—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Energy Utilities

17 Wikipedia bridge articles confirmed in both vertical ledgers. 313 deterministic cross-vertical edges. 8,805 external source links harvested. Every edge provenance-stamped. Every claim auditable.

17 QID Bridge Articles
313 Cross Edges
8,805 External Sources
370 Wikipedia Articles
17 🌲 Evergreen
160 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Energy Utilities
QID Bridge Articles
17
confirmed Wikipedia overlap
Total Cross Edges
313
External Sources Harvested
8,805
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Clean Water Act
score: 1.0000  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (17)
Clean Water ActSnake RiverTreasure ValleyBoise State UniversityAquiferWater rightIrrigation districts in the United StatesMergers and acquisitionsNampa, IdahoBoise, IdahoPrivate equityAda County, IdahoPrior-appropriation water rightsCanyon County, IdahoCaldwell, IdahoMeridian, IdahoEagle, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationwatercanyonnorthwestpublicriverwesthomeadagroundwaterlawnameirrigationlargestvalleywesternlocalbusiness
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:46:37 UTC
Content Hash
98b2f69a0958cc63
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
17 BRIDGES
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in legal (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (18): "address", "administered", "changes", "environmental", "federal", "form", "groundwater", "law", "maintain", "name", "owned", "physical", "primary", "protection", "quality", "resource", "water", "works". | EXACT TITLE in energy_utilities: "Clean Water Act".
addressadministeredchangesenvironmentalfederalformgroundwaterlawmaintainnameownedphysicalprimaryprotectionqualityresourcewaterworks
governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
f 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination. Groundwater protection provisions are included in the Safe Drinking Water Act, Resource Conservation and Recovery Act, and the Superfund act. Background Health implications of water pollution Contamination of drinking water supplies can not only occur in the source water but also in the distribution system. Sources of water contamination include naturally occurring chemicals and minerals (arsenic, radon, uranium), local land use practices (fertilizers, pesticides, concentrated feeding operations), manufacturing processes, and sewer overflows or wastewater releases. Some examples of health implications of water contamination are gastrointestinal illness, reproductive problems, and neurological disorders.
Anti-degradation policy The water quality regulations include an anti-degradation policy that requires states and tribes to establish a three-tiered anti-degradation program. Anti-degradation procedures identify steps and questions that need to be addressed when specific activities affect water quality. "Tier 1" requirements are applicable to all surface waters. These requirements maintain and protect current uses and the water quality conditions to support existing uses. Current uses are identified by showing that fishing, swimming, and other water uses have occurred and are suitable since November 28, 1975. "Tier 2" requirements maintains and protects water bodies with existing conditions that are better to support "fishable/swimmable" uses pursuant to CWA section 101(a)(2).
Snake River
EXACT TITLE 1.000
QID OVERLAP: Q272074 in legal (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (25): "agencies", "american", "canyon", "commercial", "construction", "eastern", "falls", "history", "idaho", "irrigation", "large", "largest", "national", "northwest", "projects", "public", "river", "snake", "southern", "territory".... | EXACT TITLE in legal: "Snake River". | EXACT TITLE in energy_utilities: "Snake River".
agenciesamericancanyoncommercialconstructioneasternfallshistoryidahoirrigationlargelargestnationalnorthwestprojectspublicriversnakesouthernterritorytribalvalleywestwesternworld
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in legal (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "name", "resources", "river", "snake", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in energy_utilities: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalnameresourcesriversnaketreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Boise State University
EXACT TITLE 0.940
QID OVERLAP: Q891082 in legal (tier:branch) and energy_utilities (tier:evergreen). | SHARED TOKENS (12): "among", "boise", "business", "college", "education", "idaho", "independent", "program", "public", "school", "university", "west". | EXACT TITLE in energy_utilities: "Boise State University".
amongboisebusinesscollegeeducationidahoindependentprogrampublicschooluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Aquifer
Q208791 EXACT TITLE 0.920
QID OVERLAP: Q208791 in legal (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (11): "aquifer", "beyond", "environment", "flow", "formation", "groundwater", "home", "industrial", "land", "layer", "water". | EXACT TITLE in legal: "Aquifer". | EXACT TITLE in energy_utilities: "Aquifer".
aquiferbeyondenvironmentflowformationgroundwaterhomeindustriallandlayerwater
An aquifer is an underground layer of water-bearing material consisting of permeable or fractured rock, or of unconsolidated materials (gravel, sand, or silt). Aquifers vary greatly in their characteristics. The study of water flow in aquifers and the characterization of aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
W
Q7973730 EXACT TITLE 0.900
QID OVERLAP: Q7973730 in legal (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (10): "ground", "groundwater", "irrigation", "law", "legal", "physical", "right", "river", "surface", "water". | EXACT TITLE in legal: "Water right". | EXACT TITLE in energy_utilities: "Water right".
groundgroundwaterirrigationlawlegalphysicalrightriversurfacewater
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
cated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
Community-based allocation of water In some jurisdictions, appropriative water rights can be granted directly to communities. Here, water is reserved to provide sufficient capacity for the future growth of that particular community. For example, California provides communities and other water users within watersheds senior status over appropriative (use-based) water rights solely because they are located where the water originates and naturally flows. A second example of community-based water rights is pueblo water rights. As recognized by California, pueblo water rights are grants to individual settlements (i.e. pueblos) over all streams and rivers flowing through the city and to all groundwater aquifers underlying that particular city. The pueblo's claim expands with the needs of the city and may be used to supply the needs of areas that are later annexed to the city. While California recognizes pueblo water rights, pueblo water rights are controversial.
I
Q6073798 QID OVERLAP 0.800
QID OVERLAP: Q6073798 in legal (tier:evergreen) and energy_utilities (tier:evergreen). | SHARED TOKENS (15): "authority", "corporation", "district", "districts", "entity", "irrigation", "large", "local", "organized", "power", "projects", "public", "set", "subdivision", "water".
authoritycorporationdistrictdistrictsentityirrigationlargelocalorganizedpowerprojectspublicsetsubdivisionwater
division of the State government, with definite geographic boundaries, organized, and having taxing power to obtain and distribute water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn.
water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district
igation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district References External links Federal lands included in state irrigation districts "The Nevada Irrigation District Act"
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (22): "assets", "business", "commission", "competitive", "corporate", "department", "entity", "federal", "governed", "law", "legal", "market", "operating", "operations", "organization", "regulatory", "requires", "review", "single", "strategic"....
assetsbusinesscommissioncompetitivecorporatedepartmententityfederalgovernedlawlegalmarketoperatingoperationsorganizationregulatoryrequiresreviewsinglestrategictradetransaction
l terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Acquisition An acquisition/takeover is the purchase of one business or company by another company or other business entity. Specific acquisition targets can be identified through myriad avenues, including market research, trade expos, sent up from internal business units, or supply chain analysis. Such purchase may be of 100%, or nearly 100%, of the assets or ownership equity of the acquired entity. A consolidation/amalgamation occurs when two companies combine to form a new enterprise altogether, and neither of the previous companies remains independently owned. Acquisitions are divided into "private" and "public" acquisitions, depending on whether the acquiree or merging company (also termed a target) is or is not publicly listed. Some public companies rely on acquisitions as an important value creation strategy. An additional dimension or categorization consists of whether an acquisition is friendly or hostile. Achieving acquisition success has proven to be very difficult, while various studies have shown that 50% of acquisitions were unsuccessful. "Serial acquirers" appear to be more successful with M&A than companies who make acquisitions only occasionally (see Douma & Schreuder, 2013, chapter 13). The new forms of buy out created since the 2008 financial crisis are based on serial type acquisitions known as an ECO Buyout which is a co-community ownership buy out and the new generation buy outs of the MIBO (Management Involved or Management & Institution Buy Out) and MEIBO (Management & Employee Involved Buy Out). Whether a purchase is perceived as being "friendly" or "hostile" depends significantly on how the proposed acquisition is communicated to and perceived by the target company's board of directors, employees, and shareholders. It is normal for M&A deal communications to take place in a so-called "confidentiality bubble", wherein the flow of information is restricted pursuant to confidentiality agreements. In the case of a friendly transaction, the companies cooperate in negotiations; in the case of a hostile deal, the board and/or management of the target is unwilling to be bought or the target's board has no prior knowledge of the offer. Hostile acquisitions can, and often do, ultimately become "friendly" as the acquirer secures endorsement of the transaction from the board of the acquiree company. This usually requires an improvement in the terms of the offer and/or through negotiation. "Acquisition" usually refers to a purchase of a smaller firm by a larger one. Sometimes, however, a smaller firm will acquire management control of a larger and/or longer-established company and retain the name of the latter for the post-acquisition combined entity. This is known as a reverse takeover. Another type of acquisition is the reverse merger, a form of transaction that enables a private company to be publicly listed in a relatively short time frame. A reverse merger is a type of merger where a privately held company, typically one with promising prospects and a need for financing, acquires a publicly listed shell company that has few assets and no significant business operations. The combined evidence suggests that the shareholders of acquired firms realize significant positive "abnormal returns," while shareholders of the acquiring company are most likely to experience a negative wealth effect. Most studies indicate that M&A transactions have a positive net effect, with investors in both the buyer and target companies seeing positive returns. This suggests that M&A creates economic value, likely by transferring assets to more efficient management teams who can better utilize them.
The buyer buys the shares, and therefore control, of the target company being purchased. Ownership control of the company in turn conveys effective control over the assets of the company, but since the company is acquired intact as a going concern, this form of transaction carries with it all of the liabilities accrued by that business over its past and all of the risks that company faces in its commercial environment and corporate environment The buyer buys the assets of the target company. The cash the target receives from the sell-off is paid back to its shareholders by dividend or through liquidation. This type of transaction leaves the target company as an empty shell, if the buyer buys out the entire assets. A buyer often structures the transaction as an asset purchase to "cherry-pick" the assets that it wants and leave out the assets and liabilities that it does not. This can be particularly important where foreseeable liabilities may include future, unquantified damage awards such as those that could arise from litigation over defective products, employee benefits or terminations, or environmental damage. A disadvantage of this structure is the tax that many jurisdictions, particularly outside the United States, impose on transfers of the individual assets, whereas stock transactions can frequently be structured as like-kind exchanges or other arrangements that are tax-free or tax-neutral, both to the buyer and to the seller's shareholders. The terms "demerger", "spin-off" and "spin-out" are sometimes used to indicate a situation where one company splits into two, generating a second company which may or may not become separately listed on a stock exchange. As per knowledge-based views, firms can generate greater values through the retention of knowledge-based resources which they generate and integrate. Extracting technological benefits during and after acquisition is an ever-challenging issue because of organizational differences.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meridian", "name", "nampa", "northwest", "population", "principal", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannamenampanorthwestpopulationprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "counties", "home", "idaho", "level", "population", "river", "technology", "treasure", "valley".
adaannualboisecountieshomeidaholevelpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
P
Q476115 QID OVERLAP 0.740
QID OVERLAP: Q476115 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (12): "active", "business", "changes", "development", "expansion", "finance", "financial", "financing", "firm", "firms", "fund", "public".
activebusinesschangesdevelopmentexpansionfinancefinancialfinancingfirmfirmsfundpublic
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (11): "ada", "boise", "cascade", "district", "home", "idaho", "jurisdiction", "largest", "local", "northwest", "population".
adaboisecascadedistricthomeidahojurisdictionlargestlocalnorthwestpopulation
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
P
Q7245403 QID OVERLAP 0.680
QID OVERLAP: Q7245403 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (9): "agricultural", "american", "full", "industrial", "legal", "right", "rights", "system", "water".
agriculturalamericanfullindustriallegalrightrightssystemwater
In the American legal system, prior appropriation water rights is the doctrine that the first person to take a quantity of water from a water source for "beneficial use" (agricultural, industrial or household) has the right to continue to use that quantity of water for that purpose. Subsequent users can take the remaining water for their own use if they do not impinge on the rights of previous users.
Nature of the right The legal details of prior appropriation vary from state to state. Under the prior appropriation system, the right is initially allotted to those who are "first in time of use"; these rights of withdrawal can then trade on the open market, like other property. For water sources with many users, a government or quasi-government agency is usually charged with overseeing allocations. Allocations involving water sources that cross state borders or international borders can be quite contentious, and are generally governed by federal court rulings, interstate agreements and international treaties. A claim of prior appropriation must prove four sub-claims: diversion (that the water had been withdrawn), priority (that the withdrawer had diverted water prior to the other claimant), intent (that the water had been withdrawn by design), and beneficial use (that the water was put to a publicly-acceptable end). If proved, the initial person to use a quantity of water from a water source for a beneficial use has the right to continue to use the same quantity of water for the same purpose. Subsequent users can use the remaining water for their own beneficial purposes provided that they do not impinge on the rights of previous users; this is the priority element of the doctrine. But neither can a senior user change the manner (i.e., location) in which they appropriate water to the detriment of a junior user. These Preservation of Conditions were granted to the second user after Farmers Highline Canal & Reservoir Co. v. City of Golden, 272 P.2d 629 (Colo. 1954). A senior water user could, for example, only have been using the water during a particular season. Then the purchaser of the water right could only use the water in the same season as when the right was established. In addition, the state may put additional conditions on the use of the water right to prevent polluting or inefficient uses of water. Beneficial use is commonly defined as agricultural, industrial or household use. The doctrine has historically excluded ecological purposes, such as maintaining a natural body of water and the wildlife that depends on it, but some jurisdictions now accept such claims. The extent to which private parties may own such rights varies among the states. Each water right has a yearly quantity and an appropriation date. Each year, the user with the earliest appropriation date (known as the "senior appropriator") may use up to their full allocation (provided the water source can supply it). Then the user with the next earliest appropriation date may use their full allocation and so on. In cases of water shortages, prior-appropriation does not require a senior user to utilize less water than usual. Therefore, during times of drought, users with junior appropriation dates might not receive their full allocation or even any water at all. When a water right is sold, it retains its original appropriation date. Only the amount of water historically consumed can be transferred if a water right is sold. For example, if alfalfa is grown using flood irrigation, the amount of the return flow may not be transferred, only the amount that would be necessary to irrigate the amount of alfalfa historically grown. Prior appropriation rights are subject to certain adverse possession-type rules to reduce speculation. Withdrawal rights can be lost or shrunk over time if unused for a certain number of years, or if a litigant can demonstrate that the water's use is not beneficial.
Criticism Each drop of rain falling through the sky has already been allocated to a user. Leave the hose running between rinses while you wash your car and you won't run afoul of the law; but if you gather a pailful of rainwater and pour on your tomato plant, look over your shoulder for a water cop. You will be preventing those raindrops from entering the watershed, depriving people downstream from the surrounding creeks and rivers of their rights to use their apportioned amounts of streamflow. The doctrine of prior appropriation comes crashing up against the imperative to conserve scarce water. Colorado made it legal for some homeowners to harvest rain and snow from their roofs. Tucson is encouraging its citizens to gather rainwater. Santa Fe made catchment devices mandatory for new dwellings. But, in Utah and Washington (with the exception of Seattle), harvesting raindrops is still a crime. Even though water markets increasingly gain ground, many criticize the prior appropriation system for failing to adequately adjust to society's evolving values and needs. Environmentalists and recreational river-users demand more water be left in rivers and streams, but courts have been slow to accept these requests as beneficial uses. Conversely, the tool of beneficial use is too tied to custom to encourage users to conserve. An appropriator who uses water inefficiently retains the right to the full allotment, but an appropriator who uses only a portion risks losing the right to the rest, and water right markets remain too illiquid to purchase any excess. As a result, the vast majority of water in the West still is allocated to agricultural uses despite cries for additional water from growing cities. High demand can cause an over-appropriation of the waters, in which there are more water rights for a particular stream than water actually available. This leads to an apparent inefficiency: if a water source is over-appropriated, the latest users will almost never see water from their claims.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (6): "ada", "among", "boise", "idaho", "meridian", "population".
adaamongboiseidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in legal (tier:branch) and energy_utilities (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
296 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP296 edges
🌿 BRANCH160 edges
0.590
adaboisecanalcanyonidahoirrigationriversystemtreasurevalleywaterwestern
SHARED TOKENS (12): "ada", "boise", "canal", "canyon", "idaho", "irrigation", "river", "system", "treasure", "valley", "water", "western". | URL->B (1): https://www.usbr.gov/projects/index.php?id=338. | EXACT TITLE in energy_utilities: "New York Canal".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureassociatedboiseeasternidaholandlargestnationalnorthwestorganizedpopulationriversectorseparatesnaketechnologyterritoryunionwest
SHARED TOKENS (21): "agricultural", "agriculture", "associated", "boise", "eastern", "idaho", "land", "largest", "national", "northwest", "organized", "population", "river", "sector", "separate", "snake", "technology", "territory", "union", "west".... | EXACT TITLE in legal: "Idaho". | EXACT TITLE in energy_utilities: "Idaho".
0.500
Corporation ↗ Q167037 EXACT TITLE
businesscorporatecorporationcorporationsentityjointjurisdictionlawlegallocalnaturalobligationsofficeownedownerspublicregistrationrightsingleworkers
SHARED TOKENS (20): "business", "corporate", "corporation", "corporations", "entity", "joint", "jurisdiction", "law", "legal", "local", "natural", "obligations", "office", "owned", "owners", "public", "registration", "right", "single", "workers". | EXACT TITLE in legal: "Corporation". | EXACT TITLE in energy_utilities: "Corporation".
0.500
civilenforcementenvironmentalgovernsjurisdictionlandlawlegalpropertypublicrealrelationshipsrightsseparateset
SHARED TOKENS (15): "civil", "enforcement", "environmental", "governs", "jurisdiction", "land", "law", "legal", "property", "public", "real", "relationships", "rights", "separate", "set". | EXACT TITLE in legal: "Property law".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbusinessentityfederalgovernedjurisdictionlawlegallifenaturalownerspropertypublicrequiresrightsingle
SHARED TOKENS (16): "assets", "business", "entity", "federal", "governed", "jurisdiction", "law", "legal", "life", "natural", "owners", "property", "public", "requires", "right", "single". | EXACT TITLE in legal: "Trust (law)".
0.500
agenciescommunitydevelopmentenforcementenvironmentenvironmentalfirmsgreenindustrialindustryinstitutionslawmaintainphysicalpublicservingsetstandardssupplywater
SHARED TOKENS (20): "agencies", "community", "development", "enforcement", "environment", "environmental", "firms", "green", "industrial", "industry", "institutions", "law", "maintain", "physical", "public", "serving", "set", "standards", "supply", "water". | EXACT TITLE in energy_utilities: "Infrastructure".
0.500
benefitscompetitiveenergyenvironmentalexpansionfinancialgreenlandlargelocalmainnaturalnetpowerpublicratereachrequiresresourceresources
SHARED TOKENS (21): "benefits", "competitive", "energy", "environmental", "expansion", "financial", "green", "land", "large", "local", "main", "natural", "net", "power", "public", "rate", "reach", "requires", "resource", "resources".... | EXACT TITLE in energy_utilities: "Renewable energy".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalconstructioncriticalflowindustrialirrigationlandlargelifemaintenancemigrationneedsprojectprojectsrecreationresultingriversafetysupplyvalley
SHARED TOKENS (22): "additional", "construction", "critical", "flow", "industrial", "irrigation", "land", "large", "life", "maintenance", "migration", "needs", "project", "projects", "recreation", "resulting", "river", "safety", "supply", "valley".... | EXACT TITLE in energy_utilities: "Dam".
0.500
amongcommissiondevelopmentestatefinanciallegalmethodologynationalpropertyrealrightssubdivisionsystemtransactionworld
SHARED TOKENS (15): "among", "commission", "development", "estate", "financial", "legal", "methodology", "national", "property", "real", "rights", "subdivision", "system", "transaction", "world". | EXACT TITLE in legal: "Real estate transaction".
0.500
amongcasesdomesticexperiencefinancialhomelevellifeofficeorganizationpartnersphysicalpowerratesrelationshipsresourcestechnologyworld
SHARED TOKENS (18): "among", "cases", "domestic", "experience", "financial", "home", "level", "life", "office", "organization", "partners", "physical", "power", "rates", "relationships", "resources", "technology", "world". | EXACT TITLE in legal: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongfallindustriallawlegalnationalorganizationpropertyprotectionpublicrightrightstechnologytradeworld
SHARED TOKENS (16): "agreements", "among", "fall", "industrial", "law", "legal", "national", "organization", "property", "protection", "public", "right", "rights", "technology", "trade", "world". | EXACT TITLE in legal: "Patent".
0.500
cannotcommissionenergyentityfederallargelocalmarketnaturaloperatesorganizationpublicregulationrepresentsscalesupplywater
SHARED TOKENS (17): "cannot", "commission", "energy", "entity", "federal", "large", "local", "market", "natural", "operates", "organization", "public", "regulation", "represents", "scale", "supply", "water". | EXACT TITLE in energy_utilities: "Public utility".
0.500
businesscompensationconsumerformgrowthlawlicenselicensedlicensingmarketprofessionalprotectionpublicqualityregulationregulatoryreviewsafetystandardstandards
SHARED TOKENS (20): "business", "compensation", "consumer", "form", "growth", "law", "license", "licensed", "licensing", "market", "professional", "protection", "public", "quality", "regulation", "regulatory", "review", "safety", "standard", "standards". | EXACT TITLE in energy_utilities: "Occupational licensing".
0.500
businesscommercialcommunitycorporatecorporationcorporationsenvironmentfinancialformationgovernancegovernslawlegalmarketorganizationsrelationsrightssystem
SHARED TOKENS (18): "business", "commercial", "community", "corporate", "corporation", "corporations", "environment", "financial", "formation", "governance", "governs", "law", "legal", "market", "organizations", "relations", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
authoritycannotcasescivilfinalitselfjurisdictionlawlegallevelpowerproceedingproceedingsreviewrightstandardsystemworld
SHARED TOKENS (18): "authority", "cannot", "cases", "civil", "final", "itself", "jurisdiction", "law", "legal", "level", "power", "proceeding", "proceedings", "review", "right", "standard", "system", "world". | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebeyondconsumerdepartmentemploymentfeegreengrowthknowledgephysicalpresenceprogramprojectsregulationrequiresspecialtywageworkers
SHARED TOKENS (19): "additional", "agriculture", "beyond", "consumer", "department", "employment", "fee", "green", "growth", "knowledge", "physical", "presence", "program", "projects", "regulation", "requires", "specialty", "wage", "workers". | EXACT TITLE in legal: "H-1B visa".
0.500
Tariff ↗ EXACT TITLE
americanamongconsumerdomesticfallsformgrowthindustrylocalnationalregulationsupplyterritorytradeunionworkers
SHARED TOKENS (16): "american", "among", "consumer", "domestic", "falls", "form", "growth", "industry", "local", "national", "regulation", "supply", "territory", "trade", "union", "workers". | EXACT TITLE in energy_utilities: "Tariff".
0.500
collectioncommunitycomplexdistributiondistrictenergyenvironmentalflowintegrationnetworkpowerrelationshipsrequiresresourcessupplysystem
SHARED TOKENS (16): "collection", "community", "complex", "distribution", "district", "energy", "environmental", "flow", "integration", "network", "power", "relationships", "requires", "resources", "supply", "system". | EXACT TITLE in energy_utilities: "Distributed generation".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagricultureaquiferdepthdistributionenvironmentalformformationgroundgroundwaterindustriallandlargestlevelmunicipaloperatingprimarypublicsurfacevalley
SHARED TOKENS (22): "agricultural", "agriculture", "aquifer", "depth", "distribution", "environmental", "form", "formation", "ground", "groundwater", "industrial", "land", "largest", "level", "municipal", "operating", "primary", "public", "surface", "valley".... | EXACT TITLE in legal: "Groundwater". | EXACT TITLE in energy_utilities: "Groundwater".
0.500
Zoning ↗ Q702232 EXACT TITLE
developmentformgoverngrowthindustriallandland-uselocalplanningpropertyregulatoryscalesetsinglezoning
SHARED TOKENS (15): "development", "form", "govern", "growth", "industrial", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "set", "single", "zoning". | EXACT TITLE in legal: "Zoning". | EXACT TITLE in energy_utilities: "Zoning".
0.500
Pipeline ↗ Q25471856 EXACT TITLE
constructionenvironmentalindustryirrigationmainmarketnaturalneedsnetworkpipelineplanningprojectssystemwaterwork
SHARED TOKENS (15): "construction", "environmental", "industry", "irrigation", "main", "market", "natural", "needs", "network", "pipeline", "planning", "projects", "system", "water", "work". | EXACT TITLE in legal: "Pipeline". | EXACT TITLE in energy_utilities: "Pipeline".
0.500
americanannualassociationboisebusinessclasscollegeeducationemploymentenvironmentalexpansionfallfallsfullidaholawmainnaturalnewsplans
SHARED TOKENS (29): "american", "annual", "association", "boise", "business", "class", "college", "education", "employment", "environmental", "expansion", "fall", "falls", "full", "idaho", "law", "main", "natural", "news", "plans".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
annualchargescommercialdemanddomesticenergyindustriallevelmonthlyoperatingpowerrepresentssinglesupplysustained
SHARED TOKENS (15): "annual", "charges", "commercial", "demand", "domestic", "energy", "industrial", "level", "monthly", "operating", "power", "represents", "single", "supply", "sustained". | EXACT TITLE in energy_utilities: "Peak demand".
0.500
activeamericanassociationassociationscasescommercialcommunitycorporationsdevelopmentestateformgoverngovernedgovernsgrowthindustrialjurisdictionlandlargelaw
SHARED TOKENS (39): "active", "american", "association", "associations", "cases", "commercial", "community", "corporations", "development", "estate", "form", "govern", "governed", "governs", "growth", "industrial", "jurisdiction", "land", "large", "law".... | EXACT TITLE in energy_utilities: "Homeowner association".
0.500
agenciesamericandatadepartmentfederallaborlifelocalmaintainofficeprincipalpublicqualityresourceservessystem
SHARED TOKENS (16): "agencies", "american", "data", "department", "federal", "labor", "life", "local", "maintain", "office", "principal", "public", "quality", "resource", "serves", "system". | EXACT TITLE in energy_utilities: "Bureau of Labor Statistics".
0.500
Real estate ↗ Q684740 EXACT TITLE
businesscommercialcorporationsentityestatelandlawlegalnaturalownedpropertypublicrealresourceswater
SHARED TOKENS (15): "business", "commercial", "corporations", "entity", "estate", "land", "law", "legal", "natural", "owned", "property", "public", "real", "resources", "water". | EXACT TITLE in legal: "Real estate". | EXACT TITLE in energy_utilities: "Real estate".
0.500
associationcontractorsgroundgroundwatergroupindustrynationaloperatesorganizationpublicpublishesresponsibleseparatetradewater
SHARED TOKENS (15): "association", "contractors", "ground", "groundwater", "group", "industry", "national", "operates", "organization", "public", "publishes", "responsible", "separate", "trade", "water". | EXACT TITLE in energy_utilities: "National Ground Water Association".
0.500
Contract ↗ Q93288 EXACT TITLE
adoptionagreementsbusinesscivilcodecommercialdateenforcementframeworkgovernedindependentlawlegalnationalobligationsrightstrade
SHARED TOKENS (17): "adoption", "agreements", "business", "civil", "code", "commercial", "date", "enforcement", "framework", "governed", "independent", "law", "legal", "national", "obligations", "rights", "trade". | EXACT TITLE in legal: "Contract". | EXACT TITLE in energy_utilities: "Contract".
0.500
agenciesagreementscompensationdevelopmentenergyenforcementenvironmentenvironmentalgrowthjurisdictionlawlegalnationalnaturalneedsorganizationsprotectionregulatoryresourceresources
SHARED TOKENS (23): "agencies", "agreements", "compensation", "development", "energy", "enforcement", "environment", "environmental", "growth", "jurisdiction", "law", "legal", "national", "natural", "needs", "organizations", "protection", "regulatory", "resource", "resources".... | EXACT TITLE in legal: "Environmental law".
0.500
activeamericancascadecollectioncorporationenergyenvironmentallargestoperatesoperationsownedprojectsprotectionresidentswater
SHARED TOKENS (15): "active", "american", "cascade", "collection", "corporation", "energy", "environmental", "largest", "operates", "operations", "owned", "projects", "protection", "residents", "water". | EXACT TITLE in energy_utilities: "Republic Services".
0.500
adoptionappliesassetsbusinesscivilcodecommercialconsumerdistrictemploymentfallfinancefinancialfinancingfoodformationframeworkgovernjurisdictionlaw
SHARED TOKENS (37): "adoption", "applies", "assets", "business", "civil", "code", "commercial", "consumer", "district", "employment", "fall", "finance", "financial", "financing", "food", "formation", "framework", "govern", "jurisdiction", "law".... | EXACT TITLE in legal: "Commercial law".
0.500
communitydataenergyenvironmentalintegrationlevellocalnationaloperatingpowerprimaryprojectprojectsregionalscale
SHARED TOKENS (15): "community", "data", "energy", "environmental", "integration", "level", "local", "national", "operating", "power", "primary", "project", "projects", "regional", "scale". | EXACT TITLE in energy_utilities: "Small hydro".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteasterneducationfallgovernedidaholargenampapopulationprimarypublicresidentsservedsouthern
SHARED TOKENS (24): "ada", "boise", "canyon", "college", "community", "counties", "development", "eastern", "education", "fall", "governed", "idaho", "large", "nampa", "population", "primary", "public", "residents", "served", "southern".... | EXACT TITLE in energy_utilities: "College of Western Idaho".
0.500
casescivilcollectiondevelopmentenforcementfinancialjointjurisdictionlawmaintenanceneedsobligationsprimaryrequiresreviewrightrightssinglestandardsupport
SHARED TOKENS (22): "cases", "civil", "collection", "development", "enforcement", "financial", "joint", "jurisdiction", "law", "maintenance", "needs", "obligations", "primary", "requires", "review", "right", "rights", "single", "standard", "support".... | EXACT TITLE in legal: "Child support".
0.490
commissionidahoownedpowerpublicregulatewater
SHARED TOKENS (7): "commission", "idaho", "owned", "power", "public", "regulate", "water". | URL->B (1): https://puc.idaho.gov/. | EXACT TITLE in energy_utilities: "Idaho Public Utilities Commission".
0.480
departmentdevelopmentfederalirrigationlargestlawoversightpowerprogramprojectsresourcesupplywaterwestern
SHARED TOKENS (14): "department", "development", "federal", "irrigation", "largest", "law", "oversight", "power", "program", "projects", "resource", "supply", "water", "western". | EXACT TITLE in energy_utilities: "Bureau of Reclamation".
0.480
assetscommunityconstructionemploymentenvironmentalmunicipalphysicalprojectsprotectionpublicsafetysupplywaterworks
SHARED TOKENS (14): "assets", "community", "construction", "employment", "environmental", "municipal", "physical", "projects", "protection", "public", "safety", "supply", "water", "works". | EXACT TITLE in energy_utilities: "Public works".
0.480
Microgrid ↗ Q5762595 EXACT TITLE
distributiondomesticenergyentitylevellocalneedsoperatespowerprotectionsinglesupplysystemwater
SHARED TOKENS (14): "distribution", "domestic", "energy", "entity", "level", "local", "needs", "operates", "power", "protection", "single", "supply", "system", "water". | EXACT TITLE in energy_utilities: "Microgrid".
0.480
Well ↗ Q43483 EXACT TITLE
aquiferconstructiondateenvironmentalfallsgroundwaterneedsoldestreachresourcessupplysurfacewaterworld
SHARED TOKENS (14): "aquifer", "construction", "date", "environmental", "falls", "groundwater", "needs", "oldest", "reach", "resources", "supply", "surface", "water", "world". | EXACT TITLE in legal: "Well". | EXACT TITLE in energy_utilities: "Well".
0.480
appliesenvironmentalfederalfoodlawprimaryprotectionpublicqualityservedsetstandardssystemwater
SHARED TOKENS (14): "applies", "environmental", "federal", "food", "law", "primary", "protection", "public", "quality", "served", "set", "standards", "system", "water". | EXACT TITLE in energy_utilities: "Safe Drinking Water Act".
0.480
Heat pump ↗ Q131313 EXACT TITLE
adoptiondistrictenergyfallsgeneratesgroundnaturalneedsoperatespowersalessystemtransferswater
SHARED TOKENS (14): "adoption", "district", "energy", "falls", "generates", "ground", "natural", "needs", "operates", "power", "sales", "system", "transfers", "water". | EXACT TITLE in energy_utilities: "Heat pump".
0.480
Mediation ↗ Q223871 EXACT TITLE
agreementsamongauthoritycivilcommercialformindependentlawlegallicensingneedsprofessionalreachtraining
SHARED TOKENS (14): "agreements", "among", "authority", "civil", "commercial", "form", "independent", "law", "legal", "licensing", "needs", "professional", "reach", "training". | EXACT TITLE in legal: "Mediation".
0.480
Pipefitter ↗ Q5407416 EXACT TITLE
casescommercialconstructioneducationindustrialinstitutionallicensednationalrequiresstandardstradeunionwaterworks
SHARED TOKENS (14): "cases", "commercial", "construction", "education", "industrial", "institutional", "licensed", "national", "requires", "standards", "trade", "union", "water", "works". | EXACT TITLE in energy_utilities: "Pipefitter".
0.480
compensationcorporationsdevelopmentfeefinalfulllandlegalownerspowerpropertypublicrighttitle
SHARED TOKENS (14): "compensation", "corporations", "development", "fee", "final", "full", "land", "legal", "owners", "power", "property", "public", "right", "title". | EXACT TITLE in legal: "Eminent domain".
0.460
Natural gas ↗ Q40858 EXACT TITLE
adoptionalongsideassetscommercialdemandenergyindustrylargestnaturalreportstandardsupplywater
SHARED TOKENS (13): "adoption", "alongside", "assets", "commercial", "demand", "energy", "industry", "largest", "natural", "report", "standard", "supply", "water". | EXACT TITLE in energy_utilities: "Natural gas".
0.460
Stormwater ↗ Q1421263 EXACT TITLE
demandeventsfallsgroundwaterlandlargenaturalpopulationresourcerightsurfacevolumewater
SHARED TOKENS (13): "demand", "events", "falls", "groundwater", "land", "large", "natural", "population", "resource", "right", "surface", "volume", "water". | EXACT TITLE in energy_utilities: "Stormwater".
0.460
energyenvironmentenvironmentalflowindustrialirrigationmaintenancequalityrecreationresourceriversupplywater
SHARED TOKENS (13): "energy", "environment", "environmental", "flow", "industrial", "irrigation", "maintenance", "quality", "recreation", "resource", "river", "supply", "water". | EXACT TITLE in energy_utilities: "Water treatment".
0.460
agricultureamericanboisecivilcountiesidahoirrigationlevelnationalprimaryriverwaterwestern
SHARED TOKENS (13): "agriculture", "american", "boise", "civil", "counties", "idaho", "irrigation", "level", "national", "primary", "river", "water", "western". | EXACT TITLE in energy_utilities: "Arrowrock Dam".
0.460
Compost ↗ Q212254 EXACT TITLE
agriculturebenefitscommercialconstructionenvironmentalfoodgreenlandlevelphysicalrequiresresultingwater
SHARED TOKENS (13): "agriculture", "benefits", "commercial", "construction", "environmental", "food", "green", "land", "level", "physical", "requires", "resulting", "water". | EXACT TITLE in energy_utilities: "Compost".
0.460
Canal ↗ Q12284 EXACT TITLE
canalcasesdivideflowirrigationlevelnaturalresourcesriversupplysurfacevalleywater
SHARED TOKENS (13): "canal", "cases", "divide", "flow", "irrigation", "level", "natural", "resources", "river", "supply", "surface", "valley", "water". | EXACT TITLE in legal: "Canal". | EXACT TITLE in energy_utilities: "Canal".
0.460
Recycling ↗ Q132580 EXACT TITLE
complexenergyenvironmentalfoodformofficeproducesrepresentsresourcestandardssupplysystemwater
SHARED TOKENS (13): "complex", "energy", "environmental", "food", "form", "office", "produces", "represents", "resource", "standards", "supply", "system", "water". | EXACT TITLE in energy_utilities: "Recycling".
0.440
Complaint ↗ Q836925 EXACT TITLE
associatedauthoritycaseschargescivilfederalgovernlawlegalnamepowersupport
SHARED TOKENS (12): "associated", "authority", "cases", "charges", "civil", "federal", "govern", "law", "legal", "name", "power", "support". | EXACT TITLE in energy_utilities: "Complaint".
0.440
caseslandlawlegalpropertypublicrealregistrationrightrightsservestitle
SHARED TOKENS (12): "cases", "land", "law", "legal", "property", "public", "real", "registration", "right", "rights", "serves", "title". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in energy_utilities: "Title (property)".
0.440
agreementsbenefitscasescivilestategovernlegalpropertyrightrightssupportunion
SHARED TOKENS (12): "agreements", "benefits", "cases", "civil", "estate", "govern", "legal", "property", "right", "rights", "support", "union". | EXACT TITLE in legal: "Prenuptial agreement".
0.440
Veolia ↗ Q1632461 EXACT TITLE
businessenergyenvironmentenvironmentalgroupmainnameoperationspublicsectorsinglewater
SHARED TOKENS (12): "business", "energy", "environment", "environmental", "group", "main", "name", "operations", "public", "sector", "single", "water". | EXACT TITLE in energy_utilities: "Veolia".
0.440
commissioncommissionersdepartmentenergyfederalindependentlicensingnaturalpipelineprojectsregulatoryserving
SHARED TOKENS (12): "commission", "commissioners", "department", "energy", "federal", "independent", "licensing", "natural", "pipeline", "projects", "regulatory", "serving". | EXACT TITLE in energy_utilities: "Federal Energy Regulatory Commission".
0.440
amongbenefitscompensationemploymentformmedicaloutsideplansrightsystemwageworkers
SHARED TOKENS (12): "among", "benefits", "compensation", "employment", "form", "medical", "outside", "plans", "right", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.420
Divorce ↗ Q93190 EXACT TITLE
authoritycivildebtdistributionlawlegalpropertyrequiressupportunionworld
SHARED TOKENS (11): "authority", "civil", "debt", "distribution", "law", "legal", "property", "requires", "support", "union", "world". | EXACT TITLE in legal: "Divorce".
0.420
Arbitration ↗ Q207946 EXACT TITLE
classcommercialconsumeremploymententityformlocalproceedingsreviewrightrights
SHARED TOKENS (11): "class", "commercial", "consumer", "employment", "entity", "form", "local", "proceedings", "review", "right", "rights". | EXACT TITLE in legal: "Arbitration".
0.420
casescivilcommunitydivideestatelawownedpropertyseparatesystemworld
SHARED TOKENS (11): "cases", "civil", "community", "divide", "estate", "law", "owned", "property", "separate", "system", "world". | EXACT TITLE in legal: "Community property".
0.420
completecontinuingdevelopmentdistricteducationlawlegallicensesmaintainoutsideprofessional
SHARED TOKENS (11): "complete", "continuing", "development", "district", "education", "law", "legal", "licenses", "maintain", "outside", "professional". | EXACT TITLE in legal: "Continuing legal education".
0.420
Substation ↗ Q174814 EXACT TITLE
commercialconsumerdistributionenergyflowindustriallargeownedpowersupplysystem
SHARED TOKENS (11): "commercial", "consumer", "distribution", "energy", "flow", "industrial", "large", "owned", "power", "supply", "system". | EXACT TITLE in energy_utilities: "Substation".
0.420
casescompletelaborlevellicenseoutsideprofessionalreachsystemtradetraining
SHARED TOKENS (11): "cases", "complete", "labor", "level", "license", "outside", "professional", "reach", "system", "trade", "training". | EXACT TITLE in energy_utilities: "Apprenticeship".
0.410
boiseidahooperations
SHARED TOKENS (3): "boise", "idaho", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.400
adoptioncontactjointlawlegalphysicalproceedingsrightrightsstandard
SHARED TOKENS (10): "adoption", "contact", "joint", "law", "legal", "physical", "proceedings", "right", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.400
Law firm ↗ Q613142 EXACT TITLE
businesscasescivilcorporationsentityfirmlawlegalprimaryrights
SHARED TOKENS (10): "business", "cases", "civil", "corporations", "entity", "firm", "law", "legal", "primary", "rights". | EXACT TITLE in legal: "Law firm".
0.400
businessconstructioncontractorfirmhomelicensesmaintenanceownersprofessionalwork
SHARED TOKENS (10): "business", "construction", "contractor", "firm", "home", "licenses", "maintenance", "owners", "professional", "work". | EXACT TITLE in energy_utilities: "Electrical contractor".
0.400
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlawlegalprofessionalschoolsystemuniversity
SHARED TOKENS (10): "college", "department", "education", "jurisdiction", "law", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.400
Lawyer ↗ Q40348 EXACT TITLE
educationjurisdictionknowledgelawlegalprofessionalrightssystemtrainingwork
SHARED TOKENS (10): "education", "jurisdiction", "knowledge", "law", "legal", "professional", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.400
amongcommissiondistrictlegaloversightownedpublicregulationregulatoryserves
SHARED TOKENS (10): "among", "commission", "district", "legal", "oversight", "owned", "public", "regulation", "regulatory", "serves". | EXACT TITLE in energy_utilities: "Public utilities commission".
0.400
businessdistributioneasternidahonaturaloperatespowerriversnakesouthern
SHARED TOKENS (10): "business", "distribution", "eastern", "idaho", "natural", "operates", "power", "river", "snake", "southern". | EXACT TITLE in energy_utilities: "Idaho Power".
0.400
Easement ↗ Q448405 EXACT TITLE
amongitselflandlawownedpropertypublicrealrightrights
SHARED TOKENS (10): "among", "itself", "land", "law", "owned", "property", "public", "real", "right", "rights". | EXACT TITLE in energy_utilities: "Easement".
0.380
americancasesentitylawlegallifemedicalpropertyquality
SHARED TOKENS (9): "american", "cases", "entity", "law", "legal", "life", "medical", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.380
assetscomplexestatelegallifeneedsnetplanningproperty
SHARED TOKENS (9): "assets", "complex", "estate", "legal", "life", "needs", "net", "planning", "property". | EXACT TITLE in legal: "Estate planning".
0.380
Journeyman ↗ Q582096 EXACT TITLE
businesseducationexperiencelicensepublicresponsibletradeworkworkers
SHARED TOKENS (9): "business", "education", "experience", "license", "public", "responsible", "trade", "work", "workers". | EXACT TITLE in energy_utilities: "Journeyman".
0.380
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivillawlegalobligationspropertyrightsstatutory
SHARED TOKENS (9): "among", "assets", "civil", "law", "legal", "obligations", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.380
agriculturaldomesticenvironmentindustrialindustrymainmunicipalresultingwater
SHARED TOKENS (9): "agricultural", "domestic", "environment", "industrial", "industry", "main", "municipal", "resulting", "water". | EXACT TITLE in energy_utilities: "Wastewater treatment".
0.380
landlawlegalmainprimarypropertyrightstradeworld
SHARED TOKENS (9): "land", "law", "legal", "main", "primary", "property", "rights", "trade", "world". | EXACT TITLE in legal: "Intellectual property".
0.380
Green card ↗ Q6676995 EXACT TITLE
amongcasesfederalformgreenproceedingsregistrationresidentsworkers
SHARED TOKENS (9): "among", "cases", "federal", "form", "green", "proceedings", "registration", "residents", "workers". | EXACT TITLE in legal: "Green card".
0.380
conditioncontactphysicalqualitysafetysetstandardssupplywater
SHARED TOKENS (9): "condition", "contact", "physical", "quality", "safety", "set", "standards", "supply", "water". | EXACT TITLE in energy_utilities: "Water quality".
0.380
canyoneasternidahonationalrecreationriversnakewestwestern
SHARED TOKENS (9): "canyon", "eastern", "idaho", "national", "recreation", "river", "snake", "west", "western". | EXACT TITLE in energy_utilities: "Hells Canyon".
0.380
Assault ↗ Q365680 EXACT TITLE
chargescivilcontactlawlegalphysicalseparatesinglesystem
SHARED TOKENS (9): "charges", "civil", "contact", "law", "legal", "physical", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.380
americancasescivillawlegalproceedingreviewsinglesystem
SHARED TOKENS (9): "american", "cases", "civil", "law", "legal", "proceeding", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.380
boisedepartmentenvironmentalfederalidahomainqualityregionalresponsible
SHARED TOKENS (9): "boise", "department", "environmental", "federal", "idaho", "main", "quality", "regional", "responsible". | EXACT TITLE in energy_utilities: "Idaho Department of Environmental Quality".
0.380
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilentityjurisdictionlawlegalpetitionspower
SHARED TOKENS (9): "administrative", "authority", "civil", "entity", "jurisdiction", "law", "legal", "petitions", "power". | EXACT TITLE in legal: "Court".
0.380
authoritycasesfederallandlawpopulationpowerrightsstatutory
SHARED TOKENS (9): "authority", "cases", "federal", "land", "law", "population", "power", "rights", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.370
Electrician ↗ Q165029 EXACT TITLE
datamaintenance
SHARED TOKENS (2): "data", "maintenance". | URL->B (1): http://www.bls.gov/ooh/construction-and-extraction/electricians.htm. | EXACT TITLE in energy_utilities: "Electrician".
0.360
Wastewater ↗ Q336191 EXACT TITLE
agriculturalcommercialcommunitydomesticindustrialmunicipalsurfacewater
SHARED TOKENS (8): "agricultural", "commercial", "community", "domestic", "industrial", "municipal", "surface", "water". | EXACT TITLE in energy_utilities: "Wastewater".
0.360
boisedatadistrictdistrictsidahopopulationresidentssingle
SHARED TOKENS (8): "boise", "data", "district", "districts", "idaho", "population", "residents", "single". | EXACT TITLE in legal: "Idaho Legislature".
0.360
Landfill ↗ Q152810 EXACT TITLE
activeenvironmentalfinalformfulllandmunicipaloldest
SHARED TOKENS (8): "active", "environmental", "final", "form", "full", "land", "municipal", "oldest". | EXACT TITLE in energy_utilities: "Landfill".
0.360
Probate ↗ Q6500369 EXACT TITLE
assetsestatejurisdictionlawlegalpowerpropertypublic
SHARED TOKENS (8): "assets", "estate", "jurisdiction", "law", "legal", "power", "property", "public". | EXACT TITLE in legal: "Probate".
0.360
constructiondateitselflabornamespropertyrealtitle
SHARED TOKENS (8): "construction", "date", "itself", "labor", "names", "property", "real", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.360
Jury ↗ Q837675 EXACT TITLE
civilgrouplawlegalprofessionalsetsinglesystem
SHARED TOKENS (8): "civil", "group", "law", "legal", "professional", "set", "single", "system". | EXACT TITLE in legal: "Jury".
0.360
agriculturalidaholandlargestnorthwestriversnakesouthern
SHARED TOKENS (8): "agricultural", "idaho", "land", "largest", "northwest", "river", "snake", "southern". | EXACT TITLE in legal: "Snake River Plain".
0.360
idaho
SHARED TOKENS (1): "idaho". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.360
annualenergyformationgroundgroundwaterprimarysurfaceworld
SHARED TOKENS (8): "annual", "energy", "formation", "ground", "groundwater", "primary", "surface", "world". | EXACT TITLE in energy_utilities: "Geothermal heating".
0.360
cannotcasesfederalfulllegalofficepublicrequires
SHARED TOKENS (8): "cannot", "cases", "federal", "full", "legal", "office", "public", "requires". | EXACT TITLE in legal: "Public defender".
0.360
Creditor ↗ Q157165 EXACT TITLE
assetsdebtfinanciallaworganizationpropertyrepresentsworld
SHARED TOKENS (8): "assets", "debt", "financial", "law", "organization", "property", "represents", "world". | EXACT TITLE in legal: "Creditor".
0.340
Immigration law ↗ EXACT TITLE
lawlegalmaintainnationalregulaterightrights
SHARED TOKENS (7): "law", "legal", "maintain", "national", "regulate", "right", "rights". | EXACT TITLE in legal: "Immigration law".
0.340
Lineworker ↗ Q691225 EXACT TITLE
commercialdistributionenergygroundindustrialmaintainwork
SHARED TOKENS (7): "commercial", "distribution", "energy", "ground", "industrial", "maintain", "work". | EXACT TITLE in energy_utilities: "Lineworker".
0.340
environmentalfoodformmaintainphysicalwaterwork
SHARED TOKENS (7): "environmental", "food", "form", "maintain", "physical", "water", "work". | EXACT TITLE in energy_utilities: "Drinking water".
0.340
commercialdistributionindustrialnetworksupplysystemwater
SHARED TOKENS (7): "commercial", "distribution", "industrial", "network", "supply", "system", "water". | EXACT TITLE in energy_utilities: "Water distribution system".
0.340
civilfinaljurisdictionlawlegalreviewsingle
SHARED TOKENS (7): "civil", "final", "jurisdiction", "law", "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.340
enforcementformgroundwaterindustrialmunicipaloperationswater
SHARED TOKENS (7): "enforcement", "form", "groundwater", "industrial", "municipal", "operations", "water". | EXACT TITLE in energy_utilities: "Industrial waste".
0.320
Pro bono ↗ Q127537 EXACT TITLE
communitylegalprofessionalpublicspecialistwork
SHARED TOKENS (6): "community", "legal", "professional", "public", "specialist", "work". | EXACT TITLE in legal: "Pro bono".
0.320
cannotlegalmedicalprofessionalstandardstandards
SHARED TOKENS (6): "cannot", "legal", "medical", "professional", "standard", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.320
organizationorganizationspublicregulatorysystemwater
SHARED TOKENS (6): "organization", "organizations", "public", "regulatory", "system", "water". | EXACT TITLE in energy_utilities: "Public water system".
0.320
Annexation ↗ Q194465 EXACT TITLE
annexationlawlegalphysicalterritorytitle
SHARED TOKENS (6): "annexation", "law", "legal", "physical", "territory", "title". | EXACT TITLE in legal: "Annexation". | EXACT TITLE in energy_utilities: "Annexation".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahoriversnakewestern
SHARED TOKENS (6): "agricultural", "boise", "idaho", "river", "snake", "western". | EXACT TITLE in energy_utilities: "Boise River".
0.300
Project finance ↗ KW CROSS HIGH
addressagreementsallocationamongassetsassociatedcomplexconstructioncorporatedevelopmententityenvironmentalfinancefinancialfinancingflowindustrialinstitutionsmarketsowned
SHARED TOKENS (26): "address", "agreements", "allocation", "among", "assets", "associated", "complex", "construction", "corporate", "development", "entity", "environmental", "finance", "financial", "financing", "flow", "industrial", "institutions", "markets", "owned"....
0.300
americanamongassociationauthorityconstructiondepartmentfederalfundirrigationlandlawmaintenancemeridiannationalnearlyorganizationprogramprojectprojectspublic
SHARED TOKENS (28): "american", "among", "association", "authority", "construction", "department", "federal", "fund", "irrigation", "land", "law", "maintenance", "meridian", "national", "nearly", "organization", "program", "project", "projects", "public"....
0.300
adaboisecanyoncountieshomeidaholargestmainmeridiannampanearlynorthwestpopulationtreasurevalley
SHARED TOKENS (15): "ada", "boise", "canyon", "counties", "home", "idaho", "largest", "main", "meridian", "nampa", "nearly", "northwest", "population", "treasure", "valley".
0.300
Adoption ↗ Q180472 EXACT TITLE
adoptiongovernedlegalrequiresrights
SHARED TOKENS (5): "adoption", "governed", "legal", "requires", "rights". | EXACT TITLE in legal: "Adoption". | EXACT TITLE in energy_utilities: "Adoption".
0.300
amonglawlegallevelpresence
SHARED TOKENS (5): "among", "law", "legal", "level", "presence". | EXACT TITLE in legal: "Manslaughter".
0.300
adjudicationadministrativeagencieschangescivileducationenforcementenvironmentenvironmentalitselflawlegalorderspublicregulatereviewsectorsystemtrade
SHARED TOKENS (19): "adjudication", "administrative", "agencies", "changes", "civil", "education", "enforcement", "environment", "environmental", "itself", "law", "legal", "orders", "public", "regulate", "review", "sector", "system", "trade".
0.300
annualbusinesscompletedebtdevelopmententityfinancefinancialfinancingfirmsformfundgrowthhistoryinstitutionalmarketmarketsoperatingoperationsowned
SHARED TOKENS (26): "annual", "business", "complete", "debt", "development", "entity", "finance", "financial", "financing", "firms", "form", "fund", "growth", "history", "institutional", "market", "markets", "operating", "operations", "owned"....
0.300
agreementsbenefitschangescompensationemploymentgrouporganizationreachregulaterightssafetysingletradetrainingunionwageworkworkers
SHARED TOKENS (18): "agreements", "benefits", "changes", "compensation", "employment", "group", "organization", "reach", "regulate", "rights", "safety", "single", "trade", "training", "union", "wage", "work", "workers".
0.300
agriculturalcontractorsdomesticfederalformationindependentlaborlawnationalorganizationpowerrelationsrightsectortradeworkers
SHARED TOKENS (16): "agricultural", "contractors", "domestic", "federal", "formation", "independent", "labor", "law", "national", "organization", "power", "relations", "right", "sector", "trade", "workers".
0.300
developmentenergyformlevellocalmainmarketnaturalreportrequiressafetysetstandardsupplyvolumewater
SHARED TOKENS (16): "development", "energy", "form", "level", "local", "main", "market", "natural", "report", "requires", "safety", "set", "standard", "supply", "volume", "water".
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionaldemanddistributionenergyfinancialfinancinggrowthhistorylandlargemainnearlyneedsnetpowerprogramprojectsqualityrequiresresources
SHARED TOKENS (24): "additional", "demand", "distribution", "energy", "financial", "financing", "growth", "history", "land", "large", "main", "nearly", "needs", "net", "power", "program", "projects", "quality", "requires", "resources"....
0.300
administrativeassociationcivilclassformgrouplawlegallifemainnaturalorganizationsphysicalprotectionrelationsrightrightssafetysystem
SHARED TOKENS (19): "administrative", "association", "civil", "class", "form", "group", "law", "legal", "life", "main", "natural", "organizations", "physical", "protection", "relations", "right", "rights", "safety", "system".
0.300
americanassociationauthoritychangescommunitydevelopmentdistrictsenvironmentallandland-usenaturalneedsphysicalplanningprojectregionalregulateregulationresourceswater
SHARED TOKENS (20): "american", "association", "authority", "changes", "community", "development", "districts", "environmental", "land", "land-use", "natural", "needs", "physical", "planning", "project", "regional", "regulate", "regulation", "resources", "water".
0.300
consumerdemanddevelopmentenergyenvironmentalformlargelifemainpowerratesafetytechnologywaterwork
SHARED TOKENS (15): "consumer", "demand", "development", "energy", "environmental", "form", "large", "life", "main", "power", "rate", "safety", "technology", "water", "work".
0.300
agreementsconditionemploymentfallsfederalfeelaborlawlocalpublicrightsectorsetunionwork
SHARED TOKENS (15): "agreements", "condition", "employment", "falls", "federal", "fee", "labor", "law", "local", "public", "right", "sector", "set", "union", "work".
0.300
amongcommunityemploymentenergyindustrylargestlocaloldestplanspowerprojectscalesetsouthwestsystemunionworld
SHARED TOKENS (17): "among", "community", "employment", "energy", "industry", "largest", "local", "oldest", "plans", "power", "project", "scale", "set", "southwest", "system", "union", "world".
0.300
activeamericancasescivilcommunityfallgrouplawoldestpermitspublicrequiresrightrightsworld
SHARED TOKENS (15): "active", "american", "cases", "civil", "community", "fall", "group", "law", "oldest", "permits", "public", "requires", "right", "rights", "world".
0.300
amongcomplexconstructiondemandenergyenvironmentallandlargelargestnaturalnearlypopulationpowerproducesriversupplyworld
SHARED TOKENS (17): "among", "complex", "construction", "demand", "energy", "environmental", "land", "large", "largest", "natural", "nearly", "population", "power", "produces", "river", "supply", "world".
0.300
Sewage treatment ↗ KW CROSS HIGH
constructiondemandenergyenvironmentindustriallandlargelevelmainmunicipalnetworkoperatingpopulationprimaryqualityratestechnologywaterworld
SHARED TOKENS (19): "construction", "demand", "energy", "environment", "industrial", "land", "large", "level", "main", "municipal", "network", "operating", "population", "primary", "quality", "rates", "technology", "water", "world".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationcasescivilcompletecorporatedepartmenteducationfederallawlegallicensednationalofficeprofessionalpropertypublicqualifying
SHARED TOKENS (24): "additional", "alongside", "american", "association", "cases", "civil", "complete", "corporate", "department", "education", "federal", "law", "legal", "licensed", "national", "office", "professional", "property", "public", "qualifying"....
0.300
agenciescivilconstructiondepartmentsenvironmentfirmsmaintenancemunicipalnationalphysicalprofessionalpublicsectorstructuralworks
SHARED TOKENS (15): "agencies", "civil", "construction", "departments", "environment", "firms", "maintenance", "municipal", "national", "physical", "professional", "public", "sector", "structural", "works".
0.300
agricultureamericanandersonboiseconstructionfallshomeidahoirrigationlaborlawlevelnationalpowerprimaryprojectsresourceresultingriverwater
SHARED TOKENS (23): "agriculture", "american", "anderson", "boise", "construction", "falls", "home", "idaho", "irrigation", "labor", "law", "level", "national", "power", "primary", "projects", "resource", "resulting", "river", "water"....
0.300
authoritybusinesscommunityconsumerenergyformfundgovernedgrowthlargelocalmarketsnationaloperatingpowerpublicservedsetsupplysupport
SHARED TOKENS (22): "authority", "business", "community", "consumer", "energy", "form", "fund", "governed", "growth", "large", "local", "markets", "national", "operating", "power", "public", "served", "set", "supply", "support"....
0.300
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasescodecontractorsemploymentgovernlaborlawregulatoryrightsstandardstradeunionworkworkers
SHARED TOKENS (15): "agencies", "cases", "code", "contractors", "employment", "govern", "labor", "law", "regulatory", "rights", "standards", "trade", "union", "work", "workers".
0.300
agreementsamongassociationsbusinesscasescompetitivefirmindustrylaborlawlegalmarketmarketssectorsupportsystemtradeworkers
SHARED TOKENS (18): "agreements", "among", "associations", "business", "cases", "competitive", "firm", "industry", "labor", "law", "legal", "market", "markets", "sector", "support", "system", "trade", "workers".
0.300
agriculturalagriculturedistributionenvironmentalgroundwaterindustrialindustryirrigationmunicipalnaturalneedsreachstandardssupplysurfacesystemwaterworld
SHARED TOKENS (18): "agricultural", "agriculture", "distribution", "environmental", "groundwater", "industrial", "industry", "irrigation", "municipal", "natural", "needs", "reach", "standards", "supply", "surface", "system", "water", "world".
0.300
americanappliescivileducationfederalitselfjurisdictionlargelawlocalprimaryprotectionrequiresrightrights
SHARED TOKENS (15): "american", "applies", "civil", "education", "federal", "itself", "jurisdiction", "large", "law", "local", "primary", "protection", "requires", "right", "rights".
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
codedemanddistributionenergyfinancingfullhomeindustrymunicipalnamenetworkorganizedpermitspowerprotectionrepresentsresourcessectorsupplysystem
SHARED TOKENS (22): "code", "demand", "distribution", "energy", "financing", "full", "home", "industry", "municipal", "name", "network", "organized", "permits", "power", "protection", "represents", "resources", "sector", "supply", "system"....
0.300
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsassociatedenforcementjurisdictionlegalofficeownersprimarypropertyprotectionregistrationrightsstandardstradeunion
SHARED TOKENS (16): "agencies", "agreements", "associated", "enforcement", "jurisdiction", "legal", "office", "owners", "primary", "property", "protection", "registration", "rights", "standards", "trade", "union".
0.300
Combined sewer ↗ Q361472 KW CROSS HIGH
collectionconstructionenvironmentaleventsexpandingexperienceflowgreengroundindustrialirrigationlargerateresultingsupportsurfacesystemwater
SHARED TOKENS (18): "collection", "construction", "environmental", "events", "expanding", "experience", "flow", "green", "ground", "industrial", "irrigation", "large", "rate", "resulting", "support", "surface", "system", "water".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationcannotcompletecontractorsdebtfeefeeslawlegalprincipalpropertyrealrightstatutorytitle
SHARED TOKENS (15): "association", "cannot", "complete", "contractors", "debt", "fee", "fees", "law", "legal", "principal", "property", "real", "right", "statutory", "title".
0.300
associationconstructioncontractorsdataindustryjointlabornationalpublicrepresentstradetrainingunionworkworkers
SHARED TOKENS (15): "association", "construction", "contractors", "data", "industry", "joint", "labor", "national", "public", "represents", "trade", "training", "union", "work", "workers".
0.300
associationbusinesscorporatecorporationcorporationsentityformgovernedlegallicensemedicaloperatingoperationsorganizationorganizedownersphysicalprimaryprofessionalrights
SHARED TOKENS (21): "association", "business", "corporate", "corporation", "corporations", "entity", "form", "governed", "legal", "license", "medical", "operating", "operations", "organization", "organized", "owners", "physical", "primary", "professional", "rights"....
0.300
activecannotcaseschaptercodedistrictdistrictsfederalgovernitselfjurisdictionproceedingproceedingssystemwest
SHARED TOKENS (15): "active", "cannot", "cases", "chapter", "code", "district", "districts", "federal", "govern", "itself", "jurisdiction", "proceeding", "proceedings", "system", "west".
0.300
amongassociationboisecanyoncountiesfederalformationidaholargestlevellocalnampanationalofficeprojectprojectsriversetsnakesouthwest
SHARED TOKENS (25): "among", "association", "boise", "canyon", "counties", "federal", "formation", "idaho", "largest", "level", "local", "nampa", "national", "office", "project", "projects", "river", "set", "snake", "southwest"....
0.300
activeadministrativeagenciesannualcasesdistrictfederalfinaljurisdictionlargelawlegalnationalorganizedpopulationreviewsetsystemwest
SHARED TOKENS (19): "active", "administrative", "agencies", "annual", "cases", "district", "federal", "final", "jurisdiction", "large", "law", "legal", "national", "organized", "population", "review", "set", "system", "west".
0.300
knowledgelegalmigrationnationalorganization
SHARED TOKENS (5): "knowledge", "legal", "migration", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
associationassociationsbusinesscasesjurisdictionlawlegalorganizationsorganizedphysicalprofessionalpublicregulationresponsibleseparateserving
SHARED TOKENS (16): "association", "associations", "business", "cases", "jurisdiction", "law", "legal", "organizations", "organized", "physical", "professional", "public", "regulation", "responsible", "separate", "serving".
0.300
businesscasescommercialestatefeefinancialformindependentinstitutionallandlargelawlegallifenearlyoutsidepropertyraterealregistration
SHARED TOKENS (22): "business", "cases", "commercial", "estate", "fee", "financial", "form", "independent", "institutional", "land", "large", "law", "legal", "life", "nearly", "outside", "property", "rate", "real", "registration"....
0.300
departmenteducationenergyenforcementenvironmentalfederalfinancialindependentjanuarylegallevellocalnationalprotectionpublicregionalspecialistsstandardstribalworks
SHARED TOKENS (20): "department", "education", "energy", "enforcement", "environmental", "federal", "financial", "independent", "january", "legal", "level", "local", "national", "protection", "public", "regional", "specialists", "standards", "tribal", "works".
0.300
adaboiseconstructionfederalfullidahoirrigationleveloperatingpowerprimaryriversnakesouthernwestern
SHARED TOKENS (15): "ada", "boise", "construction", "federal", "full", "idaho", "irrigation", "level", "operating", "power", "primary", "river", "snake", "southern", "western".
0.300
boisecanyoncomplexcontractorenergyfallsfinalidaholargestlevelownedpowerprojectriversnakewestern
SHARED TOKENS (16): "boise", "canyon", "complex", "contractor", "energy", "falls", "final", "idaho", "largest", "level", "owned", "power", "project", "river", "snake", "western".
0.300
Water metering ↗ Q268503 KW CROSS HIGH
americanassociationcommercialflowoutsidepublicratessetstandardssupplysystemtechnologyvolumewaterworksworld
SHARED TOKENS (16): "american", "association", "commercial", "flow", "outside", "public", "rates", "set", "standards", "supply", "system", "technology", "volume", "water", "works", "world".
0.300
associatedcodecommissiondistributionenvironmentallargelocalnationaloperatingpropertyprotectionsafetysetstandardssystem
SHARED TOKENS (15): "associated", "code", "commission", "distribution", "environmental", "large", "local", "national", "operating", "property", "protection", "safety", "set", "standards", "system".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
authoritychargescodeconstructiondepartmentsdevelopersdistrictenvironmentalestatejurisdictionlawlevellocalmainnationalplanningpublicrealregulatesafety
SHARED TOKENS (23): "authority", "charges", "code", "construction", "departments", "developers", "district", "environmental", "estate", "jurisdiction", "law", "level", "local", "main", "national", "planning", "public", "real", "regulate", "safety"....
0.300
addressemploymentenforcementfinancialinstitutionslaworganizationorganizationsprotectionpublicregulatereportresourcessectorwork
SHARED TOKENS (15): "address", "employment", "enforcement", "financial", "institutions", "law", "organization", "organizations", "protection", "public", "regulate", "report", "resources", "sector", "work".
0.300
adoptionauthoritycasescodeconsumerdistrictfederalgovernedgovernsjurisdictionlawpropertyprotectionrightstitle
SHARED TOKENS (15): "adoption", "authority", "cases", "code", "consumer", "district", "federal", "governed", "governs", "jurisdiction", "law", "property", "protection", "rights", "title".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
benefitsdatadatefinancialfulllargestlevellicensenameofficeprogramrecordsreportresourcesresponsibletechnologyuniversity
SHARED TOKENS (17): "benefits", "data", "date", "financial", "full", "largest", "level", "license", "name", "office", "program", "records", "report", "resources", "responsible", "technology", "university".
0.300
boisecanaldistrictidahoirrigationnamenampanationalprogramprojectriversettreasurevalleywaterwestern
SHARED TOKENS (16): "boise", "canal", "district", "idaho", "irrigation", "name", "nampa", "national", "program", "project", "river", "set", "treasure", "valley", "water", "western".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
administrativeamericananalysisassociationbusinesscasescorporationdepartmentseducationentityenvironmentexperienceexpertisefullknowledgelaborlawlegallevellicense
SHARED TOKENS (37): "administrative", "american", "analysis", "association", "business", "cases", "corporation", "departments", "education", "entity", "environment", "experience", "expertise", "full", "knowledge", "labor", "law", "legal", "level", "license"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturecommercialcommunityenergyinstitutionalirrigationlargepublicqualityregulationscaleseparatesupplysystemwaterworld
SHARED TOKENS (16): "agriculture", "commercial", "community", "energy", "institutional", "irrigation", "large", "public", "quality", "regulation", "scale", "separate", "supply", "system", "water", "world".
🫐 BERRY136 edges
0.280
demanddistrictenergyformfullgrowthlawmethodologyplanningpowerpublicrequiresresourcesupply
SHARED TOKENS (14): "demand", "district", "energy", "form", "full", "growth", "law", "methodology", "planning", "power", "public", "requires", "resource", "supply".
0.280
Felony ↗ Q178844 EXACT TITLE
additionalcivillandlaw
SHARED TOKENS (4): "additional", "civil", "land", "law". | EXACT TITLE in legal: "Felony".
0.280
firmfirmsformindustrylargelargestmarketnaturalpublicregulationscalesinglesupplywater
SHARED TOKENS (14): "firm", "firms", "form", "industry", "large", "largest", "market", "natural", "public", "regulation", "scale", "single", "supply", "water".
0.280
distributioneasternenergyformindustrylevellocalmarketnetworkownedpowerregulationseparatewestern
SHARED TOKENS (14): "distribution", "eastern", "energy", "form", "industry", "level", "local", "market", "network", "owned", "power", "regulation", "separate", "western".
0.280
agreementsbusinesscannotcasescommunitycompensationemploymenteventsknowledgelawlegalprogramsingletrade
SHARED TOKENS (14): "agreements", "business", "cannot", "cases", "community", "compensation", "employment", "events", "knowledge", "law", "legal", "program", "single", "trade".
0.280
additionalagriculturaldepartmentdistrictenergyformationindustrialindustryneedspowerrateresourcessupplywater
SHARED TOKENS (14): "additional", "agricultural", "department", "district", "energy", "formation", "industrial", "industry", "needs", "power", "rate", "resources", "supply", "water".
0.280
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesconditionlandlawlegalnaturalpowerproceedingsrightsstatutorytrade
SHARED TOKENS (14): "administrative", "agencies", "american", "applies", "condition", "land", "law", "legal", "natural", "power", "proceedings", "rights", "statutory", "trade".
0.280
boisecascadedistrictshomeidaholandmaintainnationalrecreationresourcesriversustainedwaterwest
SHARED TOKENS (14): "boise", "cascade", "districts", "home", "idaho", "land", "maintain", "national", "recreation", "resources", "river", "sustained", "water", "west".
0.280
agenciesauthorityfoodhealthcareindependentjurisdictionlicensingmarketsofficeregulationregulatoryresponsiblesafetystandards
SHARED TOKENS (14): "agencies", "authority", "food", "healthcare", "independent", "jurisdiction", "licensing", "markets", "office", "regulation", "regulatory", "responsible", "safety", "standards".
0.280
agreementscommunityfoodformlawlegalnationalorganizationspowerprotectionpublicrightrightstrade
SHARED TOKENS (14): "agreements", "community", "food", "form", "law", "legal", "national", "organizations", "power", "protection", "public", "right", "rights", "trade".
0.280
appliescompensationfederallawlevellifelocalmainpropertyprotectionpublicrequiresrightrights
SHARED TOKENS (14): "applies", "compensation", "federal", "law", "level", "life", "local", "main", "property", "protection", "public", "requires", "right", "rights".
0.260
Reservoir ↗ Q131681 EXACT TITLE
formpowerwater
SHARED TOKENS (3): "form", "power", "water". | EXACT TITLE in energy_utilities: "Reservoir".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
agenciesauthoritycommissioncommissionersfederalfinancialindustrylawlevelorganizationsprimaryregulationregulatory
SHARED TOKENS (13): "agencies", "authority", "commission", "commissioners", "federal", "financial", "industry", "law", "level", "organizations", "primary", "regulation", "regulatory".
0.260
Energy conservation ↗ KW CROSS HIGH
complexenergyenvironmentalformgreengrowthlargelifemaintenanceoperationsprofilescalewater
SHARED TOKENS (13): "complex", "energy", "environmental", "form", "green", "growth", "large", "life", "maintenance", "operations", "profile", "scale", "water".
0.260
businesscommercialdevelopmentfinancialfundhistoryindependentinstitutionsnameorganizationsownersprojectprojects
SHARED TOKENS (13): "business", "commercial", "development", "financial", "fund", "history", "independent", "institutions", "name", "organizations", "owners", "project", "projects".
0.260
Family law ↗ Q384014 EXACT TITLE
domesticlawrelations
SHARED TOKENS (3): "domestic", "law", "relations". | EXACT TITLE in legal: "Family law".
0.260
Solar power ↗ Q1483757 KW CROSS HIGH
commercialcontinuingenergyfinancingintegrationlargelargestpowerprimaryproducesregulationsinglesystem
SHARED TOKENS (13): "commercial", "continuing", "energy", "financing", "integration", "large", "largest", "power", "primary", "produces", "regulation", "single", "system".
0.260
activedemandenergyformfullgrouplargelargestoperatingpowersystemtechnologyworld
SHARED TOKENS (13): "active", "demand", "energy", "form", "full", "group", "large", "largest", "operating", "power", "system", "technology", "world".
0.260
constructiondevelopersdevelopmentenvironmentalgroundwaterindustrylandmunicipalphysicalprogramprojectsregulatorystandards
SHARED TOKENS (13): "construction", "developers", "development", "environmental", "groundwater", "industry", "land", "municipal", "physical", "program", "projects", "regulatory", "standards".
0.260
activeadministrativeamericancasesdistrictdistrictseasternfederalidahojurisdictionlargestsouthernwestern
SHARED TOKENS (13): "active", "administrative", "american", "cases", "district", "districts", "eastern", "federal", "idaho", "jurisdiction", "largest", "southern", "western".
0.260
constructionriverwater
SHARED TOKENS (3): "construction", "river", "water". | EXACT TITLE in energy_utilities: "Sediment control".
0.260
analysiscommercialenergyenvironmentformindustriallargelifenetpowerreachscalesystem
SHARED TOKENS (13): "analysis", "commercial", "energy", "environment", "form", "industrial", "large", "life", "net", "power", "reach", "scale", "system".
0.260
associateddepartmentsenvironmentfinancialnationalorganizationspropertyrateratesstreetsustainedtrafficunion
SHARED TOKENS (13): "associated", "departments", "environment", "financial", "national", "organizations", "property", "rate", "rates", "street", "sustained", "traffic", "union".
0.260
analysisassociatedcivilfulljurisdictionlawlegalnamesproceedingspropertyrequiressetstatutory
SHARED TOKENS (13): "analysis", "associated", "civil", "full", "jurisdiction", "law", "legal", "names", "proceedings", "property", "requires", "set", "statutory".
0.260
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycaseschargescivilfinallawlegallocalpublicresourcesservesstandards
SHARED TOKENS (13): "agreements", "authority", "cases", "charges", "civil", "final", "law", "legal", "local", "public", "resources", "serves", "standards".
0.260
Grand jury ↗ Q1323789 KW CROSS HIGH
caseschargescivilindependentjurisdictionlargelawlegalphysicalproceedingspublicreviewseparate
SHARED TOKENS (13): "cases", "charges", "civil", "independent", "jurisdiction", "large", "law", "legal", "physical", "proceedings", "public", "review", "separate".
0.260
caseslawlegal
SHARED TOKENS (3): "cases", "law", "legal". | EXACT TITLE in energy_utilities: "Settlement (litigation)".
0.260
beyonddemandenergyexperienceflowformgreenlargelargestpowerscalesetsupply
SHARED TOKENS (13): "beyond", "demand", "energy", "experience", "flow", "form", "green", "large", "largest", "power", "scale", "set", "supply".
0.240
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturedevelopmentenvironmentenvironmentalgrowthindustrialmainprogramresultingriversurfacewater
SHARED TOKENS (12): "agriculture", "development", "environment", "environmental", "growth", "industrial", "main", "program", "resulting", "river", "surface", "water".
0.240
additionaldepartmentdevelopmentenergyfederalnationalphysicalpowerprogramprojectservedsystem
SHARED TOKENS (12): "additional", "department", "development", "energy", "federal", "national", "physical", "power", "program", "project", "served", "system".
0.240
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialcompetitivelegallicensedmaintainpropertyregistrationtrade
SHARED TOKENS (12): "agreements", "among", "assets", "business", "commercial", "competitive", "legal", "licensed", "maintain", "property", "registration", "trade".
0.240
amongannualchangesfallfirmgrouphistorylegaloutsideprogramratesworld
SHARED TOKENS (12): "among", "annual", "changes", "fall", "firm", "group", "history", "legal", "outside", "program", "rates", "world".
0.240
adabusinesschangescivilfinaljanuarylawnationalprotectionpublicrequiresrights
SHARED TOKENS (12): "ada", "business", "changes", "civil", "final", "january", "law", "national", "protection", "public", "requires", "rights".
0.240
Overtime ↗ Q667022 KW CROSS HIGH
beyondemploymentlawlevelnationalrateratessupplytradeworkworkersworks
SHARED TOKENS (12): "beyond", "employment", "law", "level", "national", "rate", "rates", "supply", "trade", "work", "workers", "works".
0.240
chaptercodedebtfinancialformplanspowerprioritypropertyprotectionstatutorytitle
SHARED TOKENS (12): "chapter", "code", "debt", "financial", "form", "plans", "power", "priority", "property", "protection", "statutory", "title".
0.240
agenciesauthorityenvironmentenvironmentalfederalfinaljanuarylawnationalqualityrequiresworld
SHARED TOKENS (12): "agencies", "authority", "environment", "environmental", "federal", "final", "january", "law", "national", "quality", "requires", "world".
0.240
Road transport ↗ KW CROSS HIGH
developmentfoodfulllargelicensinglocalsafetyseparatespecialiststandardtrafficvolume
SHARED TOKENS (12): "development", "food", "full", "large", "licensing", "local", "safety", "separate", "specialist", "standard", "traffic", "volume".
0.220
complexdistributionenergylargemarketsnearlynetworkpopulationpowertechnologyworld
SHARED TOKENS (11): "complex", "distribution", "energy", "large", "markets", "nearly", "network", "population", "power", "technology", "world".
0.220
Civil liberties ↗ Q29556 KW CROSS HIGH
authoritycivilexpandinglawlifepowerpropertyprotectionrightrightswork
SHARED TOKENS (11): "authority", "civil", "expanding", "law", "life", "power", "property", "protection", "right", "rights", "work".
0.220
Attorney ↗ Q1289214 EXACT TITLE
lawpower
SHARED TOKENS (2): "law", "power". | EXACT TITLE in legal: "Attorney".
0.220
addressfederalhistorylawlegallocalmainphysicalpropertyrightssearch
SHARED TOKENS (11): "address", "federal", "history", "law", "legal", "local", "main", "physical", "property", "rights", "search".
0.220
chargescodeemploymentenvironmentformlegalorganizationsphysicalprofessionalrelationshipswork
SHARED TOKENS (11): "charges", "code", "employment", "environment", "form", "legal", "organizations", "physical", "professional", "relationships", "work".
0.220
civillaw
SHARED TOKENS (2): "civil", "law". | EXACT TITLE in energy_utilities: "Discovery (law)".
0.220
additionaladministereddepartmentdomesticlaborlawmedicalpublicwageworkworkers
SHARED TOKENS (11): "additional", "administered", "department", "domestic", "labor", "law", "medical", "public", "wage", "work", "workers".
0.220
amongassociationdevelopmentdistributionenergynationalnaturalpowerrelationsresourcesworld
SHARED TOKENS (11): "among", "association", "development", "distribution", "energy", "national", "natural", "power", "relations", "resources", "world".
0.220
changesdemandenergyfulllargenetpowerrateratessupplysystem
SHARED TOKENS (11): "changes", "demand", "energy", "full", "large", "net", "power", "rate", "rates", "supply", "system".
0.220
Probation ↗ Q13961 KW CROSS HIGH
appliescommunitycontactdomesticjurisdictionlawmaintainorderspermitprogramset
SHARED TOKENS (11): "applies", "community", "contact", "domestic", "jurisdiction", "law", "maintain", "orders", "permit", "program", "set".
0.220
Off-the-grid ↗ Q267162 KW CROSS HIGH
cannotenergyenvironmentalfoodindependentitselfpublicreachscalesupplywater
SHARED TOKENS (11): "cannot", "energy", "environmental", "food", "independent", "itself", "public", "reach", "scale", "supply", "water".
0.220
Probate court ↗ Q7246899 KW CROSS HIGH
assetsauthoritycasescountiesdistributiondistrictestatejurisdictionlawpropertystatutory
SHARED TOKENS (11): "assets", "authority", "cases", "counties", "distribution", "district", "estate", "jurisdiction", "law", "property", "statutory".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in legal: "Subdivision". | EXACT TITLE in energy_utilities: "Subdivision".
0.210
Paternity ↗ Q16881001 EXACT TITLE
law
SHARED TOKENS (1): "law". | EXACT TITLE in legal: "Paternity".
0.200
amongcorporationeasternlandlaworganizedpropertyrightssystemwater
SHARED TOKENS (10): "among", "corporation", "eastern", "land", "law", "organized", "property", "rights", "system", "water".
0.200
adaboiseidahomainmunicipalnamenearlypopulationseparatestreet
SHARED TOKENS (10): "ada", "boise", "idaho", "main", "municipal", "name", "nearly", "population", "separate", "street".
0.200
Family court ↗ Q82749 KW CROSS HIGH
addresscaseschangesdomesticlawlegalordersrelationshipssupportsystem
SHARED TOKENS (10): "address", "cases", "changes", "domestic", "law", "legal", "orders", "relationships", "support", "system".
0.200
Utility pole ↗ Q1144084 KW CROSS HIGH
distributiongroundlargepowerpublicsafetystreetsupportsystemwestern
SHARED TOKENS (10): "distribution", "ground", "large", "power", "public", "safety", "street", "support", "system", "western".
0.200
changescommercialflowformnetworkpowersystemtechnologyunionworld
SHARED TOKENS (10): "changes", "commercial", "flow", "form", "network", "power", "system", "technology", "union", "world".
0.200
casescivilenforcementformlawlegalpropertypublicrightsearch
SHARED TOKENS (10): "cases", "civil", "enforcement", "form", "law", "legal", "property", "public", "right", "search".
0.200
EXACT TITLE in energy_utilities: "Suez (disambiguation)".
0.200
consumercriticaldemanddevelopmentindustrynetworkpowerpublicrealsupply
SHARED TOKENS (10): "consumer", "critical", "demand", "development", "industry", "network", "power", "public", "real", "supply".
0.200
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerdebtentityfirmfulllawlegalpriorityrequires
SHARED TOKENS (10): "agreements", "consumer", "debt", "entity", "firm", "full", "law", "legal", "priority", "requires".
0.200
addresscivilcommercialgovernedlawlegalpropertyrealrightssales
SHARED TOKENS (10): "address", "civil", "commercial", "governed", "law", "legal", "property", "real", "rights", "sales".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will".
0.200
energyenvironmentalgreenmaintenanceoperatingprojectsqualityregulatetechnologywater
SHARED TOKENS (10): "energy", "environmental", "green", "maintenance", "operating", "projects", "quality", "regulate", "technology", "water".
0.200
Beneficiary ↗ Q2596417 KW CROSS HIGH
assetsbenefitsdevelopmententityfinancelawlegallifeprimaryprojects
SHARED TOKENS (10): "assets", "benefits", "development", "entity", "finance", "law", "legal", "life", "primary", "projects".
0.200
civilirrigationlandlawlegalpowerresponsiblestandardsystemwater
SHARED TOKENS (10): "civil", "irrigation", "land", "law", "legal", "power", "responsible", "standard", "system", "water".
0.200
appliescannotcasesformfulllawordersrealstandardsupport
SHARED TOKENS (10): "applies", "cannot", "cases", "form", "full", "law", "orders", "real", "standard", "support".
0.180
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotcriticallegallifemedicalprofessionalpropertypublic
SHARED TOKENS (9): "authority", "cannot", "critical", "legal", "life", "medical", "professional", "property", "public".
0.180
Black start ↗ Q655257 KW CROSS HIGH
complexenergyindustriallargemainnetworkpowerrequirestechnology
SHARED TOKENS (9): "complex", "energy", "industrial", "large", "main", "network", "power", "requires", "technology".
0.180
appliescasescommunitydistrictlevelpublicrequiresrightrights
SHARED TOKENS (9): "applies", "cases", "community", "district", "level", "public", "requires", "right", "rights".
0.180
americanamongcannotcaseslegalproceedingspublicrightsystem
SHARED TOKENS (9): "american", "among", "cannot", "cases", "legal", "proceedings", "public", "right", "system".
0.180
Expungement ↗ Q2352928 KW CROSS HIGH
enforcementfederaljurisdictionlawlegalproceedingspublicrecordsreview
SHARED TOKENS (9): "enforcement", "federal", "jurisdiction", "law", "legal", "proceedings", "public", "records", "review".
0.180
Deed ↗ Q705914 KW CROSS HIGH
associatedlawlegallicensespropertyrightrightsspecialtytitle
SHARED TOKENS (9): "associated", "law", "legal", "licenses", "property", "right", "rights", "specialty", "title".
0.180
agenciesappliesassociationcasescivilfinancerightrightsschool
SHARED TOKENS (9): "agencies", "applies", "association", "cases", "civil", "finance", "right", "rights", "school".
0.180
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasesdomesticenforcementlawpermitsphysicalprotectionset
SHARED TOKENS (9): "agencies", "cases", "domestic", "enforcement", "law", "permits", "physical", "protection", "set".
0.180
commercialdistributionfinalgroundindustriallevelpowerprimarysystem
SHARED TOKENS (9): "commercial", "distribution", "final", "ground", "industrial", "level", "power", "primary", "system".
0.180
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesconditiondistributionestatejurisdictionlawpropertyresultingstatutory
SHARED TOKENS (9): "applies", "condition", "distribution", "estate", "jurisdiction", "law", "property", "resulting", "statutory".
0.180
Wind power ↗ Q43302 KW CROSS HIGH
energyenvironmentnearlyneedspowersouthernsupplyworkworld
SHARED TOKENS (9): "energy", "environment", "nearly", "needs", "power", "southern", "supply", "work", "world".
0.180
analysischangeseventslevelnaturalseparatesetstructuralwater
SHARED TOKENS (9): "analysis", "changes", "events", "level", "natural", "separate", "set", "structural", "water".
0.180
americanassociationidaholaborlifeownersservingunionwestern
SHARED TOKENS (9): "american", "association", "idaho", "labor", "life", "owners", "serving", "union", "western".
0.180
businessentitylegalnameownedownersseparatetradework
SHARED TOKENS (9): "business", "entity", "legal", "name", "owned", "owners", "separate", "trade", "work".
0.180
demanddistributionenergygrowthindustrypowerprimarysupplywater
SHARED TOKENS (9): "demand", "distribution", "energy", "growth", "industry", "power", "primary", "supply", "water".
0.180
administrativecannotcivilcommissionemploymentfederalnationalproceedingrights
SHARED TOKENS (9): "administrative", "cannot", "civil", "commission", "employment", "federal", "national", "proceeding", "rights".
0.180
completeformhealthcareitselfjurisdictionlegalmedicalpowersingle
SHARED TOKENS (9): "complete", "form", "healthcare", "itself", "jurisdiction", "legal", "medical", "power", "single".
0.180
Fraud ↗ Q28813 KW CROSS HIGH
benefitscasescivilcompensationitselflawlegalpropertyright
SHARED TOKENS (9): "benefits", "cases", "civil", "compensation", "itself", "law", "legal", "property", "right".
0.180
Lawsuit ↗ Q697327 KW CROSS HIGH
businesscivillawlegalordersorganizationsproceedingpublicright
SHARED TOKENS (9): "business", "civil", "law", "legal", "orders", "organizations", "proceeding", "public", "right".
0.180
departmentdevelopmentenergyhomeintegrationjointnamenationaltechnology
SHARED TOKENS (9): "department", "development", "energy", "home", "integration", "joint", "name", "national", "technology".
0.170
idahooffice
SHARED TOKENS (2): "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.160
knowledgelawlegalpowerpropertyrightsearchstandard
SHARED TOKENS (8): "knowledge", "law", "legal", "power", "property", "right", "search", "standard".
0.160
Net metering ↗ Q2685471 KW CROSS HIGH
annualenergyfeemonthlynetpowerrequiressingle
SHARED TOKENS (8): "annual", "energy", "fee", "monthly", "net", "power", "requires", "single".
0.160
Sex offender ↗ Q5659979 KW CROSS HIGH
civilcontinuingjurisdictionlawlegalpublicregistrationstatutory
SHARED TOKENS (8): "civil", "continuing", "jurisdiction", "law", "legal", "public", "registration", "statutory".
0.160
casescivildistrictdistrictsfederaljurisdictionlawresidents
SHARED TOKENS (8): "cases", "civil", "district", "districts", "federal", "jurisdiction", "law", "residents".
0.160
additionalcaseschargeshistorynationalrecordsresultingtraffic
SHARED TOKENS (8): "additional", "cases", "charges", "history", "national", "records", "resulting", "traffic".
0.160
cannotcaseslawlegalmainpublicratesystem
SHARED TOKENS (8): "cannot", "cases", "law", "legal", "main", "public", "rate", "system".
0.160
domesticmunicipalproducespropertypublicservedwesternworld
SHARED TOKENS (8): "domestic", "municipal", "produces", "property", "public", "served", "western", "world".
0.160
cannotenforcementknowledgelawproceedingsprotectionrightrights
SHARED TOKENS (8): "cannot", "enforcement", "knowledge", "law", "proceedings", "protection", "right", "rights".
0.160
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualbenefitscontractorsindependentlawwagework
SHARED TOKENS (8): "among", "annual", "benefits", "contractors", "independent", "law", "wage", "work".
0.160
distributionlargelawregulateregulationsetsystemvolume
SHARED TOKENS (8): "distribution", "large", "law", "regulate", "regulation", "set", "system", "volume".
0.160
agricultureconstructiondevelopmentlandpropertyriversurfacewater
SHARED TOKENS (8): "agriculture", "construction", "development", "land", "property", "river", "surface", "water".
0.160
commercialgroundwaterindustrialseparateservedservingsurfacesystem
SHARED TOKENS (8): "commercial", "groundwater", "industrial", "separate", "served", "serving", "surface", "system".
0.140
Criminal law ↗ Q146491 KW CROSS HIGH
civilcommissioncompensationjurisdictionlawpropertysafety
SHARED TOKENS (7): "civil", "commission", "compensation", "jurisdiction", "law", "property", "safety".
0.140
Tort ↗ Q158970 KW CROSS HIGH
civilcodelawlegalobligationsresultingseparate
SHARED TOKENS (7): "civil", "code", "law", "legal", "obligations", "resulting", "separate".
0.140
Parole ↗ Q5357120 KW CROSS HIGH
additionalassociatedformoutsideservedservingsystem
SHARED TOKENS (7): "additional", "associated", "form", "outside", "served", "serving", "system".
0.140
Magistrate ↗ Q4594605 KW CROSS HIGH
administerscasescivillawlocalresponsibleworld
SHARED TOKENS (7): "administers", "cases", "civil", "law", "local", "responsible", "world".
0.140
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbenefitsbusinesslegalqualitystandard
SHARED TOKENS (7): "applies", "assets", "benefits", "business", "legal", "quality", "standard".
0.140
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialcriticallocalnetworkpowerprotectionsystem
SHARED TOKENS (7): "commercial", "critical", "local", "network", "power", "protection", "system".
0.140
Damages ↗ Q308922 KW CROSS HIGH
compensationformlawlegalmedicalphysicalproperty
SHARED TOKENS (7): "compensation", "form", "law", "legal", "medical", "physical", "property".
0.140
distributionnationalnaturalpublicstreettrafficwater
SHARED TOKENS (7): "distribution", "national", "natural", "public", "street", "traffic", "water".
0.140
administrativefederallawlegalofficeproceedingsreview
SHARED TOKENS (7): "administrative", "federal", "law", "legal", "office", "proceedings", "review".
0.140
americanemploymentpermitprotectionrightsupportwork
SHARED TOKENS (7): "american", "employment", "permit", "protection", "right", "support", "work".
0.140
caseschangesflowlevelmaintainseparateset
SHARED TOKENS (7): "cases", "changes", "flow", "level", "maintain", "separate", "set".
0.140
businessfinancialformlawlegalpowerprincipal
SHARED TOKENS (7): "business", "financial", "form", "law", "legal", "power", "principal".
0.140
chaptercodefederalformgoverngovernstitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "govern", "governs", "title".
0.120
Escrow ↗ Q338451 KW CROSS HIGH
nameobligationsprimaryprincipalpropertytransaction
SHARED TOKENS (6): "name", "obligations", "primary", "principal", "property", "transaction".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahonearlypopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "nearly", "population".
0.120
Partnership ↗ Q728646 KW CROSS HIGH
businessgovernedorganizationorganizationspartnersreach
SHARED TOKENS (6): "business", "governed", "organization", "organizations", "partners", "reach".
0.120
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlawlegalpublicrights
SHARED TOKENS (6): "employment", "jurisdiction", "law", "legal", "public", "rights".
0.120
Septic tank ↗ Q386300 KW CROSS HIGH
domesticenvironmentgroundwaterprimaryratesystem
SHARED TOKENS (6): "domestic", "environment", "groundwater", "primary", "rate", "system".
0.120
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfinanciallawlegalmaintenancesupport
SHARED TOKENS (6): "agreements", "financial", "law", "legal", "maintenance", "support".
0.120
Bail ↗ Q162351 KW CROSS HIGH
additionalcaseschargesformpropertyset
SHARED TOKENS (6): "additional", "cases", "charges", "form", "property", "set".
0.120
Discrimination ↗ Q169207 KW CROSS HIGH
classgroupinstitutionslegalrightsworld
SHARED TOKENS (6): "class", "group", "institutions", "legal", "rights", "world".
0.120
Trial court ↗ Q3125101 KW CROSS HIGH
authoritycasesjurisdictionlawpowerreview
SHARED TOKENS (6): "authority", "cases", "jurisdiction", "law", "power", "review".
0.120
americancivillegalpublictradeunion
SHARED TOKENS (6): "american", "civil", "legal", "public", "trade", "union".
0.120
fulllawlegaloldestprofessionalright
SHARED TOKENS (6): "full", "law", "legal", "oldest", "professional", "right".
0.120
Legal clinic ↗ Q1351667 KW CROSS HIGH
experiencelawlegalprogramschoolwork
SHARED TOKENS (6): "experience", "law", "legal", "program", "school", "work".
0.100
distributionoperatingpowerqualitysupply
SHARED TOKENS (5): "distribution", "operating", "power", "quality", "supply".
0.100
authorityemploymentlawrightswage
SHARED TOKENS (5): "authority", "employment", "law", "rights", "wage".
0.100
codefoodmunicipalpublicunion
SHARED TOKENS (5): "code", "food", "municipal", "public", "union".
0.100
Drug court ↗ Q5308883 KW CROSS HIGH
addressenforcementlawpublicwork
SHARED TOKENS (5): "address", "enforcement", "law", "public", "work".
0.100
Executor ↗ Q654437 KW CROSS HIGH
estateformlawpropertyresponsible
SHARED TOKENS (5): "estate", "form", "law", "property", "responsible".
0.100
Deposition ↗ Q1174534 KW CROSS HIGH
authoritylawoutsidepoweruniversity
SHARED TOKENS (5): "authority", "law", "outside", "power", "university".
0.100
Injunction ↗ Q6495575 KW CROSS HIGH
civilformfulllawlegal
SHARED TOKENS (5): "civil", "form", "full", "law", "legal".
0.100
Power station ↗ Q159719 KW CROSS HIGH
energyindustrialnaturalpowerworld
SHARED TOKENS (5): "energy", "industrial", "natural", "power", "world".
0.100
formlawpropertypublicresponsible
SHARED TOKENS (5): "form", "law", "property", "public", "responsible".
0.100
energynetpowerproduceswork
SHARED TOKENS (5): "energy", "net", "power", "produces", "work".
0.100
civillawlegalresultingwork
SHARED TOKENS (5): "civil", "law", "legal", "resulting", "work".
◈ Frequently Asked Questions
Legal × Energy Utilities — Treasure Valley
HAIKU · HIGH GATE
How do prior-appropriation water rights affect energy utility operations in Ada County and Canyon County?
Prior-appropriation water rights govern the Snake River and aquifer withdrawals that energy utilities in Boise, Nampa, and Caldwell depend on for hydroelectric generation and cooling systems. Utilities must hold valid water rights under Idaho law to legally access groundwater and surface water allocations, which irrigation districts in Ada County and Canyon County also claim under the same priority system. When water availability declines, utilities face legal constraints that can limit power generation capacity.
What legal compliance do energy utilities in the Treasure Valley face under the Clean Water Act?
Energy utilities operating in Boise, Nampa, and Caldwell must comply with Clean Water Act discharge permits for wastewater returned to the Snake River and groundwater systems. Ada County and Canyon County regulatory authorities enforce these standards to protect aquifer quality and surface water used by both utilities and irrigation districts. Violations can result in legal liability and operational shutdowns affecting service to Treasure Valley residents.
How do mergers and acquisitions in energy utilities affect legal water right ownership in Ada County?
When energy utilities merge or undergo private equity acquisition in the Treasure Valley, water rights tied to service territories transfer to new corporate entities, triggering review under Idaho water law. Boise State University and public agencies in Ada County must verify that acquiring companies maintain valid prior-appropriation rights to continue serving population centers like Boise and Nampa. Legal challenges to these transfers can delay infrastructure investment and service reliability.
Why do irrigation districts and energy utilities compete for Snake River water rights in the Treasure Valley?
Irrigation districts throughout Ada County and Canyon County hold senior water rights under prior-appropriation law to serve agricultural users, while energy utilities require Snake River flows for hydroelectric generation and operational cooling. During low-water years, Boise, Nampa, and Caldwell utilities face legal restrictions as junior rights-holders when aquifer and surface water allocations are reduced. This legal hierarchy creates ongoing disputes over groundwater and river allocation between agricultural and utility interests.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Energy Utilities 17 QID bridges 313 edges 8,805 ext links 2026-07-17 21:46:37 UTC 5d74f513fe901506
Legal corridor ↗ Energy Utilities corridor ↗ Energy Utilities × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals