—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Land Use Planning

28 Wikipedia bridge articles confirmed in both vertical ledgers. 291 deterministic cross-vertical edges. 8,163 external source links harvested. Every edge provenance-stamped. Every claim auditable.

28 QID Bridge Articles
291 Cross Edges
8,163 External Sources
356 Wikipedia Articles
28 🌲 Evergreen
157 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Land Use Planning
QID Bridge Articles
28
confirmed Wikipedia overlap
Total Cross Edges
291
External Sources Harvested
8,163
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (20)
IdahoLand-use planningClean Water ActZoningNational Environmental Policy ActEminent domainBoise State UniversityTreasure ValleyIdaho LegislatureAquiferEasementIdaho Supreme CourtWater rightMechanic's lienAnnexationAdministrative lawIrrigation districts in the United StatesMergers and acquisitionsBoise, IdahoNampa, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationgovernmentlandwaterlegalpublicadariverchangesdevelopmentenvironmentalphysicallocalpropertyrighthomeagriculturallargest
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:47:55 UTC
Content Hash
433d1f6de5066530
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
28 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (16): "agricultural", "agriculture", "associated", "boise", "eastern", "idaho", "land", "largest", "national", "population", "products", "river", "separate", "technology", "territory", "western". | EXACT TITLE in legal: "Idaho". | EXACT TITLE in land_use_planning: "Idaho".
agriculturalagricultureassociatedboiseeasternidaholandlargestnationalpopulationproductsriverseparatetechnologyterritorywestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (21): "american", "association", "authority", "changes", "cities", "community", "development", "districts", "environmental", "founded", "land", "land-use", "natural", "physical", "planning", "project", "regional", "regulate", "regulation", "resources".... | EXACT TITLE in land_use_planning: "Land-use planning".
americanassociationauthoritychangescitiescommunitydevelopmentdistrictsenvironmentalfoundedlandland-usenaturalphysicalplanningprojectregionalregulateregulationresourceswater
ic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
Indigenous communities Land use planning is an important method for sustainable development for Indigenous communities. Indigenous peoples in the United States and Canada often have fragmented or diminishing land bases with limited uses. Oftentimes, these land bases are also far from urban centers and with limited expansion ability. Since European settlers first began colonizing the American Continent, Indigenous peoples have lost 98.9% of their land, a Yale study found. The lands indigenous peoples were forced onto are facing current and future climate-change related risks. This fact leads to the perpetuation of systematic inequity for Indigenous peoples, since livelihoods, preservation of culture and tradition, access to adequate housing, and access to resources are all factors that are deeply rooted in land. Many Indigenous groups are embracing land use planning to determine the future of their territories. In Canada, for example, the Dehcho First Nations have developed a land use plan that honors cultural traditions and Elders' knowledge, and incorporates conservation, development zones, and other categories.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (16): "address", "administered", "assistance", "changes", "environmental", "federal", "form", "groundwater", "maintain", "owned", "physical", "protection", "quality", "resource", "water", "works". | EXACT TITLE in land_use_planning: "Clean Water Act".
addressadministeredassistancechangesenvironmentalfederalformgroundwatermaintainownedphysicalprotectionqualityresourcewaterworks
governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
f 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination. Groundwater protection provisions are included in the Safe Drinking Water Act, Resource Conservation and Recovery Act, and the Superfund act. Background Health implications of water pollution Contamination of drinking water supplies can not only occur in the source water but also in the distribution system. Sources of water contamination include naturally occurring chemicals and minerals (arsenic, radon, uranium), local land use practices (fertilizers, pesticides, concentrated feeding operations), manufacturing processes, and sewer overflows or wastewater releases. Some examples of health implications of water contamination are gastrointestinal illness, reproductive problems, and neurological disorders.
Anti-degradation policy The water quality regulations include an anti-degradation policy that requires states and tribes to establish a three-tiered anti-degradation program. Anti-degradation procedures identify steps and questions that need to be addressed when specific activities affect water quality. "Tier 1" requirements are applicable to all surface waters. These requirements maintain and protect current uses and the water quality conditions to support existing uses. Current uses are identified by showing that fishing, swimming, and other water uses have occurred and are suitable since November 28, 1975. "Tier 2" requirements maintains and protects water bodies with existing conditions that are better to support "fishable/swimmable" uses pursuant to CWA section 101(a)(2).
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (17): "development", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "set", "single", "variances", "zoning". | EXACT TITLE in legal: "Zoning". | EXACT TITLE in land_use_planning: "Zoning".
developmentformgoverngovernmentgrowthindustriallandland-uselocalplanningpropertyregulatoryscalesetsinglevarianceszoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
ed zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
itional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
National Environmental Policy Act
EXACT TITLE 1.000
QID OVERLAP: Q6972479 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (17): "actions", "agencies", "authority", "council", "courts", "created", "environmental", "established", "federal", "final", "government", "january", "national", "quality", "reports", "requirement", "requires". | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
actionsagenciesauthoritycouncilcourtscreatedenvironmentalestablishedfederalfinalgovernmentjanuarynationalqualityreportsrequirementrequires
a United States environmental law designed to promote the enhancement of the environment. It created new laws requiring U.S. federal government agencies to evaluate the environmental impacts of their actions and decisions, and it established the President's Council on Environmental Quality (CEQ). The act was passed by the U.S. Congress in December 1969 and signed into law by President Richard Nixon on January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
t all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
Eminent domain
Q166332 EXACT TITLE 0.980
QID OVERLAP: Q166332 in legal (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (14): "development", "fee", "final", "government", "land", "legal", "owners", "payment", "power", "property", "public", "right", "tax", "title". | EXACT TITLE in legal: "Eminent domain".
developmentfeefinalgovernmentlandlegalownerspaymentpowerpropertypublicrighttaxtitle
d and connect rail networks. In the mid-20th century, a new application of eminent domain was pioneered, in which the government could take the property and transfer it to a private third party for redevelopment. This was initially done only on properties that had been deemed "blighted" or a "development impediment", on the principle that such properties had a negative impact upon surrounding property owners, but was later expanded to allow the taking of any private property when the new third-party owner could develop the property in such a way as to bring in increased tax revenues. Some jurisdictions require that the taker make an offer to purchase the subject property before resorting to the use of eminent domain.
After his victory in 1066, William the Conqueror seized virtually all land in England. Although he maintained absolute power over the land, he granted fiefs to landholders who served as stewards, paying fees and providing military services. During the Hundred Years' War in the 14th century, Edward III used the Crown's right of purveyance for massive expropriations. Chapter 28 of Magna Carta required that immediate cash payment be made for expropriations. As the king's power was broken down in the ensuing centuries, tenants were regarded as holding ownership rights rather than merely possessory rights over their land. In 1427, a statute was passed granting Commission of sewers in Lincolnshire the power to take land without compensation. After the early 16th century, however, Parliamentary takings of land for roads, bridges, and other infrastructure. generally did require compensation. The common practice was to pay 10% more than the assessed value. However, as the voting franchise was expanded to include more non-landowners, the bonus was eliminated. Despite contrary statements found in some American law, in the United Kingdom, compulsory purchase valuation cases were tried by juries well into the 20th century, such as Attorney-General v De Keyser's Royal Hotel Ltd (1919). In England and Wales, and other jurisdictions that follow the principles of English law, the related term compulsory purchase is used. The landowner is compensated with a price agreed or stipulated by an appropriate person; where agreement on price cannot be achieved, the value of the taken land is determined by the Upper Tribunal. The operative law is a patchwork of statues and case law. The principal acts are the Lands Clauses Consolidation Act 1845 (8 & 9 Vict. c. 18), the Land Compensation Act 1961, the Compulsory Purchase Act 1965, the Land Compensation Act 1973, the Acquisition of Land Act 1981, part IX of the Town and Country Planning Act 1990, the Planning and Compensation Act 1991, and the Planning and Compulsory Purchase Act 2004. Scotland In Scotland, eminent domain is known as compulsory purchase. The development of powers of compulsory purchase originated in the railway mania of the Victorian period. Compensation is available to the landowner, with the Lands Tribunal for Scotland dealing with any disputes arising from the value of compensation. As in England and Wales, the law of compulsory purchase in Scotland is complex. The current statutes regulating compulsory purchase include: the Lands Clauses Consolidation (Scotland) Act 1845 (8 & 9 Vict. c. 19); the Acquisition of Land (Authorisation Procedure) (Scotland) Act 1947; and the Land Compensation (Scotland) Act 1963. The Scottish Law Commission considered the current state of the law of compulsory purchase and advocated reforms in its Discussion Paper on Compulsory Purchase.
re that the taker make an offer to purchase the subject property before resorting to the use of eminent domain.
Boise State University
EXACT TITLE 0.960
QID OVERLAP: Q891082 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (13): "among", "boise", "business", "college", "education", "founded", "idaho", "independent", "member", "program", "public", "school", "university". | EXACT TITLE in land_use_planning: "Boise State University".
amongboisebusinesscollegeeducationfoundedidahoindependentmemberprogrampublicschooluniversity
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in land_use_planning: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Idaho Legislature
Q4256974 EXACT TITLE 0.920
QID OVERLAP: Q4256974 in legal (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (11): "boise", "data", "district", "districts", "government", "house", "idaho", "legislature", "population", "residents", "single". | EXACT TITLE in legal: "Idaho Legislature".
boisedatadistrictdistrictsgovernmenthouseidaholegislaturepopulationresidentssingle
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Aquifer
Q208791 EXACT TITLE 0.900
QID OVERLAP: Q208791 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (10): "aquifer", "beyond", "formation", "groundwater", "home", "industrial", "land", "layer", "material", "water". | EXACT TITLE in legal: "Aquifer". | EXACT TITLE in land_use_planning: "Aquifer".
aquiferbeyondformationgroundwaterhomeindustriallandlayermaterialwater
An aquifer is an underground layer of water-bearing material consisting of permeable or fractured rock, or of unconsolidated materials (gravel, sand, or silt). Aquifers vary greatly in their characteristics. The study of water flow in aquifers and the characterization of aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
aquifers is called hydrogeology. Related concepts include aquitard, a bed of low permeability along an aquifer, and aquiclude (or aquifuge), a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
a solid and impermeable region underlying or overlying an aquifer, the pressure of which could lead to the formation of a confined aquifer. Aquifers can be classified as saturated versus unsaturated, aquifers versus aquitards, confined versus unconfined, isotropic versus anisotropic, and porous, karst, fractured, or transboundary. Groundwater from aquifers can be sustainably harvested by humans through the use of wells. This groundwater is mainly used for agricultral purposes but is used for other reasons such as home or industrial use.
Easement
Q448405 EXACT TITLE 0.900
QID OVERLAP: Q448405 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (10): "access", "among", "itself", "land", "owned", "property", "public", "real", "right", "rights". | EXACT TITLE in land_use_planning: "Easement".
accessamongitselflandownedpropertypublicrealrightrights
ated purpose. For example, an easement may allow someone to use a road on their neighbor's land to get to their own.' Another example is someone's right to fish in a privately owned pond, or to have access to a public beach. The rights of an easement holder vary substantially among jurisdictions. Types Historically, common law courts would enforce only four types of easements: Easements of way (also known as Right-of-way) Easements of support (pertaining to excavations) Easements of "light and air" Rights pertaining to artificial waterways Courts now recognize more varieties of easements, but these original four categories still form the foundation of easement law.
As defined by Evershed MR in Re Ellenborough Park [1956] Ch 131, an easement requires the existence of at least two pieces of land. The land with the benefit of the easement is the dominant estate or dominant tenement, while the land burdened by the easement is the servient estate or servient tenement. For example, the owner of parcel A holds an easement to use a driveway on parcel B to gain access to A's house. Here, parcel A is the dominant estate, receiving the benefit, and parcel B is the servient estate, granting the benefit or suffering the burden. Public or private A private easement is held by private individuals or entities.
Appurtenant or in gross In the US, an easement appurtenant is one that benefits the dominant estate and "runs with the land" and so generally transfers automatically when the dominant estate is transferred. An appurtenant easement allows property owners to access land that is only accessible through a neighbor's land. Conversely, an easement in gross benefits an individual or a legal entity, rather than a dominant estate. The easement can be for a personal use (for example, an easement to use a boat ramp) or a commercial use (for example, an easement to a railroad company to cross property to build and maintain a rail line). Historically, an easement in gross was neither assignable nor inheritable, but commercial easements are now freely transferable to a third party. They are divisible but must be exclusive (the original owner no longer uses it and exclusive to easement holder) and all holders of the easement must agree to divide.
Idaho Supreme Court
Q5987471 EXACT TITLE 0.870
QID OVERLAP: Q5987471 in legal (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (2): "courts", "idaho". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
courtsidaho
Idaho Supreme Court is the state supreme court of Idaho and is composed of the chief justice and four associate justices. The decisions of the Idaho Supreme Court are binding on all other Idaho state courts.
Women on the Supreme Court The first female justice on the Idaho Supreme Court was Linda Copple Trout, appointed in 1992 by Governor Cecil Andrus and elected in 1996 and 2002. She remains as the state's only female chief justice (1997–2004). The second female justice was Cathy Silak, appointed by Andrus in 1993 and elected in 1994. She lost her reelection bid in 2000 to Dan Eismann and became the first incumbent justice from the court to be defeated since 1944. After Trout's retirement in 2007, no women were on the court until the election of Robyn Brody in 2016 to a vacant seat, the first by a female; she is the only justice on the current court not first appointed. Colleen Zahn joined the court in 2021, appointed by Governor Brad Little; Brody and Zahn ran unopposed in 2022.
Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years. Prior to 1983, the position went to the justice with the least amount of time remaining in his term. The court originally had three justices; it was expanded to five in 1921. Current justices Vacancies and pending nomination Women on the Supreme Court The first female justice on the Idaho Supreme Court was Linda Copple Trout, appointed in 1992 by Governor Cecil Andrus and elected in 1996 and 2002. She remains as the state's only female chief justice (1997–2004). The second female justice was Cathy Silak, appointed by Andrus in 1993 and elected in 1994. She lost her reelection bid in 2000 to Dan Eismann and became the first incumbent justice from the court to be defeated since 1944. After Trout's retirement in 2007, no women were on the court until the election of Robyn Brody in 2016 to a vacant seat, the first by a female; she is the only justice on the current court not first appointed. Colleen Zahn joined the court in 2021, appointed by Governor Brad Little; Brody and Zahn ran unopposed in 2022.
W
Q7973730 EXACT TITLE 0.860
QID OVERLAP: Q7973730 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (8): "ground", "groundwater", "irrigation", "legal", "physical", "right", "river", "water". | EXACT TITLE in legal: "Water right". | EXACT TITLE in land_use_planning: "Water right".
groundgroundwaterirrigationlegalphysicalrightriverwater
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
cated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
Community-based allocation of water In some jurisdictions, appropriative water rights can be granted directly to communities. Here, water is reserved to provide sufficient capacity for the future growth of that particular community. For example, California provides communities and other water users within watersheds senior status over appropriative (use-based) water rights solely because they are located where the water originates and naturally flows. A second example of community-based water rights is pueblo water rights. As recognized by California, pueblo water rights are grants to individual settlements (i.e. pueblos) over all streams and rivers flowing through the city and to all groundwater aquifers underlying that particular city. The pueblo's claim expands with the needs of the city and may be used to supply the needs of areas that are later annexed to the city. While California recognizes pueblo water rights, pueblo water rights are controversial.
M
Q6804463 EXACT TITLE 0.840
QID OVERLAP: Q6804463 in legal (tier:evergreen) and land_use_planning (tier:branch). | SHARED TOKENS (7): "construction", "itself", "lien", "liens", "property", "real", "title". | EXACT TITLE in legal: "Mechanic's lien".
constructionitselflienlienspropertyrealtitle
plied labor or materials that improve the property. The lien exists for both real property and personal property. In the realm of real property, it is called by various names, including, generically, construction lien. The term "lien" comes from a French root, with a meaning similar to link, which is itself ultimately descended from the Latin ligamen, meaning "bond" and ligare, meaning "to bind".
c's liens on property in the United States date from the 18th century. History and reasons for existence Mechanic's liens in their modern form were first conceived by Thomas Jefferson, to encourage construction in the new capital city of Washington. They were established by the Maryland General Assembly, of which the city of Washington was then a part. However, it is not likely that Jefferson single-handedly dreamed up the idea. At the time Jefferson promoted the law, a lien-like privilege already existed in civil law countries like France, the Dutch Republic and Spain, with some laws even tracing their roots to the Roman Empire. And since control of Louisiana had passed between the French and Spaniards, and had largely adopted the French Napoleonic Code, there was a similar privilege concept in that territory. It seems highly likely that the legislators working on the first U.S. Mechanic Lien laws had knowledge of, and referenced these civil law concepts. Nevertheless, the United States version was original, as it gave builders a more robust right into the land itself (versus just the improvement's value). With respect to real property, mechanic's liens are purely statutory devices that exist in every state (although in California, as noted below, they have a constitutional foundation). The reason they exist is a legislative public policy to protect contractors. More specifically, the state legislatures have determined that, due to the economics of the construction business, contractors and subcontractors need greater remedy for non-payment for their work than merely the right to sue on their contracts. In particular, without the mechanics' lien, subcontractors providing either labor or materials may have no effective remedy if their general contractor is not sufficiently financially responsible, because their only contractual right is with that general contractor. Without the mechanic's lien, the contractor would have a limited number of options to enforce payment of the amounts owed. Further, there is usually a long list of claimants on any failed project. To avoid the specter of various trades, materialmen and suppliers attempting to remove the improvements they have made, and to maintain a degree of equality between the various lienors on a project, the statutory lien scheme was created. Without it, Tradesperson A may try to "race" Supplier B to the courthouse, the project site or the construction lender to obtain payment. Most lien statutes instead mandate strict compliance with the formalized process they create in return for the timely resolution and balancing of claims between all parties involved - both owners and lien claimants. In the state of California, mechanic's liens are a constitutional right guaranteed to contractors by the California Constitution. This right has been implemented in detail by statutes enacted by the California State Legislature.
Creation, perfection, priority and enforcement – real property Mechanic's liens on the title to real property are exclusively the result of legislation. Each state has its own laws regarding the creation and enforcement of these liens, but, overall, there are some similar elements among them. Many States distinguish between the types of real property upon which a mechanics lien can be filed. Under the principle of sovereign immunity, real property of the government (public property) is ordinarily not subject to the claims of private parties. Therefore, unless the state specifically so provides, mechanic's liens do not attach to the title owned by the state or its administrative subdivisions, such as cities. Similarly, mechanic's liens under state law are invalid on federal construction projects. To protect subcontractors and suppliers working on federal projects where the contract price exceeds $100,000.00 the Miller Act requires general contractors to provide a payment bond which guarantees payment for work done in accordance with the terms of the contract. Many state and municipal governments similarly require contractors on public works projects to be bonded under so-called "Little Miller Acts." Theoretically, the payment bond under the Miller Act or Little Miller Act stands in place of the government's property, and qualified claimants make claims against that bond similar to how they would file an ordinary mechanic's lien. In many states, the legislature has created extra procedures in order for a mechanics lien to be placed on residential property. In New Jersey, which enacted the strictest of these regulations, a mechanics lien can only be placed on residential property after a Notice of Unpaid Balance and Right to File Lien has been filed within 60 days of the lienor's last date of work and an arbitration award has been issued by an American Arbitration Association arbitrator permitting a mechanics lien to be filed. The act itself of filing a mechanics lien can be difficult. Most States simply require the filing of the mechanics lien with a county or court clerk within a defined amount of time from a triggering event. However, Maryland requires an application to the Court in order to file a mechanics liens.
Annexation
Q194465 EXACT TITLE 0.840
QID OVERLAP: Q194465 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (7): "actions", "annexation", "bodies", "legal", "physical", "territory", "title". | EXACT TITLE in legal: "Annexation". | EXACT TITLE in land_use_planning: "Annexation".
actionsannexationbodieslegalphysicalterritorytitle
zed if generally recognized by other states and international bodies. The illegality of annexation means that states carrying out such acts usually avoid using the word annexation in describing their actions; in each of the unresolved annexations by Israel, Morocco and Russia, the states have avoided characterizing their actions as such. Evolution of international law Illegality International law regarding the use of force by states evolved significantly in the 20th century. Key agreements include the 1907 Porter Convention, the 1920 Covenant of the League of Nations and the 1928 Kellogg–Briand Pact, culminating in Article 2(4) of Chapter I of the United Nations Charter, which is in force today: "All Members shall refrain in their international relations from the threat or use of force against the territorial integrity or political independence of any state, or in any other manner inconsistent with the Purposes of the United Nations". These principles were reconfirmed by the 1970 Friendly Relations Declaration. Since the use of force against territorial integrity or political independence is illegal, the question as to whether title or sovereignty can be transferred in such a situation has been the subject of legal debate.
After being allied with Iraq during the Iran–Iraq War (largely due to desiring Iraqi protection from Iran), Kuwait was invaded and annexed by Iraq (under Saddam Hussein) in August 1990. Hussein's primary justifications included a charge that Kuwaiti territory was in fact an Iraqi province, and that annexation was retaliation for "economic warfare" Kuwait had waged through slant drilling into Iraq's oil supplies. The monarchy was deposed after annexation, and an Iraqi governor installed. United States president George H. W. Bush ultimately condemned Iraq's actions, and moved to drive out Iraqi forces. Authorized by United Nations Security Council resolutions, an American-led coalition of 34 nations fought the Gulf War to reinstate the Kuwaiti Emir.
The rule of the Qing dynasty over Tibet was established after a Qing expedition force defeated the Dzungar Khanate which had occupied Tibet in 1720, and lasted until the fall of the Qing dynasty in 1912. The Imperial Edict of the Abdication of the Qing Emperor issued in 1912 provided the legal basis for the Republic of China (ROC) to inherit all Qing territories, including Tibet. However, the ROC had no effective control over Tibet from 1912 to 1951; In the opinion of the Chinese government, this condition does not represent Tibet's de jure independence as many other parts of China also enjoyed de facto independence when the Chinese state was torn by warlordism, Japanese invasion, and civil war. Tibet came under the control of the People's Republic of China (PRC) after attempts by the Government of Tibet to gain international recognition, efforts to modernize its military, negotiations between the Government of Tibet and the PRC, and a military conflict in the Chamdo area of western Kham in October 1950. Many analysts consider the incorporation of Tibet into the PRC an annexation. If the actions of 1950 constituted an annexation, it was subsequently legalized by the Seventeen Point Agreement by the Government of Tibet in October 1951.
Administrative law
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (19): "administrative", "agencies", "bodies", "changes", "civil", "courts", "created", "education", "enforcement", "environmental", "government", "itself", "judicial", "legal", "public", "regulate", "review", "system", "trade".
administrativeagenciesbodieschangescivilcourtscreatededucationenforcementenvironmentalgovernmentitselfjudiciallegalpublicregulatereviewsystemtrade
Administrative law is a division of law governing the activities of executive branch agencies of government. Administrative law includes executive branch rulemaking (executive branch rules are generally referred to as "regulations"), adjudication, and the enforcement of laws.
g of administrative units of government that are part of the executive branch in such areas as international trade, manufacturing, the environment, taxation, broadcasting, immigration, and transport. Administrative law expanded greatly during the 20th century, as legislative bodies worldwide created more government agencies to regulate the social, economic and political spheres of human interaction. Civil law countries often have specialized administrative courts that review these decisions.
20th century, as legislative bodies worldwide created more government agencies to regulate the social, economic and political spheres of human interaction. Civil law countries often have specialized administrative courts that review these decisions. In the last fifty years, administrative law, in many countries of the civil law tradition, has opened itself to the influence of rules posed by supranational legal orders, in which judicial principles have strong importance: it has led, for one, to changes in some traditional concepts of the administrative law model, as has happened with the public procurements or with judicial control of administrative activity and, for another, has built a supranational or international public administration, as in the environmental sector or with reference to education, for which, within the United Nations' system, it has been possible to assist to a further increase of administrative structure devoted to coordinate the States' activity in that sector.
I
Q6073798 QID OVERLAP 0.800
QID OVERLAP: Q6073798 in legal (tier:evergreen) and land_use_planning (tier:evergreen). | SHARED TOKENS (18): "authority", "corporation", "created", "district", "districts", "entity", "government", "irrigation", "large", "legislature", "local", "power", "projects", "public", "set", "subdivision", "tax", "water".
authoritycorporationcreateddistrictdistrictsentitygovernmentirrigationlargelegislaturelocalpowerprojectspublicsetsubdivisiontaxwater
division of the State government, with definite geographic boundaries, organized, and having taxing power to obtain and distribute water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn.
r irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district
igation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district References External links Federal lands included in state irrigation districts "The Nevada Irrigation District Act"
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (25): "assets", "business", "combined", "commission", "competitive", "corporate", "department", "entity", "federal", "governed", "government", "interests", "legal", "market", "operating", "operations", "organization", "regulatory", "requires", "review"....
assetsbusinesscombinedcommissioncompetitivecorporatedepartmententityfederalgovernedgovernmentinterestslegalmarketoperatingoperationsorganizationregulatoryrequiresreviewsinglestrategictradetransactionunified
l terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Acquisition An acquisition/takeover is the purchase of one business or company by another company or other business entity. Specific acquisition targets can be identified through myriad avenues, including market research, trade expos, sent up from internal business units, or supply chain analysis. Such purchase may be of 100%, or nearly 100%, of the assets or ownership equity of the acquired entity. A consolidation/amalgamation occurs when two companies combine to form a new enterprise altogether, and neither of the previous companies remains independently owned. Acquisitions are divided into "private" and "public" acquisitions, depending on whether the acquiree or merging company (also termed a target) is or is not publicly listed. Some public companies rely on acquisitions as an important value creation strategy. An additional dimension or categorization consists of whether an acquisition is friendly or hostile. Achieving acquisition success has proven to be very difficult, while various studies have shown that 50% of acquisitions were unsuccessful. "Serial acquirers" appear to be more successful with M&A than companies who make acquisitions only occasionally (see Douma & Schreuder, 2013, chapter 13). The new forms of buy out created since the 2008 financial crisis are based on serial type acquisitions known as an ECO Buyout which is a co-community ownership buy out and the new generation buy outs of the MIBO (Management Involved or Management & Institution Buy Out) and MEIBO (Management & Employee Involved Buy Out). Whether a purchase is perceived as being "friendly" or "hostile" depends significantly on how the proposed acquisition is communicated to and perceived by the target company's board of directors, employees, and shareholders. It is normal for M&A deal communications to take place in a so-called "confidentiality bubble", wherein the flow of information is restricted pursuant to confidentiality agreements. In the case of a friendly transaction, the companies cooperate in negotiations; in the case of a hostile deal, the board and/or management of the target is unwilling to be bought or the target's board has no prior knowledge of the offer. Hostile acquisitions can, and often do, ultimately become "friendly" as the acquirer secures endorsement of the transaction from the board of the acquiree company. This usually requires an improvement in the terms of the offer and/or through negotiation. "Acquisition" usually refers to a purchase of a smaller firm by a larger one. Sometimes, however, a smaller firm will acquire management control of a larger and/or longer-established company and retain the name of the latter for the post-acquisition combined entity. This is known as a reverse takeover. Another type of acquisition is the reverse merger, a form of transaction that enables a private company to be publicly listed in a relatively short time frame. A reverse merger is a type of merger where a privately held company, typically one with promising prospects and a need for financing, acquires a publicly listed shell company that has few assets and no significant business operations. The combined evidence suggests that the shareholders of acquired firms realize significant positive "abnormal returns," while shareholders of the acquiring company are most likely to experience a negative wealth effect. Most studies indicate that M&A transactions have a positive net effect, with investors in both the buyer and target companies seeing positive returns. This suggests that M&A creates economic value, likely by transferring assets to more efficient management teams who can better utilize them.
The buyer buys the shares, and therefore control, of the target company being purchased. Ownership control of the company in turn conveys effective control over the assets of the company, but since the company is acquired intact as a going concern, this form of transaction carries with it all of the liabilities accrued by that business over its past and all of the risks that company faces in its commercial environment and corporate environment The buyer buys the assets of the target company. The cash the target receives from the sell-off is paid back to its shareholders by dividend or through liquidation. This type of transaction leaves the target company as an empty shell, if the buyer buys out the entire assets. A buyer often structures the transaction as an asset purchase to "cherry-pick" the assets that it wants and leave out the assets and liabilities that it does not. This can be particularly important where foreseeable liabilities may include future, unquantified damage awards such as those that could arise from litigation over defective products, employee benefits or terminations, or environmental damage. A disadvantage of this structure is the tax that many jurisdictions, particularly outside the United States, impose on transfers of the individual assets, whereas stock transactions can frequently be structured as like-kind exchanges or other arrangements that are tax-free or tax-neutral, both to the buyer and to the seller's shareholders. The terms "demerger", "spin-off" and "spin-out" are sometimes used to indicate a situation where one company splits into two, generating a second company which may or may not become separately listed on a stock exchange. As per knowledge-based views, firms can generate greater values through the retention of knowledge-based resources which they generate and integrate. Extracting technological benefits during and after acquisition is an ever-challenging issue because of organizational differences.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (13): "ada", "annual", "boise", "counties", "employers", "home", "idaho", "population", "river", "sectors", "technology", "treasure", "valley".
adaannualboisecountiesemployershomeidahopopulationriversectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegehomeidahointerstatemeridiannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
P
Q476115 QID OVERLAP 0.760
QID OVERLAP: Q476115 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (13): "active", "business", "changes", "development", "expansion", "finance", "financial", "financing", "firm", "firms", "general", "products", "public".
activebusinesschangesdevelopmentexpansionfinancefinancialfinancingfirmfirmsgeneralproductspublic
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (10): "ada", "boise", "district", "home", "idaho", "jurisdiction", "largest", "local", "population", "range".
adaboisedistricthomeidahojurisdictionlargestlocalpopulationrange
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.680
QID OVERLAP: Q1516892 in legal (tier:branch) and land_use_planning (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "government", "idaho", "municipal", "nearly", "population", "separate", "street".
adaboisegovernmentidahomunicipalnearlypopulationseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "cities", "fastest-growing", "idaho", "meridian", "population".
adaamongboisecitiesfastest-growingidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
P
Q7245403 QID OVERLAP 0.660
QID OVERLAP: Q7245403 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (8): "agricultural", "american", "industrial", "legal", "right", "rights", "system", "water".
agriculturalamericanindustriallegalrightrightssystemwater
In the American legal system, prior appropriation water rights is the doctrine that the first person to take a quantity of water from a water source for "beneficial use" (agricultural, industrial or household) has the right to continue to use that quantity of water for that purpose. Subsequent users can take the remaining water for their own use if they do not impinge on the rights of previous users.
Nature of the right The legal details of prior appropriation vary from state to state. Under the prior appropriation system, the right is initially allotted to those who are "first in time of use"; these rights of withdrawal can then trade on the open market, like other property. For water sources with many users, a government or quasi-government agency is usually charged with overseeing allocations. Allocations involving water sources that cross state borders or international borders can be quite contentious, and are generally governed by federal court rulings, interstate agreements and international treaties. A claim of prior appropriation must prove four sub-claims: diversion (that the water had been withdrawn), priority (that the withdrawer had diverted water prior to the other claimant), intent (that the water had been withdrawn by design), and beneficial use (that the water was put to a publicly-acceptable end). If proved, the initial person to use a quantity of water from a water source for a beneficial use has the right to continue to use the same quantity of water for the same purpose. Subsequent users can use the remaining water for their own beneficial purposes provided that they do not impinge on the rights of previous users; this is the priority element of the doctrine. But neither can a senior user change the manner (i.e., location) in which they appropriate water to the detriment of a junior user. These Preservation of Conditions were granted to the second user after Farmers Highline Canal & Reservoir Co. v. City of Golden, 272 P.2d 629 (Colo. 1954). A senior water user could, for example, only have been using the water during a particular season. Then the purchaser of the water right could only use the water in the same season as when the right was established. In addition, the state may put additional conditions on the use of the water right to prevent polluting or inefficient uses of water. Beneficial use is commonly defined as agricultural, industrial or household use. The doctrine has historically excluded ecological purposes, such as maintaining a natural body of water and the wildlife that depends on it, but some jurisdictions now accept such claims. The extent to which private parties may own such rights varies among the states. Each water right has a yearly quantity and an appropriation date. Each year, the user with the earliest appropriation date (known as the "senior appropriator") may use up to their full allocation (provided the water source can supply it). Then the user with the next earliest appropriation date may use their full allocation and so on. In cases of water shortages, prior-appropriation does not require a senior user to utilize less water than usual. Therefore, during times of drought, users with junior appropriation dates might not receive their full allocation or even any water at all. When a water right is sold, it retains its original appropriation date. Only the amount of water historically consumed can be transferred if a water right is sold. For example, if alfalfa is grown using flood irrigation, the amount of the return flow may not be transferred, only the amount that would be necessary to irrigate the amount of alfalfa historically grown. Prior appropriation rights are subject to certain adverse possession-type rules to reduce speculation. Withdrawal rights can be lost or shrunk over time if unused for a certain number of years, or if a litigant can demonstrate that the water's use is not beneficial.
Criticism Each drop of rain falling through the sky has already been allocated to a user. Leave the hose running between rinses while you wash your car and you won't run afoul of the law; but if you gather a pailful of rainwater and pour on your tomato plant, look over your shoulder for a water cop. You will be preventing those raindrops from entering the watershed, depriving people downstream from the surrounding creeks and rivers of their rights to use their apportioned amounts of streamflow. The doctrine of prior appropriation comes crashing up against the imperative to conserve scarce water. Colorado made it legal for some homeowners to harvest rain and snow from their roofs. Tucson is encouraging its citizens to gather rainwater. Santa Fe made catchment devices mandatory for new dwellings. But, in Utah and Washington (with the exception of Seattle), harvesting raindrops is still a crime. Even though water markets increasingly gain ground, many criticize the prior appropriation system for failing to adequately adjust to society's evolving values and needs. Environmentalists and recreational river-users demand more water be left in rivers and streams, but courts have been slow to accept these requests as beneficial uses. Conversely, the tool of beneficial use is too tied to custom to encourage users to conserve. An appropriator who uses water inefficiently retains the right to the full allotment, but an appropriator who uses only a portion risks losing the right to the rest, and water right markets remain too illiquid to purchase any excess. As a result, the vast majority of water in the West still is allocated to agricultural uses despite cries for additional water from growing cities. High demand can cause an over-appropriation of the waters, in which there are more water rights for a particular stream than water actually available. This leads to an apparent inefficiency: if a water source is over-appropriated, the latest users will almost never see water from their claims.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.620
QID OVERLAP: Q849592 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "college", "idaho", "population".
boisecaldwellcanyoncollegeidahopopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in legal (tier:branch) and land_use_planning (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
263 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP263 edges
🌿 BRANCH157 edges
0.500
Arbitration ↗ Q207946 EXACT TITLE
alternativecommercialconsumercontextcourtsdisputesemploymententityformjudiciallocalmandatoryproceedingsreviewrightrights
SHARED TOKENS (16): "alternative", "commercial", "consumer", "context", "courts", "disputes", "employment", "entity", "form", "judicial", "local", "mandatory", "proceedings", "review", "right", "rights". | EXACT TITLE in legal: "Arbitration".
0.500
attorneysbarcompletecontinuingdevelopmentdistricteducationlawyerslegallicensesmaintainmandatoryminimumoutsidepracticeprofessionalrequired
SHARED TOKENS (17): "attorneys", "bar", "complete", "continuing", "development", "district", "education", "lawyers", "legal", "licenses", "maintain", "mandatory", "minimum", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education". | EXACT TITLE in land_use_planning: "Continuing legal education".
0.500
Corporation ↗ Q167037 EXACT TITLE
businesscontextcorporatecorporationentityestablishedinvestorsjointjurisdictionlegallegislaturelocalmembernaturalobligationsofficeownedownerspracticepublic
SHARED TOKENS (23): "business", "context", "corporate", "corporation", "entity", "established", "investors", "joint", "jurisdiction", "legal", "legislature", "local", "member", "natural", "obligations", "office", "owned", "owners", "practice", "public".... | EXACT TITLE in legal: "Corporation". | EXACT TITLE in land_use_planning: "Corporation".
0.500
civilenforcementenglishenvironmentalgovernsjurisdictionlandlegalpropertypublicrealrelationshipsrightsseparatesettrust
SHARED TOKENS (16): "civil", "enforcement", "english", "environmental", "governs", "jurisdiction", "land", "legal", "property", "public", "real", "relationships", "rights", "separate", "set", "trust". | EXACT TITLE in legal: "Property law".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbusinesscreatedenglishentityestablishedfederalgovernedincomejurisdictionlegalnaturalownerspropertypublicrequiresrightsingletrust
SHARED TOKENS (19): "assets", "business", "created", "english", "entity", "established", "federal", "governed", "income", "jurisdiction", "legal", "natural", "owners", "property", "public", "requires", "right", "single", "trust". | EXACT TITLE in legal: "Trust (law)". | EXACT TITLE in land_use_planning: "Trust (law)".
0.500
departmentdevelopmentestablishedfederalgovernmentirrigationjunelargestpowerprogramprojectsresourcesupplywaterwestern
SHARED TOKENS (15): "department", "development", "established", "federal", "government", "irrigation", "june", "largest", "power", "program", "projects", "resource", "supply", "water", "western". | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
0.500
accessagenciescommunitycreateddevelopmentenforcementenvironmentalfirmsfocusgeneralindustrialinstitutionsmaintainphysicalpublicservingsetstandardssupplywater
SHARED TOKENS (20): "access", "agencies", "community", "created", "development", "enforcement", "environmental", "firms", "focus", "general", "industrial", "institutions", "maintain", "physical", "public", "serving", "set", "standards", "supply", "water". | EXACT TITLE in land_use_planning: "Infrastructure".
0.500
amongcommissiondevelopmentenglishestatefinancialgovernmentlegalmethodologynationalpropertyrealrightssubdivisionsystemtransactionunified
SHARED TOKENS (17): "among", "commission", "development", "english", "estate", "financial", "government", "legal", "methodology", "national", "property", "real", "rights", "subdivision", "system", "transaction", "unified". | EXACT TITLE in legal: "Real estate transaction".
0.500
agenciesagriculturaldevelopmentdistrictseducationgovernmentgrowingjointlandlocalnationalorganizationsplanningpreservationregionalrightssettaxtrustszoning
SHARED TOKENS (20): "agencies", "agricultural", "development", "districts", "education", "government", "growing", "joint", "land", "local", "national", "organizations", "planning", "preservation", "regional", "rights", "set", "tax", "trusts", "zoning". | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
amongcasescontextestablishedexperiencefinancialformshomeofficeorganizationpartnerpartnersphysicalpowerrangeratesrelationshipsreligiousresourcestechnology
SHARED TOKENS (20): "among", "cases", "context", "established", "experience", "financial", "forms", "home", "office", "organization", "partner", "partners", "physical", "power", "range", "rates", "relationships", "religious", "resources", "technology". | EXACT TITLE in legal: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongclaimsformsindustriallegalmemberminimumnationalorganizationpropertyprotectionpublicrightrightstechnologytrade
SHARED TOKENS (17): "agreements", "among", "claims", "forms", "industrial", "legal", "member", "minimum", "national", "organization", "property", "protection", "public", "right", "rights", "technology", "trade". | EXACT TITLE in legal: "Patent".
0.500
administrativeagenciesassistancedepartmentdistrictfederalfinancialgovernmentlocalmaintainofficeofficespublicregionalstatutory
SHARED TOKENS (15): "administrative", "agencies", "assistance", "department", "district", "federal", "financial", "government", "local", "maintain", "office", "offices", "public", "regional", "statutory". | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
Wetland ↗ Q170321 EXACT TITLE
amongenvironmentalformgroundwaterlargestprotectionpublicqualityrangeremovalriverservingsourceswaterwork
SHARED TOKENS (15): "among", "environmental", "form", "groundwater", "largest", "protection", "public", "quality", "range", "removal", "river", "serving", "sources", "water", "work". | EXACT TITLE in land_use_planning: "Wetland".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysiscivilconstructiondevelopmentformsgovernmenthistorylandlegalplanningprofessionalpropertyrequiredstructuralwork
SHARED TOKENS (15): "analysis", "civil", "construction", "development", "forms", "government", "history", "land", "legal", "planning", "professional", "property", "required", "structural", "work". | EXACT TITLE in land_use_planning: "Surveying".
0.500
analysisarchitecturebusinesscitiescivilcommunitydevelopmentdistributionenvironmentalfocusgrowthindependentlandland-uselandscapemaintainnaturalphysicalplanningplans
SHARED TOKENS (34): "analysis", "architecture", "business", "cities", "civil", "community", "development", "distribution", "environmental", "focus", "growth", "independent", "land", "land-use", "landscape", "maintain", "natural", "physical", "planning", "plans".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
administeredalternativeassistanceclaimscommunityconstructioncreateddebtdevelopmenteffectiveenforcementfederalgovernmentinsurancelandnationalownersprogrampropertyprotection
SHARED TOKENS (22): "administered", "alternative", "assistance", "claims", "community", "construction", "created", "debt", "development", "effective", "enforcement", "federal", "government", "insurance", "land", "national", "owners", "program", "property", "protection".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
businesscommercialcommunityconductcorporatecorporationfinancialformationgovernancegovernsinvestorslegalmarketorganizationspracticerightssystem
SHARED TOKENS (17): "business", "commercial", "community", "conduct", "corporate", "corporation", "financial", "formation", "governance", "governs", "investors", "legal", "market", "organizations", "practice", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
Plat ↗ Q831939 EXACT TITLE
commissiondepartmentgenerallandlegallocalmapofficeplanningplatpublicreviewscalesubdivisionworkszoning
SHARED TOKENS (16): "commission", "department", "general", "land", "legal", "local", "map", "office", "planning", "plat", "public", "review", "scale", "subdivision", "works", "zoning". | EXACT TITLE in legal: "Plat". | EXACT TITLE in land_use_planning: "Plat".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplieschangescollectiondistributionenvironmentalformgroundwatergrowthirrigationlandlandscapemaintainnaturalnetworkoperationsoutsidepracticequality
SHARED TOKENS (28): "agricultural", "agriculture", "applies", "changes", "collection", "distribution", "environmental", "form", "groundwater", "growth", "irrigation", "land", "landscape", "maintain", "natural", "network", "operations", "outside", "practice", "quality".... | EXACT TITLE in legal: "Irrigation". | EXACT TITLE in land_use_planning: "Irrigation".
0.500
authoritycannotcasescivilcourtsdeterminesdisputesestablishedfinalitselfjurisdictionlegalpowerproceedingsreviewrightsystem
SHARED TOKENS (17): "authority", "cannot", "cases", "civil", "courts", "determines", "disputes", "established", "final", "itself", "jurisdiction", "legal", "power", "proceedings", "review", "right", "system". | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebeyondconsumerdepartmentemployersemploymentfeegrowthknowledgeleadingminimumphysicalprogramprojectsregulationrequiredrequiresworkers
SHARED TOKENS (19): "additional", "agriculture", "beyond", "consumer", "department", "employers", "employment", "fee", "growth", "knowledge", "leading", "minimum", "physical", "program", "projects", "regulation", "required", "requires", "workers". | EXACT TITLE in legal: "H-1B visa".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisconstructioncontractorcountiesdevelopmentlandlandscapelegallicensedplanningplansprojectpropertyrepresentationresourcerightssetwater
SHARED TOKENS (18): "analysis", "construction", "contractor", "counties", "development", "land", "landscape", "legal", "licensed", "planning", "plans", "project", "property", "representation", "resource", "rights", "set", "water". | EXACT TITLE in land_use_planning: "Site plan".
0.500
Lawyer ↗ Q40348 EXACT TITLE
bareducationinterestsjurisdictionknowledgelawyerslegalpracticeprofessionalrangerequiredrightssystemtrainingwork
SHARED TOKENS (15): "bar", "education", "interests", "jurisdiction", "knowledge", "lawyers", "legal", "practice", "professional", "range", "required", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer". | EXACT TITLE in land_use_planning: "Lawyer".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagricultureaquifercitiesdistributionenvironmentalformformationgroundgroundwaterindustriallandlargestleadingmunicipaloperatingpublicsourcesvalleywater
SHARED TOKENS (20): "agricultural", "agriculture", "aquifer", "cities", "distribution", "environmental", "form", "formation", "ground", "groundwater", "industrial", "land", "largest", "leading", "municipal", "operating", "public", "sources", "valley", "water". | EXACT TITLE in legal: "Groundwater". | EXACT TITLE in land_use_planning: "Groundwater".
0.500
americanannualassociationbarboisebusinesscollegeeducationemploymentenvironmentalestablishedexpansionfallsidaholegislaturemembermonthsnaturalnewsplans
SHARED TOKENS (28): "american", "annual", "association", "bar", "boise", "business", "college", "education", "employment", "environmental", "established", "expansion", "falls", "idaho", "legislature", "member", "months", "natural", "news", "plans".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
addressadministrativecitiescoveringdevelopmentenvironmentalfocusgrowthindustriallandland-usenationalnetworkplanningplansprotectionregionalrequiresscalesupport
SHARED TOKENS (21): "address", "administrative", "cities", "covering", "development", "environmental", "focus", "growth", "industrial", "land", "land-use", "national", "network", "planning", "plans", "protection", "regional", "requires", "scale", "support".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
analysisassociatedchangescitiesdevelopmentenvironmentalformformationformsmaintainmaterialphysicalproducessetsourcesspecialstreet
SHARED TOKENS (17): "analysis", "associated", "changes", "cities", "development", "environmental", "form", "formation", "forms", "maintain", "material", "physical", "produces", "set", "sources", "special", "street". | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
agenciesarchitectureconstructionenvironmentalestateexpertisegenerallandscapelicenselicensedlicensesplanningprofessionalpublicrangerecreationrequiredresource
SHARED TOKENS (18): "agencies", "architecture", "construction", "environmental", "estate", "expertise", "general", "landscape", "license", "licensed", "licenses", "planning", "professional", "public", "range", "recreation", "required", "resource". | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
associationattorneycannotcompletecontractorscourtsdebtduesfeefeeshouselegallienpaymentprincipalpropertyrealrightstatutorytitle
SHARED TOKENS (21): "association", "attorney", "cannot", "complete", "contractors", "courts", "debt", "dues", "fee", "fees", "house", "legal", "lien", "payment", "principal", "property", "real", "right", "statutory", "title".... | EXACT TITLE in land_use_planning: "Foreclosure".
0.500
businesscasescommercialestatefeefinancialformgeneralindependentinstitutionalinsuranceinterestslandlargelegallendersnearlyoutsidepaymentproperty
SHARED TOKENS (25): "business", "cases", "commercial", "estate", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "interests", "land", "large", "legal", "lenders", "nearly", "outside", "payment", "property".... | EXACT TITLE in land_use_planning: "Title insurance".
0.500
Mediation ↗ Q223871 EXACT TITLE
agreementsamongassistanceauthoritycivilcommercialdisputesformformsindependentinterestslegallicensingpracticeprofessionaltraining
SHARED TOKENS (16): "agreements", "among", "assistance", "authority", "civil", "commercial", "disputes", "form", "forms", "independent", "interests", "legal", "licensing", "practice", "professional", "training". | EXACT TITLE in legal: "Mediation".
0.500
Real estate ↗ Q684740 EXACT TITLE
businesscommercialentityestategeneralgovernmentgrowinglandlegalnaturalnonprofitownedpropertypublicrealresourceswater
SHARED TOKENS (17): "business", "commercial", "entity", "estate", "general", "government", "growing", "land", "legal", "natural", "nonprofit", "owned", "property", "public", "real", "resources", "water". | EXACT TITLE in legal: "Real estate". | EXACT TITLE in land_use_planning: "Real estate".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyonclarkcommercialconstructioncreatedeasternfallsheavilyhistoryidahoirrigationlargelargestleadingnationalpopulationsprojectspublic
SHARED TOKENS (26): "agencies", "american", "canyon", "clark", "commercial", "construction", "created", "eastern", "falls", "heavily", "history", "idaho", "irrigation", "large", "largest", "leading", "national", "populations", "projects", "public".... | EXACT TITLE in legal: "Snake River".
0.500
Contract ↗ Q93288 EXACT TITLE
adoptionagreementsbusinesscivilcodecommercialenforcementframeworkgeneralgovernedindependentjudiciallegallitigationmeetingnationalobligationspracticerightstrade
SHARED TOKENS (20): "adoption", "agreements", "business", "civil", "code", "commercial", "enforcement", "framework", "general", "governed", "independent", "judicial", "legal", "litigation", "meeting", "national", "obligations", "practice", "rights", "trade". | EXACT TITLE in legal: "Contract". | EXACT TITLE in land_use_planning: "Contract".
0.500
agenciesagreementsdevelopmentenforcementenvironmentalgrowthjudicialjurisdictionlegalnationalnaturalorganizationspreservationprotectionregulatoryresourceresourcesrightssafetystatutes
SHARED TOKENS (21): "agencies", "agreements", "development", "enforcement", "environmental", "growth", "judicial", "jurisdiction", "legal", "national", "natural", "organizations", "preservation", "protection", "regulatory", "resource", "resources", "rights", "safety", "statutes".... | EXACT TITLE in legal: "Environmental law".
0.500
adaboisecombinedcommercialcommissiondepartmentfallsgeneralidahojointnationaloperatesprotectionrightssupportwestern
SHARED TOKENS (16): "ada", "boise", "combined", "commercial", "commission", "department", "falls", "general", "idaho", "joint", "national", "operates", "protection", "rights", "support", "western". | EXACT TITLE in land_use_planning: "Boise Airport".
0.500
adoptionappliesassetsbusinesscivilcodecommercialconductconsumerdistrictemploymentfinancefinancialfinancingformationframeworkgeneralgoverninsuranceinterstate
SHARED TOKENS (41): "adoption", "applies", "assets", "business", "civil", "code", "commercial", "conduct", "consumer", "district", "employment", "finance", "financial", "financing", "formation", "framework", "general", "govern", "insurance", "interstate".... | EXACT TITLE in legal: "Commercial law".
0.500
authoritybodiescodeconstructioncouncildepartmentsdevelopersdistrictenvironmentalestategeneralinsurancejurisdictionlocalnationalplanningproductspublicrealregulate
SHARED TOKENS (24): "authority", "bodies", "code", "construction", "council", "departments", "developers", "district", "environmental", "estate", "general", "insurance", "jurisdiction", "local", "national", "planning", "products", "public", "real", "regulate".... | EXACT TITLE in land_use_planning: "Building code".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteasterneducationelectedgovernedidaholargenampapopulationpublicresidentsservedsouthernsouthwest
SHARED TOKENS (24): "ada", "boise", "canyon", "college", "community", "counties", "development", "eastern", "education", "elected", "governed", "idaho", "large", "nampa", "population", "public", "residents", "served", "southern", "southwest".... | EXACT TITLE in land_use_planning: "College of Western Idaho".
0.500
casescivilcollectioncouncilcreateddevelopmentenforcementfinancialincomejointjurisdictionmemberminimumobligationspaymentrequiredrequiresreviewrightrights
SHARED TOKENS (22): "cases", "civil", "collection", "council", "created", "development", "enforcement", "financial", "income", "joint", "jurisdiction", "member", "minimum", "obligations", "payment", "required", "requires", "review", "right", "rights".... | EXACT TITLE in legal: "Child support".
0.500
communitydeterminesdevelopmentgeneralgrowthlandlargeplanningplanspublicrangerecreationregionalresultingzoning
SHARED TOKENS (15): "community", "determines", "development", "general", "growth", "land", "large", "planning", "plans", "public", "range", "recreation", "regional", "resulting", "zoning". | EXACT TITLE in land_use_planning: "Comprehensive planning".
0.480
analysisbusinessdatainstitutionalinsuranceknowledgenaturaloperationsorganizationsphysicalplanningrealsupportsystem
SHARED TOKENS (14): "analysis", "business", "data", "institutional", "insurance", "knowledge", "natural", "operations", "organizations", "physical", "planning", "real", "support", "system". | EXACT TITLE in land_use_planning: "Geographic information system".
0.480
Stormwater ↗ Q1421263 EXACT TITLE
bodiescitiesdemandeventsfallsgroundwaterlandlargenaturalpopulationresourcerightvolumewater
SHARED TOKENS (14): "bodies", "cities", "demand", "events", "falls", "groundwater", "land", "large", "natural", "population", "resource", "right", "volume", "water". | EXACT TITLE in land_use_planning: "Stormwater".
0.480
UrbanSim ↗ Q7899833 EXACT TITLE
agenciesdevelopmentenvironmentalfederallandnationalorgplanningprofessionalprotectionsupportsystemuniversitywww
SHARED TOKENS (14): "agencies", "development", "environmental", "federal", "land", "national", "org", "planning", "professional", "protection", "support", "system", "university", "www". | EXACT TITLE in land_use_planning: "UrbanSim".
0.480
agenciesagriculturalagricultureassistancedepartmentfocusleadinglocalnaturalprojectqualityresourcessetwater
SHARED TOKENS (14): "agencies", "agricultural", "agriculture", "assistance", "department", "focus", "leading", "local", "natural", "project", "quality", "resources", "set", "water". | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.480
aleneamongboisecoeurestablishedfallsidahoofficesoperatesprofessionalpublicstatewideuidahouniversity
SHARED TOKENS (14): "alene", "among", "boise", "coeur", "established", "falls", "idaho", "offices", "operates", "professional", "public", "statewide", "uidaho", "university". | EXACT TITLE in legal: "University of Idaho". | EXACT TITLE in land_use_planning: "University of Idaho".
0.480
americanboiseconsumercreateddatademandfoundedidahomarketownedproductssemiconductorservedtechnology
SHARED TOKENS (14): "american", "boise", "consumer", "created", "data", "demand", "founded", "idaho", "market", "owned", "products", "semiconductor", "served", "technology". | EXACT TITLE in land_use_planning: "Micron Technology".
0.480
amongcreatedemployersemploymentformgeneralinsurancemandatoryoutsidepaymentplansrightsystemworkers
SHARED TOKENS (14): "among", "created", "employers", "employment", "form", "general", "insurance", "mandatory", "outside", "payment", "plans", "right", "system", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.480
agriculturalagricultureannualcollectioncommissioncontextdevelopmentformsirrigationlandnaturalorganizationrequireszoning
SHARED TOKENS (14): "agricultural", "agriculture", "annual", "collection", "commission", "context", "development", "forms", "irrigation", "land", "natural", "organization", "requires", "zoning". | EXACT TITLE in land_use_planning: "Agricultural land".
0.480
authoritycasesconstitutionalfederalgovernmentheavilylandlegislaturepopulationpowerrightsstatutesstatutorytax
SHARED TOKENS (14): "authority", "cases", "constitutional", "federal", "government", "heavily", "land", "legislature", "population", "power", "rights", "statutes", "statutory", "tax". | EXACT TITLE in legal: "Constitutional law".
0.460
agenciescommunitydistributiongrowinggrowthland-useorganizationsplanningpracticeprojectregionalreviewwork
SHARED TOKENS (13): "agencies", "community", "distribution", "growing", "growth", "land-use", "organizations", "planning", "practice", "project", "regional", "review", "work". | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.460
casesclaimslandlegalpropertypublicrealrequiredrightrightsservesstatutestitle
SHARED TOKENS (13): "cases", "claims", "land", "legal", "property", "public", "real", "required", "right", "rights", "serves", "statutes", "title". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in land_use_planning: "Title (property)".
0.460
agenciescivilconstructiondepartmentsfirmsgovernmentmunicipalnationalphysicalprofessionalpublicstructuralworks
SHARED TOKENS (13): "agencies", "civil", "construction", "departments", "firms", "government", "municipal", "national", "physical", "professional", "public", "structural", "works". | EXACT TITLE in land_use_planning: "Civil engineering".
0.460
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilcourtsdisputesentityestablishedgovernmentjudicialjurisdictionlegallegislaturepower
SHARED TOKENS (13): "administrative", "authority", "civil", "courts", "disputes", "entity", "established", "government", "judicial", "jurisdiction", "legal", "legislature", "power". | EXACT TITLE in legal: "Court". | EXACT TITLE in land_use_planning: "Court".
0.460
Urban design ↗ Q63100 EXACT TITLE
architecturecitiescommunityenvironmentallandscapelocalphysicalplanningprojectpublicrangeregionalstreet
SHARED TOKENS (13): "architecture", "cities", "community", "environmental", "landscape", "local", "physical", "planning", "project", "public", "range", "regional", "street". | EXACT TITLE in land_use_planning: "Urban design".
0.460
amendmentassistancecannotcasesestablishedfederalgovernmentlawyerslegalofficepublicrepresentationrequires
SHARED TOKENS (13): "amendment", "assistance", "cannot", "cases", "established", "federal", "government", "lawyers", "legal", "office", "public", "representation", "requires". | EXACT TITLE in legal: "Public defender".
0.450
boisecreatedidaholegislatureoperations
SHARED TOKENS (5): "boise", "created", "idaho", "legislature", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.440
Divorce ↗ Q93190 EXACT TITLE
accessauthoritycivildebtdistributionlegalpartnerpropertyreligiousrequiredrequiressupport
SHARED TOKENS (12): "access", "authority", "civil", "debt", "distribution", "legal", "partner", "property", "religious", "required", "requires", "support". | EXACT TITLE in legal: "Divorce".
0.440
Green card ↗ Q6676995 EXACT TITLE
amongattorneycasescertificatefederalformgeneralmemberproceedingsremovalresidentsworkers
SHARED TOKENS (12): "among", "attorney", "cases", "certificate", "federal", "form", "general", "member", "proceedings", "removal", "residents", "workers". | EXACT TITLE in legal: "Green card".
0.420
accessadoptionhouseinterestsjointlegalmemberphysicalproceedingsrightrights
SHARED TOKENS (11): "access", "adoption", "house", "interests", "joint", "legal", "member", "physical", "proceedings", "right", "rights". | EXACT TITLE in legal: "Child custody".
0.420
alongsideamericancitieslargestnetworkprioritypublicqualitysinglesystemtraffic
SHARED TOKENS (11): "alongside", "american", "cities", "largest", "network", "priority", "public", "quality", "single", "system", "traffic". | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.420
associateddemandformsgovernmenthomeincomelocalmarketsnationalsetsupply
SHARED TOKENS (11): "associated", "demand", "forms", "government", "home", "income", "local", "markets", "national", "set", "supply". | EXACT TITLE in land_use_planning: "Affordable housing".
0.400
Pro bono ↗ Q127537 EXACT TITLE
communityenglishlegalpaymentproprofessionalprofessionalspublicspecialistwork
SHARED TOKENS (10): "community", "english", "legal", "payment", "pro", "professional", "professionals", "public", "specialist", "work". | EXACT TITLE in legal: "Pro bono".
0.400
Law firm ↗ Q613142 EXACT TITLE
assistancebusinesscasescivilentityfirmlawyerslegalpracticerights
SHARED TOKENS (10): "assistance", "business", "cases", "civil", "entity", "firm", "lawyers", "legal", "practice", "rights". | EXACT TITLE in legal: "Law firm".
0.400
agenciescouncildevelopmentenvironmentalfederalhouseofficeofficesqualityworks
SHARED TOKENS (10): "agencies", "council", "development", "environmental", "federal", "house", "office", "offices", "quality", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.400
associatedbeyonddatadevelopmenteventsknowledgeprojectsrelationshipsrepresentationsearch
SHARED TOKENS (10): "associated", "beyond", "data", "development", "events", "knowledge", "projects", "relationships", "representation", "search". | EXACT TITLE in land_use_planning: "Knowledge graph".
0.400
commercialdevelopersdevelopmentindustriallandlargeownedplatsinglesubdivision
SHARED TOKENS (10): "commercial", "developers", "development", "industrial", "land", "large", "owned", "plat", "single", "subdivision". | EXACT TITLE in legal: "Subdivision (land)". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.400
agreementscasescivilestategovernlegalpropertyrightrightssupport
SHARED TOKENS (10): "agreements", "cases", "civil", "estate", "govern", "legal", "property", "right", "rights", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.400
Probate ↗ Q6500369 EXACT TITLE
assetsclaimscourtsestatejudicialjurisdictionlegalpowerpropertypublic
SHARED TOKENS (10): "assets", "claims", "courts", "estate", "judicial", "jurisdiction", "legal", "power", "property", "public". | EXACT TITLE in legal: "Probate".
0.400
administrativeappliescodedevelopmentlandmunicipalsetstandardsvarianceszoning
SHARED TOKENS (10): "administrative", "applies", "code", "development", "land", "municipal", "set", "standards", "variances", "zoning". | EXACT TITLE in legal: "Variance (land use)". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.400
Canal ↗ Q12284 EXACT TITLE
canalcasesirrigationnaturalresourcesriversourcessupplyvalleywater
SHARED TOKENS (10): "canal", "cases", "irrigation", "natural", "resources", "river", "sources", "supply", "valley", "water". | EXACT TITLE in legal: "Canal". | EXACT TITLE in land_use_planning: "Canal".
0.400
Light rail ↗ Q1268865 EXACT TITLE
englishformoperatesoperatingoperationsrightright-of-waysystemtechnologytraffic
SHARED TOKENS (10): "english", "form", "operates", "operating", "operations", "right", "right-of-way", "system", "technology", "traffic". | EXACT TITLE in land_use_planning: "Light rail".
0.380
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivillegalobligationspracticepropertyrightsstatutory
SHARED TOKENS (9): "among", "assets", "civil", "legal", "obligations", "practice", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.380
Deed ↗ Q705914 EXACT TITLE
associatedattorneylegallicensespracticepropertyrightrightstitle
SHARED TOKENS (9): "associated", "attorney", "legal", "licenses", "practice", "property", "right", "rights", "title". | EXACT TITLE in land_use_planning: "Deed".
0.380
administrativecommercialconstructiondevelopmentinstitutionalplanningprojectssinglezoning
SHARED TOKENS (9): "administrative", "commercial", "construction", "development", "institutional", "planning", "projects", "single", "zoning". | EXACT TITLE in land_use_planning: "Mixed-use development".
0.380
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlegalprofessionalschoolsystemuniversity
SHARED TOKENS (9): "college", "department", "education", "jurisdiction", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.380
Jury ↗ Q837675 EXACT TITLE
bodiescivilenglishgrouplegalprofessionalsetsinglesystem
SHARED TOKENS (9): "bodies", "civil", "english", "group", "legal", "professional", "set", "single", "system". | EXACT TITLE in legal: "Jury".
0.380
Assault ↗ Q365680 EXACT TITLE
civilcombinedlegalphysicalpolicerangeseparatesinglesystem
SHARED TOKENS (9): "civil", "combined", "legal", "physical", "police", "range", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.380
americancasescivilgeneraljudiciallegalreviewsinglesystem
SHARED TOKENS (9): "american", "cases", "civil", "general", "judicial", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.380
citiesconstructiongovernmentgrowthlandprojectspublicrenewalset
SHARED TOKENS (9): "cities", "construction", "government", "growth", "land", "projects", "public", "renewal", "set". | EXACT TITLE in land_use_planning: "Urban renewal".
0.360
americancasesconductenglishentitylegalpropertyquality
SHARED TOKENS (8): "american", "cases", "conduct", "english", "entity", "legal", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.360
casescivilcommunityestateownedpropertyseparatesystem
SHARED TOKENS (8): "cases", "civil", "community", "estate", "owned", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.360
Adoption ↗ Q180472 EXACT TITLE
adoptiongovernedlegalrecognitionreligiousrequiresrightsstatutes
SHARED TOKENS (8): "adoption", "governed", "legal", "recognition", "religious", "requires", "rights", "statutes". | EXACT TITLE in legal: "Adoption". | EXACT TITLE in land_use_planning: "Adoption".
0.360
Immigration law ↗ EXACT TITLE
governmentlegalmaintainnationalregulaterightrightsstatutes
SHARED TOKENS (8): "government", "legal", "maintain", "national", "regulate", "right", "rights", "statutes". | EXACT TITLE in legal: "Immigration law".
0.360
actionsadministrativeauthoritycourtsgovernmentjudicialpowerreview
SHARED TOKENS (8): "actions", "administrative", "authority", "courts", "government", "judicial", "power", "review". | EXACT TITLE in land_use_planning: "Judicial review".
0.360
Bail ↗ Q162351 EXACT TITLE
additionalcasesformjudicialpolicepropertyrequiredset
SHARED TOKENS (8): "additional", "cases", "form", "judicial", "police", "property", "required", "set". | EXACT TITLE in land_use_planning: "Bail".
0.360
agriculturalcitiescoversidaholandlargestriversouthern
SHARED TOKENS (8): "agricultural", "cities", "covers", "idaho", "land", "largest", "river", "southern". | EXACT TITLE in legal: "Snake River Plain".
0.360
Creditor ↗ Q157165 EXACT TITLE
assetsdebtfinancialgeneralgovernmentorganizationpropertyrepresents
SHARED TOKENS (8): "assets", "debt", "financial", "general", "government", "organization", "property", "represents". | EXACT TITLE in legal: "Creditor".
0.340
Partnership ↗ Q728646 EXACT TITLE
businessgovernedinterestsorganizationorganizationspartnerpartners
SHARED TOKENS (7): "business", "governed", "interests", "organization", "organizations", "partner", "partners". | EXACT TITLE in land_use_planning: "Partnership".
0.340
assetsestatelegalnetplanningpropertytax
SHARED TOKENS (7): "assets", "estate", "legal", "net", "planning", "property", "tax". | EXACT TITLE in legal: "Estate planning". | EXACT TITLE in land_use_planning: "Estate planning".
0.340
Floodplain ↗ Q193110 EXACT TITLE
agriculturalexperienceheavilylandrivervalleywater
SHARED TOKENS (7): "agricultural", "experience", "heavily", "land", "river", "valley", "water". | EXACT TITLE in land_use_planning: "Floodplain".
0.340
civilcourtsfinaljurisdictionlegalreviewsingle
SHARED TOKENS (7): "civil", "courts", "final", "jurisdiction", "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.340
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahorangeriversawtoothwestern
SHARED TOKENS (7): "agricultural", "boise", "idaho", "range", "river", "sawtooth", "western". | EXACT TITLE in land_use_planning: "Boise River".
0.320
departmentfederalidahooperationsorganizationplanning
SHARED TOKENS (6): "department", "federal", "idaho", "operations", "organization", "planning". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.320
Wastewater ↗ Q336191 EXACT TITLE
agriculturalcommercialcommunityindustrialmunicipalwater
SHARED TOKENS (6): "agricultural", "commercial", "community", "industrial", "municipal", "water". | EXACT TITLE in land_use_planning: "Wastewater".
0.320
focuslandlegalpropertyrightstrade
SHARED TOKENS (6): "focus", "land", "legal", "property", "rights", "trade". | EXACT TITLE in legal: "Intellectual property".
0.320
analysisdataformformslargescale
SHARED TOKENS (6): "analysis", "data", "form", "forms", "large", "scale". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.320
Drainage ↗ Q7481320 EXACT TITLE
agriculturalgrowthlandnaturalremovalwater
SHARED TOKENS (6): "agricultural", "growth", "land", "natural", "removal", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.320
agenciesgovernmentplanningpublicrangesystem
SHARED TOKENS (6): "agencies", "government", "planning", "public", "range", "system". | EXACT TITLE in land_use_planning: "Transportation planning".
0.320
firmfoundedheadquarteredhouselargestsupply
SHARED TOKENS (6): "firm", "founded", "headquartered", "house", "largest", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.320
amendmentconstitutionalfederalpropertyregulatoryrights
SHARED TOKENS (6): "amendment", "constitutional", "federal", "property", "regulatory", "rights". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.300
Cartography ↗ Q42515 EXACT TITLE
landmapphysicalpracticeset
SHARED TOKENS (5): "land", "map", "physical", "practice", "set". | EXACT TITLE in land_use_planning: "Cartography".
0.300
alternativeamericanamongcannotcasescourtsdisputesgenerallegallitigationproceedingspublicrangerequiredrightshortsystemtrust
SHARED TOKENS (18): "alternative", "american", "among", "cannot", "cases", "courts", "disputes", "general", "legal", "litigation", "proceedings", "public", "range", "required", "right", "short", "system", "trust".
0.300
adaboisecanyoncitiescombinedcountieshomeidaholargestmeridiannampanearlypopulationtreasurevalley
SHARED TOKENS (15): "ada", "boise", "canyon", "cities", "combined", "counties", "home", "idaho", "largest", "meridian", "nampa", "nearly", "population", "treasure", "valley".
0.300
cannotcodeconstructiondevelopmentemploymentexpansionfinancinggovernmenthouseleadinglocalnationalpermitpermitsplanningplansregionalrequired
SHARED TOKENS (18): "cannot", "code", "construction", "development", "employment", "expansion", "financing", "government", "house", "leading", "local", "national", "permit", "permits", "planning", "plans", "regional", "required".
0.300
annualbusinesscompleteconductdebtdevelopmententityfinancefinancialfinancingfirmsformgrowthhistoryinstitutionalinvestorsmarketmarketsoperatingoperations
SHARED TOKENS (28): "annual", "business", "complete", "conduct", "debt", "development", "entity", "finance", "financial", "financing", "firms", "form", "growth", "history", "institutional", "investors", "market", "markets", "operating", "operations"....
0.300
agreementschangesemployersemploymentgroupinterestsorganizationregulaterightssafetysingletradetrainingworkworkers
SHARED TOKENS (15): "agreements", "changes", "employers", "employment", "group", "interests", "organization", "regulate", "rights", "safety", "single", "trade", "training", "work", "workers".
0.300
agriculturalcommunitydevelopmentdistrictsenvironmentalgrowthinterestslandlandscapenaturalownedplanningpreservationresourcessetwaterzoning
SHARED TOKENS (17): "agricultural", "community", "development", "districts", "environmental", "growth", "interests", "land", "landscape", "natural", "owned", "planning", "preservation", "resources", "set", "water", "zoning".
0.300
amongcasescitiescodedevelopersdevelopmentfeesfinancialincomelocalmandatorymunicipalplanningpracticeprojectprojectsresidentssupplytaxwork
SHARED TOKENS (21): "among", "cases", "cities", "code", "developers", "development", "fees", "financial", "income", "local", "mandatory", "municipal", "planning", "practice", "project", "projects", "residents", "supply", "tax", "work"....
0.300
administrativeappliesassociationcontextdevelopmentenvironmentalgovernedjudicialplansprogramprojectprojectspublicreviewstrategic
SHARED TOKENS (15): "administrative", "applies", "association", "context", "development", "environmental", "governed", "judicial", "plans", "program", "project", "projects", "public", "review", "strategic".
0.300
americancommercialdevelopmentdistrictenvironmentalindustriallandplanningplanspreservationrecreationrightsspecialsubdivisionzoning
SHARED TOKENS (15): "american", "commercial", "development", "district", "environmental", "industrial", "land", "planning", "plans", "preservation", "recreation", "rights", "special", "subdivision", "zoning".
0.300
agriculturalagriculturecivilconstructionenvironmentalgroundwaterlandland-uselandscapelargelocalnationalnaturalprotectionqualityregulationremovalresourceriversupply
SHARED TOKENS (21): "agricultural", "agriculture", "civil", "construction", "environmental", "groundwater", "land", "land-use", "landscape", "large", "local", "national", "natural", "protection", "quality", "regulation", "removal", "resource", "river", "supply"....
0.300
agreementsconditionconstitutionalcontextduesemployersemploymentfallsfederalfeegeneralgovernmentlocalmemberpublicrepresentationrequiredrightsetstatutes
SHARED TOKENS (21): "agreements", "condition", "constitutional", "context", "dues", "employers", "employment", "falls", "federal", "fee", "general", "government", "local", "member", "public", "representation", "required", "right", "set", "statutes"....
0.300
actionsactiveamericancasescivilcommunitycreatedformsgovernmentgroupminimumpermitspracticepublicreligiousrequiresrightrights
SHARED TOKENS (18): "actions", "active", "american", "cases", "civil", "community", "created", "forms", "government", "group", "minimum", "permits", "practice", "public", "religious", "requires", "right", "rights".
0.300
adabusinesschangescivilcouncileffectiveemployersfinalhouseinterestsjanuarynationalprotectionpublicrequiresrights
SHARED TOKENS (16): "ada", "business", "changes", "civil", "council", "effective", "employers", "final", "house", "interests", "january", "national", "protection", "public", "requires", "rights".
0.300
alternativecitiescombinedconstructiondemandindustriallandlargemunicipalnetworkoperatingpopulationqualityrangeratesremovaltechnologywater
SHARED TOKENS (18): "alternative", "cities", "combined", "construction", "demand", "industrial", "land", "large", "municipal", "network", "operating", "population", "quality", "range", "rates", "removal", "technology", "water".
0.300
accesscannotcommissionentityfederalformsgovernmentlargelocalmarketnaturaloperatesorganizationproductspublicregulationrepresentsscalestatewidesupply
SHARED TOKENS (21): "access", "cannot", "commission", "entity", "federal", "forms", "government", "large", "local", "market", "natural", "operates", "organization", "products", "public", "regulation", "represents", "scale", "statewide", "supply"....
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationbarcasescivilcompleteconstitutionalcorporatecourtsdepartmenteducationfederallegallicensedlitigationnationalofficepractice
SHARED TOKENS (29): "additional", "alongside", "american", "association", "bar", "cases", "civil", "complete", "constitutional", "corporate", "courts", "department", "education", "federal", "legal", "licensed", "litigation", "national", "office", "practice"....
0.300
activeadministeredagenciesauthoritybusinesscivilcombinedconductconstructiondepartmentenvironmentalfederalformgeneralgovernmentheadquarteredjunelargestnationaloffice
SHARED TOKENS (34): "active", "administered", "agencies", "authority", "business", "civil", "combined", "conduct", "construction", "department", "environmental", "federal", "form", "general", "government", "headquartered", "june", "largest", "national", "office"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
authoritycommercialcommissioncommunitycouncilcourtsdistrictdistrictsgeneralgovernmentindustriallandlayerlocalmaintainownerspropertypublicregulationright
SHARED TOKENS (26): "authority", "commercial", "commission", "community", "council", "courts", "district", "districts", "general", "government", "industrial", "land", "layer", "local", "maintain", "owners", "property", "public", "regulation", "right"....
0.300
agricultureamericanboiseconstructionfallshomeidahoirrigationmonthsnationalpowerprojectsresourceresultingriversawtoothwaterwesternwork
SHARED TOKENS (19): "agriculture", "american", "boise", "construction", "falls", "home", "idaho", "irrigation", "months", "national", "power", "projects", "resource", "resulting", "river", "sawtooth", "water", "western", "work".
0.300
accessagreementsattorneybusinesscannotcasescommunitydisputesemploymenteventsknowledgelegalmaterialprogramrequiredsingletrade
SHARED TOKENS (17): "access", "agreements", "attorney", "business", "cannot", "cases", "community", "disputes", "employment", "events", "knowledge", "legal", "material", "program", "required", "single", "trade".
0.300
authoritybusinesscommercialestategenerateincomelandlocalmaintainofficeofficespropertyrealtaxzoning
SHARED TOKENS (15): "authority", "business", "commercial", "estate", "generate", "income", "land", "local", "maintain", "office", "offices", "property", "real", "tax", "zoning".
0.300
activeadministrativeamericancasescourtscoveringcreateddistrictdistrictseasternfederalheadquarteredidahojudicialjurisdictionlargestlawyersmeetingsouthernwestern
SHARED TOKENS (20): "active", "administrative", "american", "cases", "courts", "covering", "created", "district", "districts", "eastern", "federal", "headquartered", "idaho", "judicial", "jurisdiction", "largest", "lawyers", "meeting", "southern", "western".
0.300
cannotincomelegalprofessionalstandards
SHARED TOKENS (5): "cannot", "income", "legal", "professional", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedcitiescommercialdevelopmentenvironmentalexpansionformgrowthindustriallandlargeplanningpopulationpropertyprotectionratesspecialsupporttaxzoning
SHARED TOKENS (20): "associated", "cities", "commercial", "development", "environmental", "expansion", "form", "growth", "industrial", "land", "large", "planning", "population", "property", "protection", "rates", "special", "support", "tax", "zoning".
0.300
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasescodecontractorsemployersemploymentgoverngovernmentjudiciallegislatureminimumregulatoryrightsstandardstradeworkworkers
SHARED TOKENS (17): "agencies", "cases", "code", "contractors", "employers", "employment", "govern", "government", "judicial", "legislature", "minimum", "regulatory", "rights", "standards", "trade", "work", "workers".
0.300
agreementsamongbusinesscasescompetitivecourtscoversemployersfirmleavelegalmarketmarketssupportsystemtradeworkers
SHARED TOKENS (17): "agreements", "among", "business", "cases", "competitive", "courts", "covers", "employers", "firm", "leave", "legal", "market", "markets", "support", "system", "trade", "workers".
0.300
amendmentamericanappliescivilconstitutionaleducationfederalgovernmentitselfjurisdictionlargelocalprotectionrequiresrightrights
SHARED TOKENS (16): "amendment", "american", "applies", "civil", "constitutional", "education", "federal", "government", "itself", "jurisdiction", "large", "local", "protection", "requires", "right", "rights".
0.300
accessbodiesconstitutionaldatadevelopmentformgeneralgovernmentinstitutionslegalpracticeprotectionpublicrightrightssupport
SHARED TOKENS (16): "access", "bodies", "constitutional", "data", "development", "form", "general", "government", "institutions", "legal", "practice", "protection", "public", "right", "rights", "support".
0.300
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesbodiesconditionconstitutionalcourtsenglishgovernmentlandlegalnaturalpowerproceedingsrequirementrightsstatutorytrade
SHARED TOKENS (19): "administrative", "agencies", "american", "applies", "bodies", "condition", "constitutional", "courts", "english", "government", "land", "legal", "natural", "power", "proceedings", "requirement", "rights", "statutory", "trade".
0.300
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsassociatedenforcementjurisdictionlegalmemberminimumofficeownersproductspropertyprotectionrightssourcesstandardstrade
SHARED TOKENS (17): "agencies", "agreements", "associated", "enforcement", "jurisdiction", "legal", "member", "minimum", "office", "owners", "products", "property", "protection", "rights", "sources", "standards", "trade".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycasescreatedestategovernmentgroundlandlegallocalminimumphysicalrealrightright-of-wayrightstraffic
SHARED TOKENS (16): "authority", "cases", "created", "estate", "government", "ground", "land", "legal", "local", "minimum", "physical", "real", "right", "right-of-way", "rights", "traffic".
0.300
associationbusinesscertificatecorporatecorporationentityformgovernedincomelegallicensememberoperatingoperationsorganizationownersphysicalprofessionalrequiredrights
SHARED TOKENS (22): "association", "business", "certificate", "corporate", "corporation", "entity", "form", "governed", "income", "legal", "license", "member", "operating", "operations", "organization", "owners", "physical", "professional", "required", "rights"....
0.300
activeamericanassociationcasescommercialcommunitycontextcreateddevelopmentduesestatefastest-growingformgoverngovernedgovernsgrowthindustrialjurisdictionland
SHARED TOKENS (36): "active", "american", "association", "cases", "commercial", "community", "context", "created", "development", "dues", "estate", "fastest-growing", "form", "govern", "governed", "governs", "growth", "industrial", "jurisdiction", "land"....
0.300
activecannotcaseschaptercodecourtscreateddistrictdistrictseffectivefederalgoverngovernmentinterestsitselfjudicialjurisdictionproceedingssystem
SHARED TOKENS (19): "active", "cannot", "cases", "chapter", "code", "courts", "created", "district", "districts", "effective", "federal", "govern", "government", "interests", "itself", "judicial", "jurisdiction", "proceedings", "system".
0.300
amendmentauthoritycasesconductconstitutionaldeterminesenforcementfederalgeneralgovernmentinterstatejurisdictionlegalphysicalpolicepowerpublicregulaterightssafety
SHARED TOKENS (23): "amendment", "authority", "cases", "conduct", "constitutional", "determines", "enforcement", "federal", "general", "government", "interstate", "jurisdiction", "legal", "physical", "police", "power", "public", "regulate", "rights", "safety"....
0.300
chapterclaimscodecourtsdebtfinancialformgeneralincomeliensplanspowerprioritypropertyprotectionstatutesstatutorytitle
SHARED TOKENS (18): "chapter", "claims", "code", "courts", "debt", "financial", "form", "general", "income", "liens", "plans", "power", "priority", "property", "protection", "statutes", "statutory", "title".
0.300
amongassociationboisecanyoncountiescreatedfederalformationidaholargestlocalnampanationalofficeprojectprojectsriversetsouthwesttreasure
SHARED TOKENS (23): "among", "association", "boise", "canyon", "counties", "created", "federal", "formation", "idaho", "largest", "local", "nampa", "national", "office", "project", "projects", "river", "set", "southwest", "treasure"....
0.300
activeadministrativeagenciesannualcasescitiescourtscoversdistrictestablishedfederalfinaljurisdictionlargelegalnationalpopulationreviewsetsystem
SHARED TOKENS (20): "active", "administrative", "agencies", "annual", "cases", "cities", "courts", "covers", "district", "established", "federal", "final", "jurisdiction", "large", "legal", "national", "population", "review", "set", "system".
0.300
knowledgelegalminimumnationalorganization
SHARED TOKENS (5): "knowledge", "legal", "minimum", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
associationattorneysbarbusinesscasescouncilenglishgeneraljurisdictionlawyerslegalmandatoryorganizationsphysicalpracticepracticingprofessionalpublicregulationseparate
SHARED TOKENS (21): "association", "attorneys", "bar", "business", "cases", "council", "english", "general", "jurisdiction", "lawyers", "legal", "mandatory", "organizations", "physical", "practice", "practicing", "professional", "public", "regulation", "separate"....
0.300
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycasescivilcourtsfinalformsjudiciallegallocalpracticepublicresourcesservesstandards
SHARED TOKENS (15): "agreements", "authority", "cases", "civil", "courts", "final", "forms", "judicial", "legal", "local", "practice", "public", "resources", "serves", "standards".
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
casescivilconductcourtsdeterminesfocusindependentjurisdictionlargelegalphysicalproceedingspublicrequiredreviewseparatespecial
SHARED TOKENS (17): "cases", "civil", "conduct", "courts", "determines", "focus", "independent", "jurisdiction", "large", "legal", "physical", "proceedings", "public", "required", "review", "separate", "special".
0.300
departmenteducationenforcementenvironmentalfederalfinancialgovernmenthouseindependentjanuarylegallocalnationalofficesprotectionpublicregionalspecialistsstandardsworks
SHARED TOKENS (20): "department", "education", "enforcement", "environmental", "federal", "financial", "government", "house", "independent", "january", "legal", "local", "national", "offices", "protection", "public", "regional", "specialists", "standards", "works".
0.300
boisecoveringcreateddistrictsemmetthomeidaholandmaintainnationalpopulationsrangerecreationresourcesriversawtoothwater
SHARED TOKENS (17): "boise", "covering", "created", "districts", "emmett", "home", "idaho", "land", "maintain", "national", "populations", "range", "recreation", "resources", "river", "sawtooth", "water".
0.300
amongauthoritycasescitiesconstructiondistrictdistrictselectedenvironmentalexplicitlygrowingjurisdictionlandlocaloperatingownedplanningpolicepowerproperty
SHARED TOKENS (27): "among", "authority", "cases", "cities", "construction", "district", "districts", "elected", "environmental", "explicitly", "growing", "jurisdiction", "land", "local", "operating", "owned", "planning", "police", "power", "property"....
0.300
agenciesauthorityeffectivegovernmenthealthcareindependentjurisdictionlicensingmarketsofficeproductsregulationregulatorysafetystandards
SHARED TOKENS (15): "agencies", "authority", "effective", "government", "healthcare", "independent", "jurisdiction", "licensing", "markets", "office", "products", "regulation", "regulatory", "safety", "standards".
0.300
casescontextlegallitigationpayment
SHARED TOKENS (5): "cases", "context", "legal", "litigation", "payment". | EXACT TITLE in land_use_planning: "Settlement (litigation)".
0.300
actionsaddressclaimsemploymentenforcementfinancialgovernmentinstitutionsorganizationorganizationsprotectionpublicregulatereportresourceswork
SHARED TOKENS (16): "actions", "address", "claims", "employment", "enforcement", "financial", "government", "institutions", "organization", "organizations", "protection", "public", "regulate", "report", "resources", "work".
0.300
adoptionauthoritycasescodeconsumercourtsdistrictfederalgovernedgovernsjudicialjurisdictionlienspropertyprotectionrightstaxtitle
SHARED TOKENS (18): "adoption", "authority", "cases", "code", "consumer", "courts", "district", "federal", "governed", "governs", "judicial", "jurisdiction", "liens", "property", "protection", "rights", "tax", "title".
0.300
administrativeagriculturedevelopmententityestablishedestatefederalfinancialgovernmentgrowthlandlegallocalmaintainmarketnonprofitorganizationownerspowerproperty
SHARED TOKENS (32): "administrative", "agriculture", "development", "entity", "established", "estate", "federal", "financial", "government", "growth", "land", "legal", "local", "maintain", "market", "nonprofit", "organization", "owners", "power", "property"....
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
actionsadministrativeamericananalysisassistanceassociationattorneybarbodiesbusinesscasesconductcorporationcourtscreateddepartmentsdraftingeducationentityestablished
SHARED TOKENS (47): "actions", "administrative", "american", "analysis", "assistance", "association", "attorney", "bar", "bodies", "business", "cases", "conduct", "corporation", "courts", "created", "departments", "drafting", "education", "entity", "established"....
0.300
agreementscommunityconstitutionalformformslegalmaterialmembernationalorganizationspowerprotectionpublicrightrightsspecialtrade
SHARED TOKENS (17): "agreements", "community", "constitutional", "form", "forms", "legal", "material", "member", "national", "organizations", "power", "protection", "public", "right", "rights", "special", "trade".
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
addressarchitectureassociatedcommunitycoversdevelopmentestatelandland-usemunicipalplanningpopulationpreservationrangerealregionalsupplysupporttraffic
SHARED TOKENS (19): "address", "architecture", "associated", "community", "covers", "development", "estate", "land", "land-use", "municipal", "planning", "population", "preservation", "range", "real", "regional", "supply", "support", "traffic".
0.300
approvalscommercialconstructioncontextcontractorsdevelopersdevelopmentenvironmentalestatefinancialfinancinggrowthlandlawyerspermitsplanningplansprogramprojectsproperty
SHARED TOKENS (26): "approvals", "commercial", "construction", "context", "contractors", "developers", "development", "environmental", "estate", "financial", "financing", "growth", "land", "lawyers", "permits", "planning", "plans", "program", "projects", "property"....
0.300
Probate court ↗ Q7246899 KW CROSS HIGH
actionsassetsauthoritycasescountiescourtscreateddeterminesdistributiondistrictestatejudicialjurisdictionpropertystatutorytrusts
SHARED TOKENS (16): "actions", "assets", "authority", "cases", "counties", "courts", "created", "determines", "distribution", "district", "estate", "judicial", "jurisdiction", "property", "statutory", "trusts".
🫐 BERRY106 edges
0.280
amendmentappliesassistanceattorneycasescommunitydistrictgovernmentmonthspublicrequirementrequiresrightrights
SHARED TOKENS (14): "amendment", "applies", "assistance", "attorney", "cases", "community", "district", "government", "months", "public", "requirement", "requires", "right", "rights".
0.280
Felony ↗ Q178844 EXACT TITLE
additionalcivilenglishland
SHARED TOKENS (4): "additional", "civil", "english", "land". | EXACT TITLE in legal: "Felony".
0.280
actionscorporationfinalfirmintegrationlargemarketmemberownedproducesproductsriversupplyvertical
SHARED TOKENS (14): "actions", "corporation", "final", "firm", "integration", "large", "market", "member", "owned", "produces", "products", "river", "supply", "vertical".
0.280
agriculturalcontractorsemployersestablishedfederalformationgovernmentindependentnationalorganizationpowerrighttradeworkers
SHARED TOKENS (14): "agricultural", "contractors", "employers", "established", "federal", "formation", "government", "independent", "national", "organization", "power", "right", "trade", "workers".
0.280
administrativeassociationcivilformgrouplegalnaturalorganizationsphysicalprotectionrightrightssafetysystem
SHARED TOKENS (14): "administrative", "association", "civil", "form", "group", "legal", "natural", "organizations", "physical", "protection", "right", "rights", "safety", "system".
0.280
agenciesdistributionenvironmentallandnaturalplanningplansprojectsqualityresourcesrightsspecialistssupplywater
SHARED TOKENS (14): "agencies", "distribution", "environmental", "land", "natural", "planning", "plans", "projects", "quality", "resources", "rights", "specialists", "supply", "water".
0.280
districtlandpermitzoning
SHARED TOKENS (4): "district", "land", "permit", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.280
amongannualchangesclaimscourtsfirmgovernmentgrouphistorylegaloutsideprogramratesrepresentation
SHARED TOKENS (14): "among", "annual", "changes", "claims", "courts", "firm", "government", "group", "history", "legal", "outside", "program", "rates", "representation".
0.280
agenciesamendmentappliesassociationcasescivilconstitutionalfinanceformsgovernmentreligiousrightrightsschool
SHARED TOKENS (14): "agencies", "amendment", "applies", "association", "cases", "civil", "constitutional", "finance", "forms", "government", "religious", "right", "rights", "school".
0.280
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycompletedevelopmentemploymentfocusgovernmentgrowthlandnaturalplanningpublicrangeregionalresources
SHARED TOKENS (14): "community", "complete", "development", "employment", "focus", "government", "growth", "land", "natural", "planning", "public", "range", "regional", "resources".
0.280
Identity theft ↗ Q471880 KW CROSS HIGH
accessactionsdatafinancialgovernmentlargestlicenseofficeprogramrecordsreportresourcestechnologyuniversity
SHARED TOKENS (14): "access", "actions", "data", "financial", "government", "largest", "license", "office", "program", "records", "report", "resources", "technology", "university".
0.280
amendmentappliesconstitutionalfederalgovernmentlocalpolicepropertyprotectionpublicrequirementrequiresrightrights
SHARED TOKENS (14): "amendment", "applies", "constitutional", "federal", "government", "local", "police", "property", "protection", "public", "requirement", "requires", "right", "rights".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
actionsamonglegal
SHARED TOKENS (3): "actions", "among", "legal". | EXACT TITLE in legal: "Manslaughter".
0.260
accessbusinesscreateddepartmentdevelopmentfederalgovernmentlocalpropertyrequirementresourcessupporttraining
SHARED TOKENS (13): "access", "business", "created", "department", "development", "federal", "government", "local", "property", "requirement", "resources", "support", "training".
0.260
Complaint ↗ Q836925 KW CROSS HIGH
associatedauthoritycasescivilcourtsfederalgovernlegallitigationpolicepowerstatutessupport
SHARED TOKENS (13): "associated", "authority", "cases", "civil", "courts", "federal", "govern", "legal", "litigation", "police", "power", "statutes", "support".
0.260
analysiscollectioncombineddatademandemploymentenvironmentalfinancialplanningpopulationprojectsratestraffic
SHARED TOKENS (13): "analysis", "collection", "combined", "data", "demand", "employment", "environmental", "financial", "planning", "population", "projects", "rates", "traffic".
0.260
distributiongovernmentjudiciallargepracticeproductsregulateregulationreligioussetsystemtaxvolume
SHARED TOKENS (13): "distribution", "government", "judicial", "large", "practice", "products", "regulate", "regulation", "religious", "set", "system", "tax", "volume".
0.260
administersdepartmentdepartmentsdevelopmentfederalfinancingfoundedgovernmenthomehousememberprogramreports
SHARED TOKENS (13): "administers", "department", "departments", "development", "federal", "financing", "founded", "government", "home", "house", "member", "program", "reports".
0.260
adaboiseconstructionfederalformsidahoirrigationoperatingpowerrangeriversouthernwestern
SHARED TOKENS (13): "ada", "boise", "construction", "federal", "forms", "idaho", "irrigation", "operating", "power", "range", "river", "southern", "western".
0.260
administrativecannotcivilclaimscommissionemployersemploymentestablishedfederalgovernmentnationalpracticerights
SHARED TOKENS (13): "administrative", "cannot", "civil", "claims", "commission", "employers", "employment", "established", "federal", "government", "national", "practice", "rights".
0.250
constitutionalelectedgovernmentidahooffice
SHARED TOKENS (5): "constitutional", "elected", "government", "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.240
administeredagenciesauthoritycodedevelopmentfederalgrowthnationalpreservationrequiresservestrade
SHARED TOKENS (12): "administered", "agencies", "authority", "code", "development", "federal", "growth", "national", "preservation", "requires", "serves", "trade".
0.240
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialcompetitiveformslegallicensedmaintainpropertytrade
SHARED TOKENS (12): "agreements", "among", "assets", "business", "commercial", "competitive", "forms", "legal", "licensed", "maintain", "property", "trade".
0.240
addressamendmentestablishedfederalgovernmenthistorylegallocalphysicalpropertyrightssearch
SHARED TOKENS (12): "address", "amendment", "established", "federal", "government", "history", "legal", "local", "physical", "property", "rights", "search".
0.240
actionscodeemploymentformgenerallegalorganizationsphysicalproprofessionalrelationshipswork
SHARED TOKENS (12): "actions", "code", "employment", "form", "general", "legal", "organizations", "physical", "pro", "professional", "relationships", "work".
0.240
adaboisecanalcanyoncountiesidahoirrigationrivertreasurevalleywaterwestern
SHARED TOKENS (12): "ada", "boise", "canal", "canyon", "counties", "idaho", "irrigation", "river", "treasure", "valley", "water", "western".
0.240
analysisassociatedcivilcourtsjurisdictionlegalproceedingspropertyrequiressetstatutesstatutory
SHARED TOKENS (12): "analysis", "associated", "civil", "courts", "jurisdiction", "legal", "proceedings", "property", "requires", "set", "statutes", "statutory".
0.240
additionaladministeredcoversdepartmentelectedemployersleavemembermonthspublicworkworkers
SHARED TOKENS (12): "additional", "administered", "covers", "department", "elected", "employers", "leave", "member", "months", "public", "work", "workers".
0.240
Road transport ↗ KW CROSS HIGH
developmentformslargelicensinglocalsafetyseparateshortspecialspecialisttrafficvolume
SHARED TOKENS (12): "development", "forms", "large", "licensing", "local", "safety", "separate", "short", "special", "specialist", "traffic", "volume".
0.240
Lawsuit ↗ Q697327 KW CROSS HIGH
actionsattorneysbusinesscivilclaimsdisputeslegallitigationorganizationspublicrequiredright
SHARED TOKENS (12): "actions", "attorneys", "business", "civil", "claims", "disputes", "legal", "litigation", "organizations", "public", "required", "right".
0.240
Beneficiary ↗ Q2596417 KW CROSS HIGH
assetscontextcreateddevelopmententityfinanceinsurancelegalpaymentprojectstrusttrusts
SHARED TOKENS (12): "assets", "context", "created", "development", "entity", "finance", "insurance", "legal", "payment", "projects", "trust", "trusts".
0.220
amendmentconductknowledgelegalpolicepowerpropertyrequiredrequirementrightsearch
SHARED TOKENS (11): "amendment", "conduct", "knowledge", "legal", "police", "power", "property", "required", "requirement", "right", "search".
0.220
casescivilcourtscoversdisputesdistrictdistrictsfederaljudicialjurisdictionresidents
SHARED TOKENS (11): "cases", "civil", "courts", "covers", "disputes", "district", "districts", "federal", "judicial", "jurisdiction", "residents".
0.220
agenciesauthoritycommissioncommissionerscoversfederalfinanciallitigationorganizationsregulationregulatory
SHARED TOKENS (11): "agencies", "authority", "commission", "commissioners", "covers", "federal", "financial", "litigation", "organizations", "regulation", "regulatory".
0.220
Civil liberties ↗ Q29556 KW CROSS HIGH
authoritycivilexpandinggovernmentjudicialpowerpropertyprotectionrightrightswork
SHARED TOKENS (11): "authority", "civil", "expanding", "government", "judicial", "power", "property", "protection", "right", "rights", "work".
0.220
Attorney ↗ Q1289214 EXACT TITLE
attorneypower
SHARED TOKENS (2): "attorney", "power". | EXACT TITLE in legal: "Attorney". | EXACT TITLE in land_use_planning: "Attorney".
0.220
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployersemploymentnationalratessectorssupplytradeworkworkersworks
SHARED TOKENS (11): "beyond", "employers", "employment", "national", "rates", "sectors", "supply", "trade", "work", "workers", "works".
0.220
assistancecivil
SHARED TOKENS (2): "assistance", "civil". | EXACT TITLE in land_use_planning: "Discovery (law)".
0.220
civilgovernment
SHARED TOKENS (2): "civil", "government". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.220
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
agricultureamericanboisecivilcountiesidahoirrigationnationalriverwaterwestern
SHARED TOKENS (11): "agriculture", "american", "boise", "civil", "counties", "idaho", "irrigation", "national", "river", "water", "western".
0.220
Probation ↗ Q13961 KW CROSS HIGH
appliescommunitycourtsjurisdictionleavemaintainpartnerpermitprogramrequiredset
SHARED TOKENS (11): "applies", "community", "courts", "jurisdiction", "leave", "maintain", "partner", "permit", "program", "required", "set".
0.220
actionsattorneycombinedcompleteformhealthcareitselfjurisdictionlegalpowersingle
SHARED TOKENS (11): "actions", "attorney", "combined", "complete", "form", "healthcare", "itself", "jurisdiction", "legal", "power", "single".
0.220
agriculturalagriculturedevelopmentenglishentitygeneralgovernmentlandlandscapenaturalpublic
SHARED TOKENS (11): "agricultural", "agriculture", "development", "english", "entity", "general", "government", "land", "landscape", "natural", "public".
0.210
Parcel ↗ EXACT TITLE
land
SHARED TOKENS (1): "land". | EXACT TITLE in land_use_planning: "Parcel".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in legal: "Subdivision". | EXACT TITLE in land_use_planning: "Subdivision".
0.210
Paternity ↗ Q16881001 EXACT TITLE
house
SHARED TOKENS (1): "house". | EXACT TITLE in legal: "Paternity".
0.200
amongcorporationdetermineseasternenglishlandpropertyrightssystemwater
SHARED TOKENS (10): "among", "corporation", "determines", "eastern", "english", "land", "property", "rights", "system", "water".
0.200
EXACT TITLE in land_use_planning: "Soil survey".
0.200
additionalcasesemployershistorylendersnationalpolicerecordsresultingtraffic
SHARED TOKENS (10): "additional", "cases", "employers", "history", "lenders", "national", "police", "records", "resulting", "traffic".
0.200
cannotcasesconductdisputesinsurancelegalpublicrecognitionspecialsystem
SHARED TOKENS (10): "cannot", "cases", "conduct", "disputes", "insurance", "legal", "public", "recognition", "special", "system".
0.200
amendmentcannotenforcementknowledgepoliceproceedingsprotectionrequiredrightrights
SHARED TOKENS (10): "amendment", "cannot", "enforcement", "knowledge", "police", "proceedings", "protection", "required", "right", "rights".
0.200
Family law ↗ Q384014 EXACT TITLE
domesticfamilymattersrelations
EXACT TITLE in legal: "Family law".
0.200
casescivilenforcementformlegalpolicepropertypublicrightsearch
SHARED TOKENS (10): "cases", "civil", "enforcement", "form", "legal", "police", "property", "public", "right", "search".
0.200
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesconditiondeterminesdistributionestateformsjurisdictionpropertyresultingstatutory
SHARED TOKENS (10): "applies", "condition", "determines", "distribution", "estate", "forms", "jurisdiction", "property", "resulting", "statutory".
0.200
businessdevelopmentformgrowthlandnetworkplanningpublicscaleserving
SHARED TOKENS (10): "business", "development", "form", "growth", "land", "network", "planning", "public", "scale", "serving".
0.200
amongannexationcitiesexpandinggovernmentjurisdictionlocalmunicipalterritorywork
SHARED TOKENS (10): "among", "annexation", "cities", "expanding", "government", "jurisdiction", "local", "municipal", "territory", "work".
0.200
amongcommissiondistrictinvestorslegalownedpublicregulationregulatoryserves
SHARED TOKENS (10): "among", "commission", "district", "investors", "legal", "owned", "public", "regulation", "regulatory", "serves".
0.200
associateddepartmentsfinancialgovernmentnationalorganizationspropertyratesstreettraffic
SHARED TOKENS (10): "associated", "departments", "financial", "government", "national", "organizations", "property", "rates", "street", "traffic".
0.200
Right to property ↗ KW CROSS HIGH
amendmentcivilgenerallegalnaturalpaymentpropertyprotectionrightrights
SHARED TOKENS (10): "amendment", "civil", "general", "legal", "natural", "payment", "property", "protection", "right", "rights".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will". | EXACT TITLE in land_use_planning: "Will".
0.200
communitydevelopmentdistrictfinancingprogramprojectprojectspropertypublictax
SHARED TOKENS (10): "community", "development", "district", "financing", "program", "project", "projects", "property", "public", "tax".
0.200
civilcourtsenglishformsirrigationlandlegalpowersystemwater
SHARED TOKENS (10): "civil", "courts", "english", "forms", "irrigation", "land", "legal", "power", "system", "water".
0.180
Family court ↗ Q82749 KW CROSS HIGH
addresscaseschangescourtscreatedlegalrelationshipssupportsystem
SHARED TOKENS (9): "address", "cases", "changes", "courts", "created", "legal", "relationships", "support", "system".
0.180
Expungement ↗ Q2352928 KW CROSS HIGH
enforcementfederalgeneraljurisdictionlegalproceedingspublicrecordsreview
SHARED TOKENS (9): "enforcement", "federal", "general", "jurisdiction", "legal", "proceedings", "public", "records", "review".
0.180
Tort ↗ Q158970 KW CROSS HIGH
actionscivilcodeenglishestablishedlegalobligationsresultingseparate
SHARED TOKENS (9): "actions", "civil", "code", "english", "established", "legal", "obligations", "resulting", "separate".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictgrowinghouseidahopopulationschool
SHARED TOKENS (9): "ada", "boise", "canyon", "district", "growing", "house", "idaho", "population", "school".
0.180
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasescreatedenforcementgovernmentpermitsphysicalprotectionset
SHARED TOKENS (9): "agencies", "cases", "created", "enforcement", "government", "permits", "physical", "protection", "set".
0.180
additionalcaseshomeincomememberprincipalpropertyseparatesupport
SHARED TOKENS (9): "additional", "cases", "home", "income", "member", "principal", "property", "separate", "support".
0.180
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerdebtentityfirmgovernmentlegalpriorityrequires
SHARED TOKENS (9): "agreements", "consumer", "debt", "entity", "firm", "government", "legal", "priority", "requires".
0.180
americanattorneyscivillawyersleadinglegalmemberpublictrade
SHARED TOKENS (9): "american", "attorneys", "civil", "lawyers", "leading", "legal", "member", "public", "trade".
0.180
addresscivilcommercialgovernedlegalpropertyrealrequiredrights
SHARED TOKENS (9): "address", "civil", "commercial", "governed", "legal", "property", "real", "required", "rights".
0.180
accesscommunitycompleteenvironmentalhomepublicrequiressafetytraffic
SHARED TOKENS (9): "access", "community", "complete", "environmental", "home", "public", "requires", "safety", "traffic".
0.180
boisecitiesfallshomeidahointerstaterangeriverserves
SHARED TOKENS (9): "boise", "cities", "falls", "home", "idaho", "interstate", "range", "river", "serves".
0.160
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotinterestslegalmemberprofessionalpropertypublic
SHARED TOKENS (8): "authority", "cannot", "interests", "legal", "member", "professional", "property", "public".
0.160
Criminal law ↗ Q146491 KW CROSS HIGH
civilcommissionconductestablishedjurisdictionlegislaturepropertysafety
SHARED TOKENS (8): "civil", "commission", "conduct", "established", "jurisdiction", "legislature", "property", "safety".
0.160
Drug court ↗ Q5308883 KW CROSS HIGH
addressbarcombinedcourtsenforcementleadingpublicwork
SHARED TOKENS (8): "address", "bar", "combined", "courts", "enforcement", "leading", "public", "work".
0.160
Street network ↗ Q358078 KW CROSS HIGH
analysiscitiesedgesnationalnetworkstreetsystemtraffic
SHARED TOKENS (8): "analysis", "cities", "edges", "national", "network", "street", "system", "traffic".
0.160
americanemploymentjunepermitprotectionrightsupportwork
SHARED TOKENS (8): "american", "employment", "june", "permit", "protection", "right", "support", "work".
0.160
businessentitylegalownedownersseparatetradework
SHARED TOKENS (8): "business", "entity", "legal", "owned", "owners", "separate", "trade", "work".
0.160
appliescannotcasescourtsformmaterialrealsupport
SHARED TOKENS (8): "applies", "cannot", "cases", "courts", "form", "material", "real", "support".
0.160
Legal clinic ↗ Q1351667 KW CROSS HIGH
conductexperiencelawyerslegalproprogramschoolwork
SHARED TOKENS (8): "conduct", "experience", "lawyers", "legal", "pro", "program", "school", "work".
0.140
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsuranceobligationsprincipalpropertytransactiontrust
SHARED TOKENS (7): "established", "insurance", "obligations", "principal", "property", "transaction", "trust".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboisefastest-growingidahonearlypopulation
SHARED TOKENS (7): "ada", "additional", "boise", "fastest-growing", "idaho", "nearly", "population".
0.140
Sex offender ↗ Q5659979 KW CROSS HIGH
civilcontinuingjurisdictionlegalmandatorypublicstatutory
SHARED TOKENS (7): "civil", "continuing", "jurisdiction", "legal", "mandatory", "public", "statutory".
0.140
Parole ↗ Q5357120 KW CROSS HIGH
additionalassociatedformoutsideservedservingsystem
SHARED TOKENS (7): "additional", "associated", "form", "outside", "served", "serving", "system".
0.140
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualcontractorsemployersindependentleavework
SHARED TOKENS (7): "among", "annual", "contractors", "employers", "independent", "leave", "work".
0.140
Trial court ↗ Q3125101 KW CROSS HIGH
authoritycasescourtsestablishedjurisdictionpowerreview
SHARED TOKENS (7): "authority", "cases", "courts", "established", "jurisdiction", "power", "review".
0.140
administrativefederallegalofficeproceedingsremovalreview
SHARED TOKENS (7): "administrative", "federal", "legal", "office", "proceedings", "removal", "review".
0.140
Injunction ↗ Q6495575 KW CROSS HIGH
civilconductcourtsenglishformlegalspecial
SHARED TOKENS (7): "civil", "conduct", "courts", "english", "form", "legal", "special".
0.140
attorneyattorneyseffectivelegalprofessionalrepresentationright
SHARED TOKENS (7): "attorney", "attorneys", "effective", "legal", "professional", "representation", "right".
0.140
americanassociationidahomemberownersservingwestern
SHARED TOKENS (7): "american", "association", "idaho", "member", "owners", "serving", "western".
0.140
attorneybusinessfinancialformlegalpowerprincipal
SHARED TOKENS (7): "attorney", "business", "financial", "form", "legal", "power", "principal".
0.140
chaptercodefederalformgoverngovernstitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "govern", "governs", "title".
0.120
administeredassociationbarjurisdictionpracticerequired
SHARED TOKENS (6): "administered", "association", "bar", "jurisdiction", "practice", "required".
0.120
Summons ↗ Q708245 KW CROSS HIGH
administrativeformgovernmentjudiciallegalproceedings
SHARED TOKENS (6): "administrative", "form", "government", "judicial", "legal", "proceedings".
0.120
Magistrate ↗ Q4594605 KW CROSS HIGH
administerscasescivilgovernmentjudiciallocal
SHARED TOKENS (6): "administers", "cases", "civil", "government", "judicial", "local".
0.120
Legal ethics ↗ Q3655952 KW CROSS HIGH
conductdevelopmentitselflegalpracticeprofessional
SHARED TOKENS (6): "conduct", "development", "itself", "legal", "practice", "professional".
0.120
Damages ↗ Q308922 KW CROSS HIGH
formgenerallegalphysicalpropertyspecial
SHARED TOKENS (6): "form", "general", "legal", "physical", "property", "special".
0.120
Fraud ↗ Q28813 KW CROSS HIGH
casescivilitselflegalpropertyright
SHARED TOKENS (6): "cases", "civil", "itself", "legal", "property", "right".
0.120
businessdevelopmentestateindustrialofficeoffices
SHARED TOKENS (6): "business", "development", "estate", "industrial", "office", "offices".
0.100
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlegalpublicrights
SHARED TOKENS (5): "employment", "jurisdiction", "legal", "public", "rights".
0.100
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfinanciallegalrequiredsupport
SHARED TOKENS (5): "agreements", "financial", "legal", "required", "support".
0.100
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbusinesslegalquality
SHARED TOKENS (5): "applies", "assets", "business", "legal", "quality".
0.100
Discrimination ↗ Q169207 KW CROSS HIGH
groupinstitutionslegalreligiousrights
SHARED TOKENS (5): "group", "institutions", "legal", "religious", "rights".
0.100
Deposition ↗ Q1174534 KW CROSS HIGH
authorityoutsidepowerremovaluniversity
SHARED TOKENS (5): "authority", "outside", "power", "removal", "university".
◈ Frequently Asked Questions
Legal × Land Use Planning — Treasure Valley
HAIKU · HIGH GATE
How do zoning ordinances in Ada County enforce the Clean Water Act on new residential developments?
Ada County's zoning code incorporates Clean Water Act compliance requirements to protect the Snake River and local aquifer resources during land subdivision and annexation. Local zoning boards review development proposals to ensure stormwater management and water right protections align with federal Clean Water Act standards before issuing permits.
What legal authority does the Idaho Legislature give to Boise for eminent domain takings in land-use planning?
The Idaho Legislature delegates eminent domain authority to the City of Boise through state statute, allowing the city to acquire private land for public land-use plans including parks, roads, and water infrastructure. Boise must follow statutory procedures and pay just compensation, with disputes resolved by the Idaho Supreme Court if landowners challenge the public purpose determination.
How does the National Environmental Policy Act apply to Treasure Valley annexation projects?
Projects requiring federal permits or funding—such as water system expansions tied to Boise's annexation of Treasure Valley land—trigger National Environmental Policy Act review obligations. The Idaho Legislature has required local governments to coordinate NEPA documentation with their zoning and comprehensive plan amendments to avoid legal challenges.
Can water rights disputes prevent land-use planning approval in the Treasure Valley?
Yes; Ada County and Boise planning departments must verify existing water rights and easements before approving subdivisions or zoning changes, as the Idaho Supreme Court has upheld senior water rights claims over subsequent land development. Mechanic's lien holders and water right owners can delay or block annexation and development permits if their claims are unresolved.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Land Use Planning 28 QID bridges 291 edges 8,163 ext links 2026-07-17 21:47:55 UTC 8e9d1f9e3a362ab5
Legal corridor ↗ Land Use Planning corridor ↗ Land Use Planning × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals