS (14): "agencies", "applies", "association", "cases", "civil", "constitutional", "expanded", "finance", "forms", "free", "government", "press", "rights", "school".
0.280
accessagreementsbusinesscannotcasescompensationemployeesemploymentknowledgelegalmaterialprogramrequiredsingle
SHARED TOKENS (14): "access", "agreements", "business", "cannot", "cases", "compensation", "employees", "employment", "knowledge", "legal", "material", "program", "required", "single".
0.280
Temporary work ↗ Q667944 KW CROSS HIGH
developmentemployeesemploymentinsurancelabormarketneedsorganizationsprofessionalsresourcesrightstrainingworkworkers
SHARED TOKENS (14): "development", "employees", "employment", "insurance", "labor", "market", "needs", "organizations", "professionals", "resources", "rights", "training", "work", "workers".
0.280
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasescodecontractorsemployeesemploymentgoverngovernmentjudiciallaborrightsstandardsworkworkers
SHARED TOKENS (14): "agencies", "cases", "code", "contractors", "employees", "employment", "govern", "government", "judicial", "labor", "rights", "standards", "work", "workers".
0.280
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesbodiesconstitutionalcourtsgovernmentlandlegalpowerrequirementrightsstatutory
SHARED TOKENS (14): "administrative", "agencies", "american", "applies", "bodies", "constitutional", "courts", "government", "land", "legal", "power", "requirement", "rights", "statutory".
0.280
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsassociateddistinctivejurisdictionlegalofficeownersproductspropertyregistrationrightssourcesstandards
SHARED TOKENS (14): "agencies", "agreements", "associated", "distinctive", "jurisdiction", "legal", "office", "owners", "products", "property", "registration", "rights", "sources", "standards".
0.280
analysisassociatedcivilcourtsdefenseensurejurisdictionlegalnamespropertyrequiresrunsstatutesstatutory
SHARED TOKENS (14): "analysis", "associated", "civil", "courts", "defense", "ensure", "jurisdiction", "legal", "names", "property", "requires", "runs", "statutes", "statutory".
0.280
knowledgelegalmigrationnational
SHARED TOKENS (4): "knowledge", "legal", "migration", "national". | EXACT TITLE in legal: "Naturalization".
0.280
casesclaimscompensationcoverscreateddefendingdefensegeneralgroupinsurancelegalliabilitypaymentsystem
SHARED TOKENS (14): "cases", "claims", "compensation", "covers", "created", "defending", "defense", "general", "group", "insurance", "legal", "liability", "payment", "system".
0.280
agenciesauthorityfoodgovernmenthealthcareindependentjurisdictionlicensingmarketsofficeproductsresponsiblesafetystandards
SHARED TOKENS (14): "agencies", "authority", "food", "government", "healthcare", "independent", "jurisdiction", "licensing", "markets", "office", "products", "responsible", "safety", "standards".
0.280
Law enforcement ↗ KW CROSS HIGH
associatedauthoritycollectivelycourtsformsgovernmentinstitutionslegalofficerorganizationspowerpropertypublicsystem
SHARED TOKENS (14): "associated", "authority", "collectively", "courts", "forms", "government", "institutions", "legal", "officer", "organizations", "power", "property", "public", "system".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
alternativeamericanamongcannotcasescourtsgenerallegallitigationpublicrequiredsystemtransactions
SHARED TOKENS (13): "alternative", "american", "among", "cannot", "cases", "courts", "general", "legal", "litigation", "public", "required", "system", "transactions".
0.260
Felony ↗ Q178844 EXACT TITLE
additionalcivilland
SHARED TOKENS (3): "additional", "civil", "land". | EXACT TITLE in legal: "Felony".
0.260
amonglegalpresence
SHARED TOKENS (3): "among", "legal", "presence". | EXACT TITLE in legal: "Manslaughter".
0.260
authoritycorporationcreateddistrictdistrictsentitygovernmentlargelocalpowerprojectspublicwater
SHARED TOKENS (13): "authority", "corporation", "created", "district", "districts", "entity", "government", "large", "local", "power", "projects", "public", "water".
0.260
activeamericancasescivilcreatedformsgovernmentgroupkeypermitspublicrequiresrights
SHARED TOKENS (13): "active", "american", "cases", "civil", "created", "forms", "government", "group", "key", "permits", "public", "requires", "rights".
0.260
additionaldevelopmentenvironmentfeefeesformlicenseoperatingphysicalpossessionproductsrequiredresources
SHARED TOKENS (13): "additional", "development", "environment", "fee", "fees", "form", "license", "operating", "physical", "possession", "products", "required", "resources".
0.260
OpenGov ↗ Q17084399 EXACT TITLE
governmentheadquarteredtechnology
SHARED TOKENS (3): "government", "headquartered", "technology". | EXACT TITLE in procurement_public_spending: "OpenGov".
0.260
additionaladministeredcoversdepartmentemployeeshourlaborleavemedicalpublicwageworkworkers
SHARED TOKENS (13): "additional", "administered", "covers", "department", "employees", "hour", "labor", "leave", "medical", "public", "wage", "work", "workers".
0.260
legalphysicalwater
SHARED TOKENS (3): "legal", "physical", "water". | EXACT TITLE in legal: "Water right". | EXACT TITLE in procurement_public_spending: "Water right".
0.260
businessformgovernment
SHARED TOKENS (3): "business", "form", "government". | EXACT TITLE in procurement_public_spending: "Reverse auction".
0.240
alternativecontractorsemployeesemploymentformindependentlabornearlypaymentsecurityworkworkers
SHARED TOKENS (12): "alternative", "contractors", "employees", "employment", "form", "independent", "labor", "nearly", "payment", "security", "work", "workers".
0.240
constructioncontractorcontractorsensurefinancialknowledgeprofessionalprojectprojectsresponsibletitlework
SHARED TOKENS (12): "construction", "contractor", "contractors", "ensure", "financial", "knowledge", "professional", "project", "projects", "responsible", "title", "work".
0.240
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialcompetitiveformslegallicensedmaintainpropertyregistration
SHARED TOKENS (12): "agreements", "among", "assets", "business", "commercial", "competitive", "forms", "legal", "licensed", "maintain", "property", "registration".
0.240
administeredassistancechangesenvironmentalfederalformmaintainphysicalqualityresourcewaterworks
SHARED TOKENS (12): "administered", "assistance", "changes", "environmental", "federal", "form", "maintain", "physical", "quality", "resource", "water", "works".
0.240
associateddepartmentsenvironmentfinancialgovernmentnationalorganizationspresspropertyratesustainedtraffic
SHARED TOKENS (12): "associated", "departments", "environment", "financial", "government", "national", "organizations", "press", "property", "rate", "sustained", "traffic".
0.240
Data quality ↗ Q1757694 KW CROSS HIGH
casesdataensureformgovernanceoperationsplanningqualityrepresentsrequiredsourcesstandards
SHARED TOKENS (12): "cases", "data", "ensure", "form", "governance", "operations", "planning", "quality", "represents", "required", "sources", "standards".
0.240
Probation ↗ Q13961 KW CROSS HIGH
appliescontactcourtsjurisdictionleavemaintainofficerorderspartnerpossessionprogramrequired
SHARED TOKENS (12): "applies", "contact", "courts", "jurisdiction", "leave", "maintain", "officer", "orders", "partner", "possession", "program", "required".
0.240
Lawsuit ↗ Q697327 KW CROSS HIGH
attorneysbusinesscivilclaimsissueslegallitigationordersorganizationspublicrepresentingrequired
SHARED TOKENS (12): "attorneys", "business", "civil", "claims", "issues", "legal", "litigation", "orders", "organizations", "public", "representing", "required".
0.230
constitutionalgovernmentidahooffice
SHARED TOKENS (4): "constitutional", "government", "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.220
agriculturalcontractorsemployeesestablishedfederalgovernmentindependentlabornationalpowerworkers
SHARED TOKENS (11): "agricultural", "contractors", "employees", "established", "federal", "government", "independent", "labor", "national", "power", "workers".
0.220
agenciesauthoritycoversfederalfinancialliabilitylistinglitigationorganizationssecuritytransactions
SHARED TOKENS (11): "agencies", "authority", "covers", "federal", "financial", "liability", "listing", "litigation", "organizations", "security", "transactions".
0.220
Civil liberties ↗ Q29556 KW CROSS HIGH
authoritycivilgovernmentjudicialpersonalpowerpresspropertyrightssecuritywork
SHARED TOKENS (11): "authority", "civil", "government", "judicial", "personal", "power", "press", "property", "rights", "security", "work".
0.220
alongsideamericanassistancebusinessdistributioneducationexpandedfinalfinanciallaborlocal
SHARED TOKENS (11): "alongside", "american", "assistance", "business", "distribution", "education", "expanded", "final", "financial", "labor", "local".
0.220
adabusinesschangescivilcouncilemployeesfinalnationalpublicrequiresrights
SHARED TOKENS (11): "ada", "business", "changes", "civil", "council", "employees", "final", "national", "public", "requires", "rights".
0.220
businessfinancialframeworkgovernmentlegalmandatoryorganizationspublicresourcesstandardstransactions
SHARED TOKENS (11): "business", "financial", "framework", "government", "legal", "mandatory", "organizations", "public", "resources", "standards", "transactions".
0.220
Public finance ↗ Q274490 KW CROSS HIGH
allocationamericanamongcarrydistributionfinanceframeworkgovernmentmarketpublicresources
SHARED TOKENS (11): "allocation", "american", "among", "carry", "distribution", "finance", "framework", "government", "market", "public", "resources".
0.220
businessensurefinancialkeyphysicalpropertypublicrequiredresourcesstrategictransaction
SHARED TOKENS (11): "business", "ensure", "financial", "key", "physical", "property", "public", "required", "resources", "strategic", "transaction".
0.220
assistancecivil
SHARED TOKENS (2): "assistance", "civil". | EXACT TITLE in procurement_public_spending: "Discovery (law)".
0.220
combinedcompleteformhealthcareitselfjurisdictionlegalmedicalpersonalpowersingle
SHARED TOKENS (11): "combined", "complete", "form", "healthcare", "itself", "jurisdiction", "legal", "medical", "personal", "power", "single".
0.220
claimsemploymentfinancialgovernmentinstitutionsissuesorganizationspublicreportresourceswork
SHARED TOKENS (11): "claims", "employment", "financial", "government", "institutions", "issues", "organizations", "public", "report", "resources", "work".
0.220
Road transport ↗ KW CROSS HIGH
developmentensurefoodformslargelicensinglocalsafetyseparatespecialtraffic
SHARED TOKENS (11): "development", "ensure", "food", "forms", "large", "licensing", "local", "safety", "separate", "special", "traffic".
0.220
civilcourtsformslandlegalliabilitypossessionpowerresponsiblesystemwater
SHARED TOKENS (11): "civil", "courts", "forms", "land", "legal", "liability", "possession", "power", "responsible", "system", "water".
0.220
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturecommercialinstitutionalissueslargepublicqualityseparatesupplysystemwater
SHARED TOKENS (11): "agriculture", "commercial", "institutional", "issues", "large", "public", "quality", "separate", "supply", "system", "water".
0.220
appliescompensationconstitutionalfederalgovernmentlocalpropertypublicrequirementrequiresrights
SHARED TOKENS (11): "applies", "compensation", "constitutional", "federal", "government", "local", "property", "public", "requirement", "requires", "rights".
0.210
Attorney ↗ Q1289214 EXACT TITLE
power
SHARED TOKENS (1): "power". | EXACT TITLE in legal: "Attorney". | EXACT TITLE in procurement_public_spending: "Attorney".
0.210
Family law ↗ Q384014 EXACT TITLE
matters
SHARED TOKENS (1): "matters". | EXACT TITLE in legal: "Family law".
0.200
appliesassistancecasescounseldistrictgovernmentpublicrequirementrequiresrights
SHARED TOKENS (10): "applies", "assistance", "cases", "counsel", "district", "government", "public", "requirement", "requires", "rights".
0.200
Family court ↗ Q82749 KW CROSS HIGH
caseschangescourtscreatedlegalmattersordersrelationshipssupportsystem
SHARED TOKENS (10): "cases", "changes", "courts", "created", "legal", "matters", "orders", "relationships", "support", "system".
0.200
Grant ↗ Q219140 EXACT TITLE
EXACT TITLE in procurement_public_spending: "Grant".
0.200
casescivilcourtscoversdistrictdistrictsfederaljudicialjurisdictionresidents
SHARED TOKENS (10): "cases", "civil", "courts", "covers", "district", "districts", "federal", "judicial", "jurisdiction", "residents".
0.200
complexcorporationfinalfreeintegrationlargemarketproductssupplyvertical
SHARED TOKENS (10): "complex", "corporation", "final", "free", "integration", "large", "market", "products", "supply", "vertical".
0.200
Magistrate ↗ Q4594605 KW CROSS HIGH
administerscasescivilgovernmentjudiciallocallowermattersofficerresponsible
SHARED TOKENS (10): "administers", "cases", "civil", "government", "judicial", "local", "lower", "matters", "officer", "responsible".
0.200
Cost estimate ↗ Q795053 KW CROSS HIGH
americanassociationdataestablishedgovernmentofficeprogramprojectsingletotal
SHARED TOKENS (10): "american", "association", "data", "established", "government", "office", "program", "project", "single", "total".
0.200
establishedfederalgovernmenthistoryissueslegallocalphysicalpropertyrights
SHARED TOKENS (10): "established", "federal", "government", "history", "issues", "legal", "local", "physical", "property", "rights".
0.200
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployeesemploymentnationalratereceivedsupplyworkworkersworks
SHARED TOKENS (10): "beyond", "employees", "employment", "national", "rate", "received", "supply", "work", "workers", "works".
0.200
subdivision
EXACT TITLE in legal: "Subdivision". | EXACT TITLE in procurement_public_spending: "Subdivision".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will". | EXACT TITLE in procurement_public_spending: "Will".
0.200
administrativecannotcivilclaimsemploymentestablishedfederalgovernmentnationalrights
SHARED TOKENS (10): "administrative", "cannot", "civil", "claims", "employment", "established", "federal", "government", "national", "rights".
0.200
Paternity ↗ Q16881001 EXACT TITLE
childhousepaternitytelevision
EXACT TITLE in legal: "Paternity".
0.180
agenciesbusinesscasesdistributionfinancialinstitutionslaboroutsidesystem
SHARED TOKENS (9): "agencies", "business", "cases", "distribution", "financial", "institutions", "labor", "outside", "system".
0.180
cannotcasesinsurancelegalliabilitypublicratespecialsystem
SHARED TOKENS (9): "cannot", "cases", "insurance", "legal", "liability", "public", "rate", "special", "system".
0.180
dataexpandedfinancenetworkphysicalpowersecuritystandardstechnology
SHARED TOKENS (9): "data", "expanded", "finance", "network", "physical", "power", "security", "standards", "technology".
0.180
agenciesbusinessfilesfinalformgovernmentlegalonlinepdf
SHARED TOKENS (9): "agencies", "business", "files", "final", "form", "government", "legal", "online", "pdf".
0.180
Damages ↗ Q308922 KW CROSS HIGH
compensationformgenerallegalmedicalphysicalpropertyrecognizedspecial
SHARED TOKENS (9): "compensation", "form", "general", "legal", "medical", "physical", "property", "recognized", "special".
0.180
collegeeducationformsgeneralknowledgenamesschooltechnologytraining
SHARED TOKENS (9): "college", "education", "forms", "general", "knowledge", "names", "school", "technology", "training".
0.180
casescompletelaborlicenseoutsideprofessionalreachsystemtraining
SHARED TOKENS (9): "cases", "complete", "labor", "license", "outside", "professional", "reach", "system", "training".
0.180
administersdepartmentdepartmentsdevelopmentfederalgovernmenthomeprogramreports
SHARED TOKENS (9): "administers", "department", "departments", "development", "federal", "government", "home", "program", "reports".
0.180
Beneficiary ↗ Q2596417 KW CROSS HIGH
assetscreateddevelopmententityfinanceinsurancelegalpaymentprojects
SHARED TOKENS (9): "assets", "created", "development", "entity", "finance", "insurance", "legal", "payment", "projects".
0.180
appliescannotcasescourtsformissuesmaterialorderssupport
SHARED TOKENS (9): "applies", "cannot", "cases", "courts", "form", "issues", "material", "orders", "support".
0.160
businessdataeducationemploymentlegalprocessingpublicsources
SHARED TOKENS (8): "business", "data", "education", "employment", "legal", "processing", "public", "sources".
0.160
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotlegalmedicalpersonalprofessionalpropertypublic
SHARED TOKENS (8): "authority", "cannot", "legal", "medical", "personal", "professional", "property", "public".
0.160
amongcorporationdetermineslandpropertyrightssystemwater
SHARED TOKENS (8): "among", "corporation", "determines", "land", "property", "rights", "system", "water".
0.160
datadifferencesentityfileskeynationalrecordssources
SHARED TOKENS (8): "data", "differences", "entity", "files", "key", "national", "records", "sources".
0.160
Sex offender ↗ Q5659979 KW CROSS HIGH
civilcontinuingjurisdictionlegalmandatorypublicregistrationstatutory
SHARED TOKENS (8): "civil", "continuing", "jurisdiction", "legal", "mandatory", "public", "registration", "statutory".
0.160
Deed ↗ Q705914 KW CROSS HIGH
associatedlegalliabilitylicensespropertyrightsspecialtytitle
SHARED TOKENS (8): "associated", "legal", "liability", "licenses", "property", "rights", "specialty", "title".
0.160
administrativeauthoritycourtsgovernmentjudicialpowerreviewstrong
SHARED TOKENS (8): "administrative", "authority", "courts", "government", "judicial", "power", "review", "strong".
0.160
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualcontractorsemployeesindependentleavewagework
SHARED TOKENS (8): "among", "annual", "contractors", "employees", "independent", "leave", "wage", "work".
0.160
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesdeterminesdistributionformsjurisdictionpropertyresultingstatutory
SHARED TOKENS (8): "applies", "determines", "distribution", "forms", "jurisdiction", "property", "resulting", "statutory".
0.160
Trial court ↗ Q3125101 KW CROSS HIGH
authoritycasescourtsestablishedjurisdictionmatterspowerreview
SHARED TOKENS (8): "authority", "cases", "courts", "established", "jurisdiction", "matters", "power", "review".
0.160
agriculturalamericanappropriationindustriallegalrightssystemwater
SHARED TOKENS (8): "agricultural", "american", "appropriation", "industrial", "legal", "rights", "system", "water".
0.160
accessalternativeassociatedexperiencefinancialproductsresourcesstrategic
SHARED TOKENS (8): "access", "alternative", "associated", "experience", "financial", "products", "resources", "strategic".
0.160
americanbusinessdevelopmentfederalfirmsnearlyreviewwest
SHARED TOKENS (8): "american", "business", "development", "federal", "firms", "nearly", "review", "west".
0.160
distributiongovernmentjudiciallargepersonalpossessionproductssystem
SHARED TOKENS (8): "distribution", "government", "judicial", "large", "personal", "possession", "products", "system".
0.160
Easement ↗ Q448405 KW CROSS HIGH
accessamongbestitselflandpropertypublicrights
SHARED TOKENS (8): "access", "among", "best", "itself", "land", "property", "public", "rights".
0.160
chaptercodefederalformgoverngovernssectiontitle
SHARED TOKENS (8): "chapter", "code", "federal", "form", "govern", "governs", "section", "title".
0.140
adaboisecanyoncountiesidahotreasurevalley
SHARED TOKENS (7): "ada", "boise", "canyon", "counties", "idaho", "treasure", "valley".
0.140
Expungement ↗ Q2352928 KW CROSS HIGH
federalgeneraljurisdictionlegalpublicrecordsreview
SHARED TOKENS (7): "federal", "general", "jurisdiction", "legal", "public", "records", "review".
0.140
additionalcaseshistorynationalrecordsresultingtraffic
SHARED TOKENS (7): "additional", "cases", "history", "national", "records", "resulting", "traffic".
0.140
Parole ↗ Q5357120 KW CROSS HIGH
additionalassociatedformkeyoutsideservingsystem
SHARED TOKENS (7): "additional", "associated", "form", "key", "outside", "serving", "system".
0.140
Bail ↗ Q162351 KW CROSS HIGH
additionalcasesensureformjudicialpropertyrequired
SHARED TOKENS (7): "additional", "cases", "ensure", "form", "judicial", "property", "required".
0.140
collegeeducationforminstitutionsmaintainschooluniversity
SHARED TOKENS (7): "college", "education", "form", "institutions", "maintain", "school", "university".
0.140
assetsauthoritydataensureformsgovernancequality
SHARED TOKENS (7): "assets", "authority", "data", "ensure", "forms", "governance", "quality".
0.140
casescivilformfreelegalpropertypublic
SHARED TOKENS (7): "cases", "civil", "form", "free", "legal", "property", "public".
0.140
codecompletedataprocessingqualityrecordssystem
SHARED TOKENS (7): "code", "complete", "data", "processing", "quality", "records", "system".
0.140
analysisbusinesscomplexdatadevelopmentimprovingplanning
SHARED TOKENS (7): "analysis", "business", "complex", "data", "development", "improving", "planning".
0.140
Debtor ↗ Q157470 KW CROSS HIGH
agreementsdebtentitygovernmentlegalpersonalrequires
SHARED TOKENS (7): "agreements", "debt", "entity", "government", "legal", "personal", "requires".
0.140
americanattorneyscivildefenselegalmatterspublic
SHARED TOKENS (7): "american", "attorneys", "civil", "defense", "legal", "matters", "public".
0.140
americanassociationidaholaborownersservingwestern
SHARED TOKENS (7): "american", "association", "idaho", "labor", "owners", "serving", "western".
0.140
civilcommercialgovernedlegalpropertyrequiredrights
SHARED TOKENS (7): "civil", "commercial", "governed", "legal", "property", "required", "rights".
0.140
formliabilitypersonalproductspropertypublicresponsible
SHARED TOKENS (7): "form", "liability", "personal", "products", "property", "public", "responsible".
0.140
carrycombinedcommercialindustrialseparateservingsystem
SHARED TOKENS (7): "carry", "combined", "commercial", "industrial", "separate", "serving", "system".
0.140
accessassociatedconstructiondevelopmentgovernmentinstitutionspublic
SHARED TOKENS (7): "access", "associated", "construction", "development", "government", "institutions", "public".
0.120
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsuranceobligationsprincipalpropertytransaction
SHARED TOKENS (6): "established", "insurance", "obligations", "principal", "property", "transaction".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "nearly", "population".
0.120
knowledgelegalpowerpropertyrequiredrequirement
SHARED TOKENS (6): "knowledge", "legal", "power", "property", "required", "requirement".
0.120
Partnership ↗ Q728646 KW CROSS HIGH
businessgovernedorganizationspartnerpartnersreach
SHARED TOKENS (6): "business", "governed", "organizations", "partner", "partners", "reach".
0.120
Criminal law ↗ Q146491 KW CROSS HIGH
civilcompensationestablishedjurisdictionpropertysafety
SHARED TOKENS (6): "civil", "compensation", "established", "jurisdiction", "property", "safety".
0.120
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfinanciallegalmaintenancerequiredsupport
SHARED TOKENS (6): "agreements", "financial", "legal", "maintenance", "required", "support".
0.120
appropriationconstitutionalgeneralgovernmentsupplysystem
SHARED TOKENS (6): "appropriation", "constitutional", "general", "government", "supply", "system".
0.120
Drug court ↗ Q5308883 KW CROSS HIGH
barcombinedcourtsdefensepublicwork
SHARED TOKENS (6): "bar", "combined", "courts", "defense", "public", "work".
0.120
Indemnity ↗ Q708399 KW CROSS HIGH
compensationforminsuranceitselfmedicalprincipal
SHARED TOKENS (6): "compensation", "form", "insurance", "itself", "medical", "principal".
0.120
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasescreatedgovernmentpermitsphysical
SHARED TOKENS (6): "agencies", "cases", "created", "government", "permits", "physical".
0.120
agenciesgovernmentneedsplanningpublicsystem
SHARED TOKENS (6): "agencies", "government", "needs", "planning", "public", "system".
0.120
ensurefinanciallegalliabilityobligationsrenewal
SHARED TOKENS (6): "ensure", "financial", "legal", "liability", "obligations", "renewal".
0.120
accessfederalgovernmentlocalpublicrecords
SHARED TOKENS (6): "access", "federal", "government", "local", "public", "records".
0.120
federallocalneedsorganizationsprofessionalrequires
SHARED TOKENS (6): "federal", "local", "needs", "organizations", "professional", "requires".
0.120
amongdistrictensurelegalpublicserves
SHARED TOKENS (6): "among", "district", "ensure", "legal", "public", "serves".
0.120
allocationanalysisdataitselflegalresulting
SHARED TOKENS (6): "allocation", "analysis", "data", "itself", "legal", "resulting".
0.120
accessdemandformnetworkphysicalresources
SHARED TOKENS (6): "access", "demand", "form", "network", "physical", "resources".
0.120
businessentitylegalownersseparatework
SHARED TOKENS (6): "business", "entity", "legal", "owners", "separate", "work".
0.120
Fraud ↗ Q28813 KW CROSS HIGH
casescivilcompensationitselflegalproperty
SHARED TOKENS (6): "cases", "civil", "compensation", "itself", "legal", "property".
0.120
departmentfinancialintegrationlargestplanningsupply
SHARED TOKENS (6): "department", "financial", "integration", "largest", "planning", "supply".
0.120
businessfinancialformlegalpowerprincipal
SHARED TOKENS (6): "business", "financial", "form", "legal", "power", "principal".
0.120
Legal clinic ↗ Q1351667 KW CROSS HIGH
experiencefreelegalprogramschoolwork
SHARED TOKENS (6): "experience", "free", "legal", "program", "school", "work".
0.100
administeredassociationbarjurisdictionrequired
SHARED TOKENS (5): "administered", "association", "bar", "jurisdiction", "required".
0.100
Summons ↗ Q708245 KW CROSS HIGH
administrativeformgovernmentjudiciallegal
SHARED TOKENS (5): "administrative", "form", "government", "judicial", "legal".
0.100
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlegalpublicrights
SHARED TOKENS (5): "employment", "jurisdiction", "legal", "public", "rights".
0.100
financialgovernmentlaborprofessionalswage
SHARED TOKENS (5): "financial", "government", "labor", "professionals", "wage".
0.100
codefoodmunicipalpublicsources
SHARED TOKENS (5): "code", "food", "municipal", "public", "sources".
0.100
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbusinesslegalquality
SHARED TOKENS (5): "applies", "assets", "business", "legal", "quality".
0.100
cannotcounselknowledgerequiredrights
SHARED TOKENS (5): "cannot", "counsel", "knowledge", "required", "rights".
0.100
Discrimination ↗ Q169207 KW CROSS HIGH
classgroupinstitutionslegalrights
SHARED TOKENS (5): "class", "group", "institutions", "legal", "rights".
0.100
administrativefederallegalofficereview
SHARED TOKENS (5): "administrative", "federal", "legal", "office", "review".
0.100
Injunction ↗ Q6495575 KW CROSS HIGH
civilcourtsformlegalspecial
SHARED TOKENS (5): "civil", "courts", "form", "legal", "special".
0.100
attorneyscounsellegalprofessionalrepresentation
SHARED TOKENS (5): "attorneys", "counsel", "legal", "professional", "representation".
0.100
departmentdevelopmentfederallocalprogram
SHARED TOKENS (5): "department", "development", "federal", "local", "program".
0.100
Traffic light ↗ Q8004 KW CROSS HIGH
localnationalsystemtechnologytraffic
SHARED TOKENS (5): "local", "national", "system", "technology", "traffic".
◈ Frequently Asked Questions
Legal × Procurement Public Spending — Treasure Valley
HAIKU · HIGH GATE
What legal framework governs how Boise State University must conduct procurement for public funds?
Idaho administrative law sets mandatory bidding and disclosure requirements for all public spending by Boise State University, including contract formation and vendor selection. The Idaho Legislature codified these procurement standards to ensure transparency in how state universities in Ada County spend taxpayer dollars.
How do tort liability rules affect procurement contracts in Ada County and Canyon County government?
Ada County and Canyon County government entities must include specific tort liability clauses in procurement contracts to limit public exposure and comply with Idaho's sovereign immunity statutes. Administrative law review of these contracts ensures they allocate risk appropriately between the government and private contractors before any public spending occurs.
What legal considerations apply when Nampa or Garden City pursue mergers and acquisitions involving private equity in procurement contracts?
Nampa and Garden City must ensure that private equity acquisitions of existing government contractors comply with Idaho administrative law requirements for contract assignment and continuity of performance. Legal review of such transactions protects public spending by verifying that new ownership does not create conflicts of interest or breach fiduciary duties to the municipality.
How does Boise's legal department review procurement contracts before the city approves public spending?
Boise's legal department examines all procurement contracts for compliance with Idaho contract law, administrative regulations, and Ada County civil code before city council approves public spending. This legal vetting process prevents disputes and protects Boise's public funds from liability exposure or contract enforceability challenges.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Procurement Public Spending 17 QID bridges 298 edges 8,557 ext links 2026-07-17 21:49:19 UTC d71c82c8125c0c02
Legal corridor ↗ Procurement Public Spending corridor ↗ Procurement Public Spending × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals