—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Sports Recreation

16 Wikipedia bridge articles confirmed in both vertical ledgers. 325 deterministic cross-vertical edges. 9,067 external source links harvested. Every edge provenance-stamped. Every claim auditable.

16 QID Bridge Articles
325 Cross Edges
9,067 External Sources
369 Wikipedia Articles
15 🌲 Evergreen
173 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Sports Recreation
QID Bridge Articles
16
confirmed Wikipedia overlap
Total Cross Edges
325
External Sources Harvested
9,067
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Land-use planning
score: 1.0000  ·  type: exact_title_cross  ·  22 shared tokens
QID Bridge Titles (16)
Land-use planningBoise State UniversityTreasure ValleyWater rightAmericans with Disabilities Act of 1990Nampa, IdahoBoise, IdahoGarden City, IdahoPrivate equityAda County, IdahoMeridian, IdahoCanyon County, IdahoCaldwell, IdahoNegligenceEagle, IdahoPremises liability
Shared Semantics (20 tokens)
boiseidahopopulationadasecondlawchangeslandphysicalbusinesscollegepublicwestnamerivercanyonnorthwestassociationcitiesdevelopment
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:49:47 UTC
Content Hash
54715e19fd9dd319
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
16 BRIDGES
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in legal (tier:branch) and sports_recreation (tier:evergreen). | SHARED TOKENS (22): "american", "association", "authority", "changes", "cities", "community", "development", "districts", "environmental", "founded", "land", "land-use", "needs", "physical", "planning", "project", "regional", "regulate", "regulation", "resources".... | EXACT TITLE in sports_recreation: "Land-use planning".
americanassociationauthoritychangescitiescommunitydevelopmentdistrictsenvironmentalfoundedlandland-useneedsphysicalplanningprojectregionalregulateregulationresourcessecondwater
ic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
Indigenous communities Land use planning is an important method for sustainable development for Indigenous communities. Indigenous peoples in the United States and Canada often have fragmented or diminishing land bases with limited uses. Oftentimes, these land bases are also far from urban centers and with limited expansion ability. Since European settlers first began colonizing the American Continent, Indigenous peoples have lost 98.9% of their land, a Yale study found. The lands indigenous peoples were forced onto are facing current and future climate-change related risks. This fact leads to the perpetuation of systematic inequity for Indigenous peoples, since livelihoods, preservation of culture and tradition, access to adequate housing, and access to resources are all factors that are deeply rooted in land. Many Indigenous groups are embracing land use planning to determine the future of their territories. In Canada, for example, the Dehcho First Nations have developed a land use plan that honors cultural traditions and Elders' knowledge, and incorporates conservation, development zones, and other categories.
Boise State University
EXACT TITLE 0.980
QID OVERLAP: Q891082 in legal (tier:branch) and sports_recreation (tier:evergreen). | SHARED TOKENS (14): "among", "boise", "business", "college", "education", "founded", "idaho", "independent", "mountain", "program", "public", "school", "university", "west". | EXACT TITLE in sports_recreation: "Boise State University".
amongboisebusinesscollegeeducationfoundedidahoindependentmountainprogrampublicschooluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in legal (tier:evergreen) and sports_recreation (tier:evergreen). | SHARED TOKENS (11): "association", "boise", "idaho", "land", "local", "name", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in sports_recreation: "Treasure Valley".
associationboiseidaholandlocalnameresourcesrivertreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
W
Q7973730 EXACT TITLE 0.840
QID OVERLAP: Q7973730 in legal (tier:evergreen) and sports_recreation (tier:branch). | SHARED TOKENS (7): "irrigation", "law", "legal", "physical", "river", "surface", "water". | EXACT TITLE in legal: "Water right".
irrigationlawlegalphysicalriversurfacewater
g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
Based on ownership of the land Often, water rights are based on ownership of the land upon which the water rests or flows. For example, under English common law, any rights asserted to "moveable and wandering" water must be based upon rights to the "permanent and immovable" land below. On streams and rivers, these are referred to as riparian rights or littoral rights, which are protected by property law. Legal principles long recognized under riparian principles involve the right to remove the water – for drinking or irrigation – or to add more water into the channel – for drainage or effluence. Under riparian law, water rights are subject to the test of "reasonable use".
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.780
QID OVERLAP: Q1111004 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (14): "ada", "business", "changes", "civil", "employees", "employers", "individuals", "law", "national", "prohibits", "protection", "public", "requires", "rights".
adabusinesschangescivilemployeesemployersindividualslawnationalprohibitsprotectionpublicrequiresrights
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
h made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
actment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "idaho", "meridian", "name", "nampa", "northwest", "population", "principal", "second", "university", "west", "western".
boisecanyoncollegeidahomeridiannamenampanorthwestpopulationprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "counties", "employers", "idaho", "level", "population", "river", "technology", "treasure", "valley".
adaannualboisecountiesemployersidaholevelpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Garden City, Idaho
Q1516892 QID OVERLAP 0.700
QID OVERLAP: Q1516892 in legal (tier:branch) and sports_recreation (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "government", "idaho", "municipal", "name", "population", "second", "separate", "street".
adaboisegovernmentidahomunicipalnamepopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
P
Q476115 QID OVERLAP 0.700
QID OVERLAP: Q476115 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (10): "active", "business", "changes", "development", "expansion", "finance", "firms", "general", "press", "public".
activebusinesschangesdevelopmentexpansionfinancefirmsgeneralpresspublic
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in legal (tier:branch) and sports_recreation (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "district", "idaho", "jurisdiction", "largest", "local", "northwest", "population", "second".
adaboisedistrictidahojurisdictionlargestlocalnorthwestpopulationsecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "cities", "idaho", "meridian", "population", "second".
adaamongboisecitiesidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
N
Q160070 QID OVERLAP 0.640
QID OVERLAP: Q160070 in legal (tier:berry) and sports_recreation (tier:branch). | SHARED TOKENS (7): "actions", "conduct", "individuals", "injury", "law", "physical", "property".
actionsconductindividualsinjurylawphysicalproperty
to harm caused by the violation of a duty of care through a negligent act or failure to act. The concept of negligence is linked to the obligation of individuals to exercise reasonable care in their actions and to consider foreseeable harm that their conduct might cause to other people or property. The elements of a negligence claim include the duty to act or refrain from action, breach of that duty, actual and proximate cause of harm, and damages. Someone who suffers loss caused by another's negligence may be able to sue for damages to compensate for their harm.
Damages place a monetary value on the harm done, following the principle of restitutio in integrum (Latin for "restoration to the original condition"). Thus, for most purposes connected with the quantification of damages, the degree of culpability in the breach of the duty of care is irrelevant. Once the breach of the duty is established, the only requirement is to compensate the victim. One of the main tests that is posed when deliberating whether a claimant is entitled to compensation for a tort, is the "reasonable person". The test is self-explanatory: would a reasonable person (as determined by a judge or jury), under the given circumstances, have done what the defendant did to cause the injury in question; or, in other words, would a reasonable person, acting reasonably, have engaged in similar conduct when compared to the one whose actions caused the injury in question? Simple as the "reasonable person" test sounds, it is very complicated. It is a risky test because it involves the opinion of either the judge or the jury that can be based on limited facts. However, as vague as the "reasonable person" test seems, it is extremely important in deciding whether or not a plaintiff is entitled to compensation for a negligence tort. Damages are compensatory in nature. Compensatory damages addresses a plaintiff/claimant's losses (in cases involving physical or mental injury the amount awarded also compensates for pain and suffering). The award should make the plaintiff whole, sufficient to put the plaintiff back in the position he or she was before Defendant's negligent act. Anything more would unlawfully permit a plaintiff to profit from the tort. There are also two other general principles relating to damages. Firstly, the award of damages should take place in the form of a single lump sum payment. Therefore, a defendant should not be required to make periodic payments (however some statutes give exceptions for this). Secondly, the court is not concerned with how the plaintiff uses the award of damages.
Civil law jurisdictions In the Swiss Criminal Code, the term "négligence" is used to denote an omission, akin to the English term "negligence". However, unlike criminal negligence, it describes situations where the perpetrator acts without being aware of the potential consequences of their actions or disregards these consequences. Similarly, under the Turkish Penal Code No. 5237, which took effect on June 1, 2005, "criminal negligence" (Turkish: İhmali suç) refers to a person's failure to act when required by law, while "negligence" (Turkish: Taksir) is defined as the occurrence of a legally foreseen consequence due to a lack of necessary care. The French criminal code, as a rule, requires a person to have acted with mens rea, for an act to be punishable. Comparably, the Italian Penal Code [it], enacted on October 19, 1930, specifies in Article 42 that a person can only be punished for a crime if it was committed with intent. However, Article 43 provides exceptions for crimes arising from negligence or exceeding intentionality. These negligent crimes occur despite the defendant's foresight and are the result of negligence, carelessness, lack of experience, or non-compliance with laws, regulations, orders, or disciplinary rules. Consistent with other civil law systems, Turkish criminal law also treats criminal responsibility for acts committed negligently as an exception, confined to those acts explicitly stated in the law. Article 23 of the Turkish Penal Code further asserts that for crimes that are aggravated by their consequences to be attributed to the perpetrator, the base crime must be committed with intent.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in legal (tier:branch) and sports_recreation (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
P
Q17152589 QID OVERLAP 0.560
QID OVERLAP: Q17152589 in legal (tier:berry) and sports_recreation (tier:branch). | SHARED TOKENS (3): "land", "law", "liability".
landlawliability
Premises liability (known in some common law jurisdictions as occupiers' liability) is the liability that a landowner or occupier has for certain torts that occur on their land. Scope of the law Premises liability may range from things from "injuries caused by a variety of hazardous conditions, including open excavations, uneven pavement, standing water, crumbling curbs, wet floors, uncleared snow, icy walks, falling objects, inadequate security, insufficient lighting, concealed holes, improperly secured mats, or defects in chairs or benches".
The defendant must possess the land or "premises". The plaintiff must be an invitee or, in certain cases, a licensee. Traditionally, trespassers were not protected under premises liability law. However, in 1968, the California Supreme Court issued a vastly influential opinion, Rowland v. Christian, 69 Cal.2d 108 (1968), which abolished the significance of legal distinctions such as invitee, licensee, or trespasser in determining whether one could hold the possessor of a premises liable for harm. This opinion led to changes in the law in many other states in the United States, and is viewed as a seminal opinion in the development of the law of premises liability. There must be negligence—a breach of the duty of care—or some other wrongful act. In recent years, the law of premises liability has evolved to include cases where a person is injured on the premises of another by a third person's wrongful act, such as an assault. These cases are sometimes referred to as "third party premises liability" cases and they represent a highly complex and dynamic area of tort law.
At common law, in the case of landowners, the extent of their duty of care to those who came on their premises varied depending on whether a person was classified as a trespasser, licensee, or invitee. This rule was eventually abolished in some common law jurisdictions. For example, England enacted the Occupiers Liability Act 1957. Similarly, in the 1968 landmark case of Rowland v. Christian, the Supreme Court of California replaced the old classifications with a general duty of care to all persons on one's land, regardless of their status. After several highly publicized and controversial cases, the California Legislature enacted a statute in 1985 that partially restored immunity to landowners from some types of lawsuits from trespassers. Colorado's highest court adopted the Rowland unified duty of care analysis in 1971.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
309 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP309 edges
🌿 BRANCH172 edges
0.590
adaaddressboisegeneralgroupidahoindependentlevelopenedriversecondwestern
SHARED TOKENS (12): "ada", "address", "boise", "general", "group", "idaho", "independent", "level", "opened", "river", "second", "western". | URL->B (1): https://www.boisehawks.com/ClubInfo/memorialstadiumFAQ. | EXACT TITLE in sports_recreation: "Memorial Stadium (Boise)".
0.570
americanboiseexpansionidaholocalmountainnationalprimaryprofessionalwestwestern
SHARED TOKENS (11): "american", "boise", "expansion", "idaho", "local", "mountain", "national", "primary", "professional", "west", "western". | URL->B (1): https://idahosteelheads.com/. | EXACT TITLE in sports_recreation: "Idaho Steelheads".
0.550
associationbasinboiseidaholandmountainnationalorganizationrecreationwestern
SHARED TOKENS (10): "association", "basin", "boise", "idaho", "land", "mountain", "national", "organization", "recreation", "western". | URL->B (1): http://www.bogusbasin.org/. | EXACT TITLE in sports_recreation: "Bogus Basin".
0.550
adaamericanboiseclassidahoindependentnorthwestpartnerprofessionalshort
SHARED TOKENS (10): "ada", "american", "boise", "class", "idaho", "independent", "northwest", "partner", "professional", "short". | URL->B (1): http://www.boisehawks.com/. | EXACT TITLE in sports_recreation: "Boise Hawks".
0.530
boiseidaholevelopenedprofessionalrightsstreettitlewestern
SHARED TOKENS (9): "boise", "idaho", "level", "opened", "professional", "rights", "street", "title", "western". | URL->B (2): http://www.idahosteelheads.com/, https://idahocentralarena.com/. | EXACT TITLE in sports_recreation: "Idaho Central Arena".
0.530
caldwellcollegeeducationfoundedidahomedicaloldestprofessionalstandard
SHARED TOKENS (9): "caldwell", "college", "education", "founded", "idaho", "medical", "oldest", "professional", "standard". | URL->B (1): http://yoteathletics.com/. | EXACT TITLE in sports_recreation: "College of Idaho".
0.500
Idaho ↗ Q1221 EXACT TITLE
basinboiseidaholandlargestmountainnationalnorthwestorganizedpopulationriverseparatetechnologyterritorywestwestern
SHARED TOKENS (16): "basin", "boise", "idaho", "land", "largest", "mountain", "national", "northwest", "organized", "population", "river", "separate", "technology", "territory", "west", "western". | EXACT TITLE in legal: "Idaho". | EXACT TITLE in sports_recreation: "Idaho".
0.500
businessdevelopmenteventsformationgovernmentintellectualjunelargestlocalnationalorganizationoutsidepartnersrecognizedregionalspecialtrainingunified
SHARED TOKENS (18): "business", "development", "events", "formation", "government", "intellectual", "june", "largest", "local", "national", "organization", "outside", "partners", "recognized", "regional", "special", "training", "unified". | EXACT TITLE in sports_recreation: "Special Olympics".
0.500
Corporation ↗ Q167037 EXACT TITLE
activelybodybusinesscorporateentityestablishedjurisdictionlawlegallegislativeliabilitylocalobligationsownedownerspracticepublicrecognizedregistrationserve
SHARED TOKENS (22): "actively", "body", "business", "corporate", "entity", "established", "jurisdiction", "law", "legal", "legislative", "liability", "local", "obligations", "owned", "owners", "practice", "public", "recognized", "registration", "serve".... | EXACT TITLE in legal: "Corporation".
0.500
civilcourtenforcementenvironmentalgovernsindividualsintellectualjurisdictionlandlawlegalpropertypublicrealrelationshipsrightsseparate
SHARED TOKENS (17): "civil", "court", "enforcement", "environmental", "governs", "individuals", "intellectual", "jurisdiction", "land", "law", "legal", "property", "public", "real", "relationships", "rights", "separate". | EXACT TITLE in legal: "Property law".
0.500
adaboisecanyoncitiescombinedcountiesidaholargestmeridianmountainnampanorthwestpopulationsectiontreasurevalley
SHARED TOKENS (16): "ada", "boise", "canyon", "cities", "combined", "counties", "idaho", "largest", "meridian", "mountain", "nampa", "northwest", "population", "section", "treasure", "valley". | EXACT TITLE in sports_recreation: "Boise metropolitan area".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbodybusinesscourtcreatedentityestablishedfederalgovernedincomeindividualsjurisdictionlawlegalownerspropertypublicrequiressingle
SHARED TOKENS (19): "assets", "body", "business", "court", "created", "entity", "established", "federal", "governed", "income", "individuals", "jurisdiction", "law", "legal", "owners", "property", "public", "requires", "single". | EXACT TITLE in legal: "Trust (law)".
0.500
Urban park ↗ Q22746 EXACT TITLE
agenciesamongbenefitscitiescourtsgovernmentgrouplandlevellocalmaintenancemunicipalpublicrecreationresidents
SHARED TOKENS (15): "agencies", "among", "benefits", "cities", "courts", "government", "group", "land", "level", "local", "maintenance", "municipal", "public", "recreation", "residents". | EXACT TITLE in sports_recreation: "Urban park".
0.500
State park ↗ EXACT TITLE
establishedexperiencefederalgeneralgovernmenthistorylargestlevellocalmaintainnationalregionalresourcesresponsibleservesubdivision
SHARED TOKENS (16): "established", "experience", "federal", "general", "government", "history", "largest", "level", "local", "maintain", "national", "regional", "resources", "responsible", "serve", "subdivision". | EXACT TITLE in sports_recreation: "State park".
0.500
accesscitiescollectivelycreateddemandenvironmentfreegeneralorganizedoutsidephysicalpopulationrecreationrenewalrivertraining
SHARED TOKENS (16): "access", "cities", "collectively", "created", "demand", "environment", "free", "general", "organized", "outside", "physical", "population", "recreation", "renewal", "river", "training". | EXACT TITLE in sports_recreation: "Outdoor recreation".
0.500
amongassociationbodiesconditiondevelopmenteducationlevellocalnationalorganizedoutsideprimarypublicreportresourcesschoolsupportsystemwater
SHARED TOKENS (19): "among", "association", "bodies", "condition", "development", "education", "level", "local", "national", "organized", "outside", "primary", "public", "report", "resources", "school", "support", "system", "water". | EXACT TITLE in sports_recreation: "Youth sports".
0.500
departmententityformformsinsurancelegalnameorganizationoutsideprofessionalprogrampropertyrightsschooltitleuniversity
SHARED TOKENS (16): "department", "entity", "form", "forms", "insurance", "legal", "name", "organization", "outside", "professional", "program", "property", "rights", "school", "title", "university". | EXACT TITLE in sports_recreation: "Naming rights".
0.500
amongestablishedexperiencefamilyformerformslevelorganizationpartnerpartnersphysicalpowerrelationshipsresourcestechnology
SHARED TOKENS (15): "among", "established", "experience", "family", "former", "forms", "level", "organization", "partner", "partners", "physical", "power", "relationships", "resources", "technology". | EXACT TITLE in legal: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongfallformsintellectuallawlegalnationalorganizationpropertyprotectionpublicrightstechnologytrade
SHARED TOKENS (15): "agreements", "among", "fall", "forms", "intellectual", "law", "legal", "national", "organization", "property", "protection", "public", "rights", "technology", "trade". | EXACT TITLE in legal: "Patent".
0.500
Basketball ↗ Q5372 EXACT TITLE
additionalamericanassociationcollegecourteventsfallfreelevelnationaloutsidepowerprimaryprofessionalregionalregulationtied
SHARED TOKENS (17): "additional", "american", "association", "college", "court", "events", "fall", "free", "level", "national", "outside", "power", "primary", "professional", "regional", "regulation", "tied". | EXACT TITLE in sports_recreation: "Basketball".
0.500
Hunting ↗ Q36963 EXACT TITLE
bodycollectionenvironmentfoodformlawmaintainmaintenancepopulationpopulationspracticeprimaryrecreationrightstradetreasure
SHARED TOKENS (16): "body", "collection", "environment", "food", "form", "law", "maintain", "maintenance", "population", "populations", "practice", "primary", "recreation", "rights", "trade", "treasure". | EXACT TITLE in sports_recreation: "Hunting".
0.500
bodybusinesscommercialcommunityconductcorporateemployeesenvironmentformationgovernancegovernslawlegalmarketmattersorganizationspracticerightssystem
SHARED TOKENS (19): "body", "business", "commercial", "community", "conduct", "corporate", "employees", "environment", "formation", "governance", "governs", "law", "legal", "market", "matters", "organizations", "practice", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
authoritycannotcivilcourtcourtsestablisheditselfjudgesjurisdictionlawlegallevelpowerreviewsecondstandardsystem
SHARED TOKENS (17): "authority", "cannot", "civil", "court", "courts", "established", "itself", "judges", "jurisdiction", "law", "legal", "level", "power", "review", "second", "standard", "system". | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalbeyondbodyconsumerdepartmentemployersemploymentfeegrowthindividualsknowledgephysicalpresenceprogramprojectsregulationrequiredrequiressectionsecurity
SHARED TOKENS (22): "additional", "beyond", "body", "consumer", "department", "employers", "employment", "fee", "growth", "individuals", "knowledge", "physical", "presence", "program", "projects", "regulation", "required", "requires", "section", "security".... | EXACT TITLE in legal: "H-1B visa".
0.500
activeadministrativeagenciesaidamericanamongassociationcommunitydepartmenteducationinjuriesinjurylevellicenselicensedmedicalnationalphysicalpopulationpractice
SHARED TOKENS (34): "active", "administrative", "agencies", "aid", "american", "among", "association", "community", "department", "education", "injuries", "injury", "level", "license", "licensed", "medical", "national", "physical", "population", "practice".... | EXACT TITLE in sports_recreation: "Athletic trainer".
0.500
YMCA ↗ Q157169 EXACT TITLE
associationassociationsbodydevelopmentfoundedindependentjunelocalnationalorganizationorganizationspracticeprojectsregionalwork
SHARED TOKENS (15): "association", "associations", "body", "development", "founded", "independent", "june", "local", "national", "organization", "organizations", "practice", "projects", "regional", "work". | EXACT TITLE in sports_recreation: "YMCA".
0.500
agenciesamericanamongcreateddepartmentestatefederalgeneralgovernmentidaholandlandscapenationalpermitspublicresponsiblerightssurfacesystemwestern
SHARED TOKENS (20): "agencies", "american", "among", "created", "department", "estate", "federal", "general", "government", "idaho", "land", "landscape", "national", "permits", "public", "responsible", "rights", "surface", "system", "western". | EXACT TITLE in sports_recreation: "Bureau of Land Management".
0.500
americanamongboisefoundedhistoryidaholocalopenedoutsiderightsschoolsubdivisionsurfaceuniversitywestern
SHARED TOKENS (15): "american", "among", "boise", "founded", "history", "idaho", "local", "opened", "outside", "rights", "school", "subdivision", "surface", "university", "western". | EXACT TITLE in sports_recreation: "Albertsons Stadium".
0.500
americanannualassociationboisebusinessclasscollegeeducationemploymentenvironmentalestablishedexpansionfallfullidahointellectuallawnewsopenedplans
SHARED TOKENS (29): "american", "annual", "association", "boise", "business", "class", "college", "education", "employment", "environmental", "established", "expansion", "fall", "full", "idaho", "intellectual", "law", "news", "opened", "plans".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
Kickboxing ↗ Q178678 EXACT TITLE
americanamongassociationbodiesbodycontactfullgenerallevelnetworkorganizationsorganizedprofessionalrecognizedsingle
SHARED TOKENS (15): "american", "among", "association", "bodies", "body", "contact", "full", "general", "level", "network", "organizations", "organized", "professional", "recognized", "single". | EXACT TITLE in sports_recreation: "Kickboxing".
0.500
Mediation ↗ Q223871 EXACT TITLE
activelyagreementsamongauthoritycivilcommercialformformsindependentindividualslawlegallicensingneedspracticeprofessionaltraining
SHARED TOKENS (17): "actively", "agreements", "among", "authority", "civil", "commercial", "form", "forms", "independent", "individuals", "law", "legal", "licensing", "needs", "practice", "professional", "training". | EXACT TITLE in legal: "Mediation".
0.500
Swimming ↗ Q6388 EXACT TITLE
actionsamongbenefitsbodyenvironmentexperiencefrontlevellocalnationalpublicrecreationrequiresspecialtrainingwater
SHARED TOKENS (16): "actions", "among", "benefits", "body", "environment", "experience", "front", "level", "local", "national", "public", "recreation", "requires", "special", "training", "water". | EXACT TITLE in sports_recreation: "Swimming".
0.500
Real estate ↗ Q684740 EXACT TITLE
businesscommercialentityestategeneralgovernmentgrowingindividualslandlawlegalnonprofitownedpropertypublicrealresourceswater
SHARED TOKENS (18): "business", "commercial", "entity", "estate", "general", "government", "growing", "individuals", "land", "law", "legal", "nonprofit", "owned", "property", "public", "real", "resources", "water". | EXACT TITLE in legal: "Real estate". | EXACT TITLE in sports_recreation: "Real estate".
0.500
amongbenefitscreatedemployeesemployersemploymentformgeneralinsuranceliabilitymedicaloutsidepaymentplanssecuritysystemwageworkers
SHARED TOKENS (18): "among", "benefits", "created", "employees", "employers", "employment", "form", "general", "insurance", "liability", "medical", "outside", "payment", "plans", "security", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
Snake River ↗ EXACT TITLE
agenciesamericanbasincanyoncommercialconstructioncreatedhistoryidahoirrigationlargelargestnationalnorthwestpopulationsprojectspublicremovalriversection
SHARED TOKENS (24): "agencies", "american", "basin", "canyon", "commercial", "construction", "created", "history", "idaho", "irrigation", "large", "largest", "national", "northwest", "populations", "projects", "public", "removal", "river", "section".... | EXACT TITLE in legal: "Snake River".
0.500
basinboisecoveringcreateddistrictsemmettidaholandmaintainmountainnationalpopulationsrecreationresourcesriversustainedwaterwest
SHARED TOKENS (18): "basin", "boise", "covering", "created", "districts", "emmett", "idaho", "land", "maintain", "mountain", "national", "populations", "recreation", "resources", "river", "sustained", "water", "west". | EXACT TITLE in sports_recreation: "Boise National Forest".
0.500
Contract ↗ Q93288 EXACT TITLE
agreementsbusinesscivilcodecommercialconsentenforcementframeworkgeneralgovernedgroundsindependentindividualsjudgeslawlegalmeetingnationalobligationspractice
SHARED TOKENS (22): "agreements", "business", "civil", "code", "commercial", "consent", "enforcement", "framework", "general", "governed", "grounds", "independent", "individuals", "judges", "law", "legal", "meeting", "national", "obligations", "practice".... | EXACT TITLE in legal: "Contract". | EXACT TITLE in sports_recreation: "Contract".
0.500
Concussion ↗ Q326921 EXACT TITLE
amongbodychangesconditioncontacthistoryinjuriesinjurylevelmedicalorganizedphysicalpracticerequiredscaleschoolsupplysupporttrainingwork
SHARED TOKENS (20): "among", "body", "changes", "condition", "contact", "history", "injuries", "injury", "level", "medical", "organized", "physical", "practice", "required", "scale", "school", "supply", "support", "training", "work". | EXACT TITLE in sports_recreation: "Concussion".
0.500
agenciesagreementsdevelopmentenforcementenvironmentenvironmentalgrowthjurisdictionlawlegalnationalnationallyneedsorganizationsprotectionregulatoryresourcesrightssafetytrade
SHARED TOKENS (20): "agencies", "agreements", "development", "enforcement", "environment", "environmental", "growth", "jurisdiction", "law", "legal", "national", "nationally", "needs", "organizations", "protection", "regulatory", "resources", "rights", "safety", "trade". | EXACT TITLE in legal: "Environmental law".
0.500
appliesassetsbodybusinesscivilcodecommercialconductconsumerdistrictemploymentfallfinancefoodformationframeworkgeneralgovernguidelinesinsurance
SHARED TOKENS (41): "applies", "assets", "body", "business", "civil", "code", "commercial", "conduct", "consumer", "district", "employment", "fall", "finance", "food", "formation", "framework", "general", "govern", "guidelines", "insurance".... | EXACT TITLE in legal: "Commercial law".
0.500
authoritybodiescodeconstructiondepartmentsdevelopersdistrictenvironmentalestategeneralinsurancejurisdictionlawlevellocalnationalplanningpublicrealregulate
SHARED TOKENS (24): "authority", "bodies", "code", "construction", "departments", "developers", "district", "environmental", "estate", "general", "insurance", "jurisdiction", "law", "level", "local", "national", "planning", "public", "real", "regulate".... | EXACT TITLE in sports_recreation: "Building code".
0.500
authoritybodyconstructiongovernmentgroupgrowthlocalnonprofitorganizationorganizationsproducespublicqualityregulatesupplytrade
SHARED TOKENS (16): "authority", "body", "construction", "government", "group", "growth", "local", "nonprofit", "organization", "organizations", "produces", "public", "quality", "regulate", "supply", "trade". | EXACT TITLE in sports_recreation: "Government procurement".
0.500
civilcollectioncreateddevelopmentenforcementfamilyguidelinesincomejurisdictionlawmaintenanceneedsobligationspaidpaymentprimaryrecognizedrequiredrequiresreview
SHARED TOKENS (24): "civil", "collection", "created", "development", "enforcement", "family", "guidelines", "income", "jurisdiction", "law", "maintenance", "needs", "obligations", "paid", "payment", "primary", "recognized", "required", "requires", "review".... | EXACT TITLE in legal: "Child support".
0.480
Divorce ↗ Q93190 EXACT TITLE
accessauthoritycivilcourtdebtdistributionformerlawlegalpartnerpropertyrequiredrequiressupport
SHARED TOKENS (14): "access", "authority", "civil", "court", "debt", "distribution", "former", "law", "legal", "partner", "property", "required", "requires", "support". | EXACT TITLE in legal: "Divorce".
0.480
amongcommissiondevelopmentestategovernmentlegalnationalpropertyrealrightssubdivisionsystemtransactionunified
SHARED TOKENS (14): "among", "commission", "development", "estate", "government", "legal", "national", "property", "real", "rights", "subdivision", "system", "transaction", "unified". | EXACT TITLE in legal: "Real estate transaction".
0.480
additionalestablishedfallfreelevelmarketsnationalnationallyoperatesorganizedpremierprofessionalsupersystem
SHARED TOKENS (14): "additional", "established", "fall", "free", "level", "markets", "national", "nationally", "operates", "organized", "premier", "professional", "super", "system". | EXACT TITLE in sports_recreation: "USL Super League".
0.480
Lawyer ↗ Q40348 EXACT TITLE
educationindividualsjurisdictionknowledgelawlegalmatterspracticeprofessionalrequiredrightssystemtrainingwork
SHARED TOKENS (14): "education", "individuals", "jurisdiction", "knowledge", "law", "legal", "matters", "practice", "professional", "required", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.480
Zoning ↗ Q702232 EXACT TITLE
developmentformgoverngovernmentgrowthguidelineslandland-uselocalplanningpropertyregulatoryscalesingle
SHARED TOKENS (14): "development", "form", "govern", "government", "growth", "guidelines", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "single". | EXACT TITLE in legal: "Zoning".
0.480
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilcourtcourtsentityestablishedgovernmentjudgesjurisdictionlawlegalmatterspower
SHARED TOKENS (14): "administrative", "authority", "civil", "court", "courts", "entity", "established", "government", "judges", "jurisdiction", "law", "legal", "matters", "power". | EXACT TITLE in legal: "Court". | EXACT TITLE in sports_recreation: "Court".
0.480
americananalysisassociationhealthcareimmediateinjuriesinjurymedicaloperatingpracticeprofessionalrecognizedtrainingwork
SHARED TOKENS (14): "american", "analysis", "association", "healthcare", "immediate", "injuries", "injury", "medical", "operating", "practice", "professional", "recognized", "training", "work". | EXACT TITLE in sports_recreation: "Athletic training".
0.460
completecontinuingdevelopmentdistricteducationlawlegallicensesmaintainoutsidepracticeprofessionalrequired
SHARED TOKENS (13): "complete", "continuing", "development", "district", "education", "law", "legal", "licenses", "maintain", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.460
familylandlawlegalpossessionpropertypublicrealregistrationrequiredrightsservestitle
SHARED TOKENS (13): "family", "land", "law", "legal", "possession", "property", "public", "real", "registration", "required", "rights", "serves", "title". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in sports_recreation: "Title (property)".
0.450
boisecourtcreatedidahooperations
SHARED TOKENS (5): "boise", "court", "created", "idaho", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.440
Arbitration ↗ Q207946 EXACT TITLE
classcommercialconsumercourtcourtsemploymententityformlocalmattersreviewrights
SHARED TOKENS (12): "class", "commercial", "consumer", "court", "courts", "employment", "entity", "form", "local", "matters", "review", "rights". | EXACT TITLE in legal: "Arbitration".
0.440
Tennis ↗ Q847 EXACT TITLE
competitivecourtcourtsformformslevelprofessionalrealreviewsinglesystemtechnology
SHARED TOKENS (12): "competitive", "court", "courts", "form", "forms", "level", "professional", "real", "review", "single", "system", "technology". | EXACT TITLE in sports_recreation: "Tennis".
0.440
Pickleball ↗ Q866224 EXACT TITLE
associationcourtestablishedgrowinggrowthnorthwestoperatingoutsideproducesprofessionalreportserves
SHARED TOKENS (12): "association", "court", "established", "growing", "growth", "northwest", "operating", "outside", "produces", "professional", "report", "serves". | EXACT TITLE in sports_recreation: "Pickleball".
0.440
developmentfeefullgovernmentlandlegalownerspaymentpowerpropertypublictitle
SHARED TOKENS (12): "development", "fee", "full", "government", "land", "legal", "owners", "payment", "power", "property", "public", "title". | EXACT TITLE in legal: "Eminent domain".
0.440
ECHL ↗ Q182010 EXACT TITLE
agreementsamericanassociationdevelopmentfranchiseitselfnationalprofessionalrecognizedreportservessystem
SHARED TOKENS (12): "agreements", "american", "association", "development", "franchise", "itself", "national", "professional", "recognized", "report", "serves", "system". | EXACT TITLE in sports_recreation: "ECHL".
0.430
idahonampanorthwestuniversity
SHARED TOKENS (4): "idaho", "nampa", "northwest", "university". | URL->B (1): https://nnusports.com/. | EXACT TITLE in sports_recreation: "Northwest Nazarene University".
0.420
americanbodyconductentityinjurylawlegalliabilitymedicalpropertyquality
SHARED TOKENS (11): "american", "body", "conduct", "entity", "injury", "law", "legal", "liability", "medical", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.420
Lacrosse ↗ Q185851 EXACT TITLE
americanbodycontacteventsformgovernedoldestorganizationorganizedprofessionalrequired
SHARED TOKENS (11): "american", "body", "contact", "events", "form", "governed", "oldest", "organization", "organized", "professional", "required". | EXACT TITLE in sports_recreation: "Lacrosse".
0.420
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivilindividualslawlegalobligationspracticepropertyrightsstatutory
SHARED TOKENS (11): "among", "assets", "civil", "individuals", "law", "legal", "obligations", "practice", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.420
beyondboiseeagleidahopermitriversectionsshortspecialsystemwest
SHARED TOKENS (11): "beyond", "boise", "eagle", "idaho", "permit", "river", "sections", "short", "special", "system", "west". | EXACT TITLE in sports_recreation: "Boise River Greenbelt".
0.420
americanassociationchangescreateddepartmenteventsgovernmentlocalrecreationsecondspecial
SHARED TOKENS (11): "american", "association", "changes", "created", "department", "events", "government", "local", "recreation", "second", "special". | EXACT TITLE in sports_recreation: "Parks and Recreation".
0.420
Complaint ↗ Q836925 EXACT TITLE
authoritycivilcourtcourtsfederalgovernlawlegalnamepowersupport
SHARED TOKENS (11): "authority", "civil", "court", "courts", "federal", "govern", "law", "legal", "name", "power", "support". | EXACT TITLE in sports_recreation: "Complaint".
0.420
americanassociationbodycombinedeventsnamenationaloldestoutsiderecordssingle
SHARED TOKENS (11): "american", "association", "body", "combined", "events", "name", "national", "oldest", "outside", "records", "single". | EXACT TITLE in sports_recreation: "Track and field".
0.420
Baseball ↗ Q5369 EXACT TITLE
americancivilhistorylevelnationalorganizedprofessionalrecognizedrecordstiedwest
SHARED TOKENS (11): "american", "civil", "history", "level", "national", "organized", "professional", "recognized", "records", "tied", "west". | EXACT TITLE in sports_recreation: "Baseball".
0.420
Jury ↗ Q837675 EXACT TITLE
bodiesbodycivilcourtgroupjudgeslawlegalprofessionalsinglesystem
SHARED TOKENS (11): "bodies", "body", "civil", "court", "group", "judges", "law", "legal", "professional", "single", "system". | EXACT TITLE in legal: "Jury". | EXACT TITLE in sports_recreation: "Jury".
0.420
associationbodycompetitivedevelopmenteducationgrowthnonprofitorganizationprofessionalpublicstandards
SHARED TOKENS (11): "association", "body", "competitive", "development", "education", "growth", "nonprofit", "organization", "professional", "public", "standards". | EXACT TITLE in sports_recreation: "Professional Disc Golf Association".
0.420
americancivilconcentratedcourtgeneraljudgeslawlegalreviewsinglesystem
SHARED TOKENS (11): "american", "civil", "concentrated", "court", "general", "judges", "law", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.420
Golf ↗ Q5377 EXACT TITLE
amongcannotcompletecreatedformslandscapeleveloldestprofessionalstandardwater
SHARED TOKENS (11): "among", "cannot", "complete", "created", "forms", "landscape", "level", "oldest", "professional", "standard", "water". | EXACT TITLE in sports_recreation: "Golf".
0.420
additionalbusinesschangesfamilyformformsprofessionalrealreviewsafetystreet
SHARED TOKENS (11): "additional", "business", "changes", "family", "form", "forms", "professional", "real", "review", "safety", "street". | EXACT TITLE in sports_recreation: "Mixed martial arts".
0.420
aidcannotcourtestablishedfederalfreefullgovernmentlegalpublicrequires
SHARED TOKENS (11): "aid", "cannot", "court", "established", "federal", "free", "full", "government", "legal", "public", "requires". | EXACT TITLE in legal: "Public defender".
0.420
authoritybodyfederalgovernmentlandlawlegislativepopulationpowerrightsstatutory
SHARED TOKENS (11): "authority", "body", "federal", "government", "land", "law", "legislative", "population", "power", "rights", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.420
Creditor ↗ Q157165 EXACT TITLE
assetscourtdebtgeneralgovernmentlaworganizationpropertyrepresentssecondsecurity
SHARED TOKENS (11): "assets", "court", "debt", "general", "government", "law", "organization", "property", "represents", "second", "security". | EXACT TITLE in legal: "Creditor".
0.410
courtcourtsidaho
SHARED TOKENS (3): "court", "courts", "idaho". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.400
boisedatadistrictdistrictsgovernmentidaholegislativepopulationresidentssingle
SHARED TOKENS (10): "boise", "data", "district", "districts", "government", "idaho", "legislative", "population", "residents", "single". | EXACT TITLE in legal: "Idaho Legislature".
0.400
intellectuallandlawlegalprimarypropertyrightsstrongtradeunauthorized
SHARED TOKENS (10): "intellectual", "land", "law", "legal", "primary", "property", "rights", "strong", "trade", "unauthorized". | EXACT TITLE in legal: "Intellectual property".
0.400
Law firm ↗ Q613142 EXACT TITLE
businesscivilentityindividualslawlegalmatterspracticeprimaryrights
SHARED TOKENS (10): "business", "civil", "entity", "individuals", "law", "legal", "matters", "practice", "primary", "rights". | EXACT TITLE in legal: "Law firm".
0.400
Probate ↗ Q6500369 EXACT TITLE
assetscourtcourtsestatejurisdictionlawlegalpowerpropertypublic
SHARED TOKENS (10): "assets", "court", "courts", "estate", "jurisdiction", "law", "legal", "power", "property", "public". | EXACT TITLE in legal: "Probate".
0.400
boisecommunityeventsidaholevelnorthwesttradeuniversitywestwestern
SHARED TOKENS (10): "boise", "community", "events", "idaho", "level", "northwest", "trade", "university", "west", "western". | EXACT TITLE in sports_recreation: "ExtraMile Arena".
0.400
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlawlegalprofessionalschoolsystemuniversity
SHARED TOKENS (10): "college", "department", "education", "jurisdiction", "law", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.400
Assault ↗ Q365680 EXACT TITLE
civilcombinedcontactlawlegalliabilityphysicalseparatesinglesystem
SHARED TOKENS (10): "civil", "combined", "contact", "law", "legal", "liability", "physical", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.400
Cheerleading ↗ Q61391 EXACT TITLE
americanassociationforminjurieslevelorganizedoutsidephysicalpracticerecognized
SHARED TOKENS (10): "american", "association", "form", "injuries", "level", "organized", "outside", "physical", "practice", "recognized". | EXACT TITLE in sports_recreation: "Cheerleading".
0.400
Easement ↗ Q448405 EXACT TITLE
accessamongitselflandlawownedpropertypublicrealrights
SHARED TOKENS (10): "access", "among", "itself", "land", "law", "owned", "property", "public", "real", "rights". | EXACT TITLE in sports_recreation: "Easement".
0.400
amongannualenvironmentalirrigationlandmaintainphysicalpopulationpopulationssustained
SHARED TOKENS (10): "among", "annual", "environmental", "irrigation", "land", "maintain", "physical", "population", "populations", "sustained". | EXACT TITLE in sports_recreation: "Wildlife management".
0.380
accesscontactfamilylawlegalparentalphysicalrightsstandard
SHARED TOKENS (9): "access", "contact", "family", "law", "legal", "parental", "physical", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.380
Pro bono ↗ Q127537 EXACT TITLE
communityfreelegalpaymentproprofessionalprofessionalspublicwork
SHARED TOKENS (9): "community", "free", "legal", "payment", "pro", "professional", "professionals", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.380
Volleyball ↗ Q1734 EXACT TITLE
americanbodycourteducationestablishedhistoryorganizedphysicalprogram
SHARED TOKENS (9): "american", "body", "court", "education", "established", "history", "organized", "physical", "program". | EXACT TITLE in sports_recreation: "Volleyball".
0.380
Green card ↗ Q6676995 EXACT TITLE
amongfederalformgeneralregistrationremovalresidentsserveworkers
SHARED TOKENS (9): "among", "federal", "form", "general", "registration", "removal", "residents", "serve", "workers". | EXACT TITLE in legal: "Green card".
0.380
agreementsbenefitscivilestategovernlegalpropertyrightssupport
SHARED TOKENS (9): "agreements", "benefits", "civil", "estate", "govern", "legal", "property", "rights", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.380
cannotincomeinjurylegalmedicalprofessionalrecognizedstandardstandards
SHARED TOKENS (9): "cannot", "income", "injury", "legal", "medical", "professional", "recognized", "standard", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.380
injuriesmedicalphysicalprimaryrecognizedstandardstrainingusawork
SHARED TOKENS (9): "injuries", "medical", "physical", "primary", "recognized", "standards", "training", "usa", "work". | EXACT TITLE in sports_recreation: "Sports medicine".
0.380
Gymnastics ↗ Q43450 EXACT TITLE
bodycompetitivedevelopmenteventsformgovernedgroupphysicalrecognized
SHARED TOKENS (9): "body", "competitive", "development", "events", "form", "governed", "group", "physical", "recognized". | EXACT TITLE in sports_recreation: "Gymnastics".
0.380
civilcourtcourtsformerjurisdictionlawlegalreviewsingle
SHARED TOKENS (9): "civil", "court", "courts", "former", "jurisdiction", "law", "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.360
Boxing ↗ Q32112 EXACT TITLE
completegovernedhistoryjudgeslocalsourcesstandardwestern
SHARED TOKENS (8): "complete", "governed", "history", "judges", "local", "sources", "standard", "western". | EXACT TITLE in sports_recreation: "Boxing".
0.360
civilcommunityestatelawownedpropertyseparatesystem
SHARED TOKENS (8): "civil", "community", "estate", "law", "owned", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.360
Immigration law ↗ EXACT TITLE
governmentlawlegalmaintainmattersnationalregulaterights
SHARED TOKENS (8): "government", "law", "legal", "maintain", "matters", "national", "regulate", "rights". | EXACT TITLE in legal: "Immigration law".
0.360
authorityeducationhealthcaremedicalphysicalpracticeprimarypublic
SHARED TOKENS (8): "authority", "education", "healthcare", "medical", "physical", "practice", "primary", "public". | EXACT TITLE in sports_recreation: "Physical therapy".
0.360
associationenvironmentgeneralgovernedlandscapelargemountainprimary
SHARED TOKENS (8): "association", "environment", "general", "governed", "landscape", "large", "mountain", "primary". | EXACT TITLE in sports_recreation: "Trail running".
0.360
Annexation ↗ Q194465 EXACT TITLE
actionsbodieslawlegalphysicalrecognizedterritorytitle
SHARED TOKENS (8): "actions", "bodies", "law", "legal", "physical", "recognized", "territory", "title". | EXACT TITLE in legal: "Annexation".
0.340
Partnership ↗ Q728646 EXACT TITLE
businessgovernedindividualsorganizationorganizationspartnerpartners
SHARED TOKENS (7): "business", "governed", "individuals", "organization", "organizations", "partner", "partners". | EXACT TITLE in sports_recreation: "Partnership".
0.340
assetscomplexestatelegalneedsplanningproperty
SHARED TOKENS (7): "assets", "complex", "estate", "legal", "needs", "planning", "property". | EXACT TITLE in legal: "Estate planning".
0.340
governmentlandlocalnationalownedpublicsystem
SHARED TOKENS (7): "government", "land", "local", "national", "owned", "public", "system". | EXACT TITLE in sports_recreation: "Public land".
0.340
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentformationlandlayermaterialwater
SHARED TOKENS (7): "beyond", "environment", "formation", "land", "layer", "material", "water". | EXACT TITLE in legal: "Aquifer".
0.340
constructionitselflaborpropertyrealsecuritytitle
SHARED TOKENS (7): "construction", "itself", "labor", "property", "real", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.340
Triathlon ↗ Q10980 EXACT TITLE
createdgeneralhistoryindividualsnamerequirestraining
SHARED TOKENS (7): "created", "general", "history", "individuals", "name", "requires", "training". | EXACT TITLE in sports_recreation: "Triathlon".
0.340
citiescoversidaholandlargestnorthwestriver
SHARED TOKENS (7): "cities", "covers", "idaho", "land", "largest", "northwest", "river". | EXACT TITLE in legal: "Snake River Plain".
0.340
collectivelycommercialfoodformformslargewater
SHARED TOKENS (7): "collectively", "commercial", "food", "form", "forms", "large", "water". | EXACT TITLE in sports_recreation: "Recreational fishing".
0.340
Softball ↗ Q171038 EXACT TITLE
formsitselflevelprimaryprofessionalschoolstandard
SHARED TOKENS (7): "forms", "itself", "level", "primary", "professional", "school", "standard". | EXACT TITLE in sports_recreation: "Softball".
0.330
associationidaholevelnampanationalnorthwestschooluniversitywest
SHARED TOKENS (9): "association", "idaho", "level", "nampa", "national", "northwest", "school", "university", "west". | URL->B (1): https://nnusports.com/.
0.320
Adoption ↗ Q180472 EXACT TITLE
governedlegalparentalrecognitionrequiresrights
SHARED TOKENS (6): "governed", "legal", "parental", "recognition", "requires", "rights". | EXACT TITLE in legal: "Adoption".
0.320
actionsamonglawlegallevelpresence
SHARED TOKENS (6): "actions", "among", "law", "legal", "level", "presence". | EXACT TITLE in legal: "Manslaughter".
0.320
groundsownedpropublicshortstandard
SHARED TOKENS (6): "grounds", "owned", "pro", "public", "short", "standard". | EXACT TITLE in sports_recreation: "Golf course".
0.320
Floodplain ↗ Q193110 EXACT TITLE
bodyexperiencelandrivervalleywater
SHARED TOKENS (6): "body", "experience", "land", "river", "valley", "water". | EXACT TITLE in sports_recreation: "Floodplain".
0.320
Lifeguard ↗ Q259327 EXACT TITLE
aidprimaryriversafetysystemwater
SHARED TOKENS (6): "aid", "primary", "river", "safety", "system", "water". | EXACT TITLE in sports_recreation: "Lifeguard".
0.320
activeamericangroupoperatesprofessionalsuper
SHARED TOKENS (6): "active", "american", "group", "operates", "professional", "super". | EXACT TITLE in sports_recreation: "USL League One".
0.320
Martial arts ↗ Q11417 EXACT TITLE
developmentenforcementlawoutsidephysicalstreet
SHARED TOKENS (6): "development", "enforcement", "law", "outside", "physical", "street". | EXACT TITLE in sports_recreation: "Martial arts".
0.300
administeredamongcommunitydepartmenteducationenvironmentenvironmentaleventsfamilygrouphealthcareinstitutionslevelmaintenancemedicalneedsorganizationoutsidephysicalplanning
SHARED TOKENS (31): "administered", "among", "community", "department", "education", "environment", "environmental", "events", "family", "group", "healthcare", "institutions", "level", "maintenance", "medical", "needs", "organization", "outside", "physical", "planning"....
0.300
bodybusinesscorporatedevelopmentenvironmenteventsknowledgemarketorganizationspermitsplanningplansprojectpublicrelationshipsrequiredsecurity
SHARED TOKENS (17): "body", "business", "corporate", "development", "environment", "events", "knowledge", "market", "organizations", "permits", "planning", "plans", "project", "public", "relationships", "required", "security".
0.300
Felony ↗ Q178844 EXACT TITLE
additionalcivilcourtlandlaw
SHARED TOKENS (5): "additional", "civil", "court", "land", "law". | EXACT TITLE in legal: "Felony".
0.300
administrativeagenciesbodieschangescivilcourtscreatededucationenforcementenvironmentenvironmentalgovernmentitselflawlegallegislativeopenedpublicregulatereview
SHARED TOKENS (23): "administrative", "agencies", "bodies", "changes", "civil", "courts", "created", "education", "enforcement", "environment", "environmental", "government", "itself", "law", "legal", "legislative", "opened", "public", "regulate", "review"....
0.300
authorityconsentcreateddistrictdistrictsentitygovernmentirrigationlargelocalorganizedpowerprojectspublicsubdivisionwater
SHARED TOKENS (16): "authority", "consent", "created", "district", "districts", "entity", "government", "irrigation", "large", "local", "organized", "power", "projects", "public", "subdivision", "water".
0.300
annualbusinesscompleteconductdebtdevelopmentemployeesentityfinancefirmsformgrowthhistoryinstitutionalmarketmarketsoperatingoperationsownedpublic
SHARED TOKENS (25): "annual", "business", "complete", "conduct", "debt", "development", "employees", "entity", "finance", "firms", "form", "growth", "history", "institutional", "market", "markets", "operating", "operations", "owned", "public"....
0.300
agreementsbenefitschangesemployeesemployersemploymentgrouporganizationregulaterightssafetysecuritysingletradetrainingwageworkworkers
SHARED TOKENS (18): "agreements", "benefits", "changes", "employees", "employers", "employment", "group", "organization", "regulate", "rights", "safety", "security", "single", "trade", "training", "wage", "work", "workers".
0.300
contractorscourtemployeesemployersestablishedfederalformationgovernmentindependentlaborlawnationalorganizationpowertradeworkers
SHARED TOKENS (16): "contractors", "court", "employees", "employers", "established", "federal", "formation", "government", "independent", "labor", "law", "national", "organization", "power", "trade", "workers".
0.300
administrativeassociationcivilclassformgroupindividualslawlegalorganizationsphysicalpressprotectionrightssafetysecondsystem
SHARED TOKENS (17): "administrative", "association", "civil", "class", "form", "group", "individuals", "law", "legal", "organizations", "physical", "press", "protection", "rights", "safety", "second", "system".
0.300
American football ↗ KW CROSS HIGH
americanamongchangescollegecreatedestablishedeventsformsgrowingnationalpossessionprimaryprofessionalschoolsuper
SHARED TOKENS (15): "american", "among", "changes", "college", "created", "established", "events", "forms", "growing", "national", "possession", "primary", "professional", "school", "super".
0.300
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialcompetitiveformsintellectuallegallicensedmaintainpropertyregistrationtradeunauthorized
SHARED TOKENS (15): "agreements", "among", "assets", "business", "commercial", "competitive", "forms", "intellectual", "legal", "licensed", "maintain", "property", "registration", "trade", "unauthorized".
0.300
assetsbusinesscombinedcommissioncompetitivecorporatedepartmententityfederalgovernedgovernmentlawlegalmarketoperatingoperationsorganizationprohibitsregulatoryrequires
SHARED TOKENS (26): "assets", "business", "combined", "commission", "competitive", "corporate", "department", "entity", "federal", "governed", "government", "law", "legal", "market", "operating", "operations", "organization", "prohibits", "regulatory", "requires"....
0.300
agreementsconditioncourtemployeesemployersemploymentfederalfeegeneralgovernmentlaborlawlocalprohibitspublicrequiredsecuritywork
SHARED TOKENS (18): "agreements", "condition", "court", "employees", "employers", "employment", "federal", "fee", "general", "government", "labor", "law", "local", "prohibits", "public", "required", "security", "work".
0.300
actionsactiveamericancivilcommunitycourtcreatedfallformsgovernmentgrouplawoldestpermitspracticepublicrequiresrights
SHARED TOKENS (18): "actions", "active", "american", "civil", "community", "court", "created", "fall", "forms", "government", "group", "law", "oldest", "permits", "practice", "public", "requires", "rights".
0.300
Mountaineering ↗ Q36908 KW CROSS HIGH
changesenvironmentenvironmentalgovernancegrouplandlandscapelargelevellocalmountainorganizationresourcessupportvertical
SHARED TOKENS (15): "changes", "environment", "environmental", "governance", "group", "land", "landscape", "large", "level", "local", "mountain", "organization", "resources", "support", "vertical".
0.300
departmentgovernmentidahorecreationregistration
SHARED TOKENS (5): "department", "government", "idaho", "recreation", "registration". | EXACT TITLE in sports_recreation: "Idaho Department of Parks and Recreation".
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
activelyanalysisarchitecturebusinesscitiescivilcommunitydevelopmentdistributionenvironmentenvironmentalgrowthindependentindividualslandland-uselandscapemaintainneedsphysical
SHARED TOKENS (36): "actively", "analysis", "architecture", "business", "cities", "civil", "community", "development", "distribution", "environment", "environmental", "growth", "independent", "individuals", "land", "land-use", "landscape", "maintain", "needs", "physical"....
0.300
addressadministeredchangesenvironmentalfederalformlawmaintainnameownedphysicalprimaryprotectionqualitywater
SHARED TOKENS (15): "address", "administered", "changes", "environmental", "federal", "form", "law", "maintain", "name", "owned", "physical", "primary", "protection", "quality", "water".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalamericanassociationcivilcompletecorporatecourtsdepartmenteducationfederalindividualslawlegallicensedmattersnationalpracticeprofessionalpropertypublic
SHARED TOKENS (27): "additional", "american", "association", "civil", "complete", "corporate", "courts", "department", "education", "federal", "individuals", "law", "legal", "licensed", "matters", "national", "practice", "professional", "property", "public"....
0.300
addressconsentcourtestablishedfederalgovernmenthistoryindividualslawlegallocalphysicalprohibitspropertyrightssearch
SHARED TOKENS (16): "address", "consent", "court", "established", "federal", "government", "history", "individuals", "law", "legal", "local", "physical", "prohibits", "property", "rights", "search".
0.300
accessagreementsbusinesscannotcommunityemployeesemploymenteventsformerindividualsknowledgelawlegalmaterialpaidprogramrequiredsingletrade
SHARED TOKENS (19): "access", "agreements", "business", "cannot", "community", "employees", "employment", "events", "former", "individuals", "knowledge", "law", "legal", "material", "paid", "program", "required", "single", "trade".
0.300
bodynationalorganizationsrecognizedusa
SHARED TOKENS (5): "body", "national", "organizations", "recognized", "usa". | EXACT TITLE in sports_recreation: "USA Climbing".
0.300
bodyconditionconducteducationfullgeneralguidelinesindividualsmedicalphysicalpowerprofessionalprogramrequiressupporttraining
SHARED TOKENS (16): "body", "condition", "conduct", "education", "full", "general", "guidelines", "individuals", "medical", "physical", "power", "professional", "program", "requires", "support", "training".
0.300
activeadministrativeamericancourtcourtscoveringcreateddistrictdistrictsfederalidahojudgesjurisdictionlargestmeetingservewestern
SHARED TOKENS (17): "active", "administrative", "american", "court", "courts", "covering", "created", "district", "districts", "federal", "idaho", "judges", "jurisdiction", "largest", "meeting", "serve", "western".
0.300
Labour law ↗ Q628967 KW CROSS HIGH
agenciescodecontractorsemployeesemployersemploymentformergoverngovernmentlaborlawregulatoryrightsstandardstradeworkworkers
SHARED TOKENS (17): "agencies", "code", "contractors", "employees", "employers", "employment", "former", "govern", "government", "labor", "law", "regulatory", "rights", "standards", "trade", "work", "workers".
0.300
agreementsamongassociationsbusinesscompetitivecourtscoversemployeesemployersformerindividualslaborlawlegalmarketmarketssupportsystemtradeworkers
SHARED TOKENS (20): "agreements", "among", "associations", "business", "competitive", "courts", "covers", "employees", "employers", "former", "individuals", "labor", "law", "legal", "market", "markets", "support", "system", "trade", "workers".
0.300
americanappliescivilcourteducationfederalgovernmentindividualsitselfjurisdictionlargelawlocalprimaryprotectionrequiresrightssection
SHARED TOKENS (18): "american", "applies", "civil", "court", "education", "federal", "government", "individuals", "itself", "jurisdiction", "large", "law", "local", "primary", "protection", "requires", "rights", "section".
0.300
accessactiveadaboisedistrictidahoitselfjunelandlegallevellocalmeetingmountainpropertytraffictreasurevalleywestern
SHARED TOKENS (19): "access", "active", "ada", "boise", "district", "idaho", "itself", "june", "land", "legal", "level", "local", "meeting", "mountain", "property", "traffic", "treasure", "valley", "western".
0.300
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesbodiesconditioncourtsgovernmentjudgeslandlawlegalpowerrequirementrightsstatutorytrade
SHARED TOKENS (17): "administrative", "agencies", "american", "applies", "bodies", "condition", "courts", "government", "judges", "land", "law", "legal", "power", "requirement", "rights", "statutory", "trade".
0.300
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsenforcementintellectualjurisdictionlegalownersprimarypropertyprotectionregistrationrightssourcesstandardstrade
SHARED TOKENS (15): "agencies", "agreements", "enforcement", "intellectual", "jurisdiction", "legal", "owners", "primary", "property", "protection", "registration", "rights", "sources", "standards", "trade".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationcannotcompletecontractorscourtcourtsdebtfeefeeslawlegalpaymentprincipalpropertyrealsecuritystatutorytitle
SHARED TOKENS (18): "association", "cannot", "complete", "contractors", "court", "courts", "debt", "fee", "fees", "law", "legal", "payment", "principal", "property", "real", "security", "statutory", "title".
0.300
associationbusinesscorporateentityformgovernedincomelegalliabilitylicensemedicaloperatingoperationsorganizationorganizedownersphysicalprimaryprofessionalrequired
SHARED TOKENS (22): "association", "business", "corporate", "entity", "form", "governed", "income", "legal", "liability", "license", "medical", "operating", "operations", "organization", "organized", "owners", "physical", "primary", "professional", "required"....
0.300
activeamericanassociationassociationsbodycommercialcommunitycreateddevelopmentestateformgoverngovernedgovernsgrowthjurisdictionlandlargelawlegal
SHARED TOKENS (34): "active", "american", "association", "associations", "body", "commercial", "community", "created", "development", "estate", "form", "govern", "governed", "governs", "growth", "jurisdiction", "land", "large", "law", "legal"....
0.300
activecannotchaptercodecourtcourtscreateddistrictdistrictsfederalgoverngovernmentitselfjudgesjurisdictionmatterssystemwest
SHARED TOKENS (18): "active", "cannot", "chapter", "code", "court", "courts", "created", "district", "districts", "federal", "govern", "government", "itself", "judges", "jurisdiction", "matters", "system", "west".
0.300
chaptercodecourtcourtsdebtformgeneralincomeplanspowerprioritypropertyprotectionsectionstatutorytitle
SHARED TOKENS (16): "chapter", "code", "court", "courts", "debt", "form", "general", "income", "plans", "power", "priority", "property", "protection", "section", "statutory", "title".
0.300
activeadministrativeagenciesannualcitiescourtcourtscoversdistrictestablishedfederalformerjudgesjurisdictionlargelawlegalnationalorganizedpopulation
SHARED TOKENS (26): "active", "administrative", "agencies", "annual", "cities", "court", "courts", "covers", "district", "established", "federal", "former", "judges", "jurisdiction", "large", "law", "legal", "national", "organized", "population"....
0.300
associationassociationsbodybusinesscourtgeneraljurisdictionlawlegalorganizationsorganizedphysicalpracticeprofessionalpublicregulationresponsibleseparateserving
SHARED TOKENS (19): "association", "associations", "body", "business", "court", "general", "jurisdiction", "law", "legal", "organizations", "organized", "physical", "practice", "professional", "public", "regulation", "responsible", "separate", "serving".
0.300
businesscommercialestatefeeformgeneralindependentinstitutionalinsurancelandlargelawlegaloutsidepaymentpropertyrealregistrationrequirementsecurity
SHARED TOKENS (22): "business", "commercial", "estate", "fee", "form", "general", "independent", "institutional", "insurance", "land", "large", "law", "legal", "outside", "payment", "property", "real", "registration", "requirement", "security"....
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
civilconductcourtcourtsindependentjurisdictionlargelawlegalmattersphysicalpublicrequiredreviewseparateservespecial
SHARED TOKENS (17): "civil", "conduct", "court", "courts", "independent", "jurisdiction", "large", "law", "legal", "matters", "physical", "public", "required", "review", "separate", "serve", "special".
0.300
Futsal ↗ Q171401 EXACT TITLE
associationbeyondcourtprofessionalsurface
SHARED TOKENS (5): "association", "beyond", "court", "professional", "surface". | EXACT TITLE in sports_recreation: "Futsal".
0.300
adaboiseconstructionfederalformsfullidahoirrigationlevelmountainoperatingpowerprimaryriverwestern
SHARED TOKENS (15): "ada", "boise", "construction", "federal", "forms", "full", "idaho", "irrigation", "level", "mountain", "operating", "power", "primary", "river", "western".
0.300
agenciesauthoritybodyfoodgovernmenthealthcareindependentjurisdictionlicensingmarketsregulationregulatoryresponsiblesafetystandards
SHARED TOKENS (15): "agencies", "authority", "body", "food", "government", "healthcare", "independent", "jurisdiction", "licensing", "markets", "regulation", "regulatory", "responsible", "safety", "standards".
0.300
actionsagenciesauthoritycourtscreatedenvironmentenvironmentalestablishedfederalgovernmentlawnationalqualityreportsrequirementrequires
SHARED TOKENS (16): "actions", "agencies", "authority", "courts", "created", "environment", "environmental", "established", "federal", "government", "law", "national", "quality", "reports", "requirement", "requires".
0.300
americanamongassociationbenefitscollegecourtinstitutionslawnationalnonprofitorganizationpaidrightssinglespecialsubdivisionsystemuniversity
SHARED TOKENS (18): "american", "among", "association", "benefits", "college", "court", "institutions", "law", "national", "nonprofit", "organization", "paid", "rights", "single", "special", "subdivision", "system", "university".
0.300
Disc golf ↗ Q876737 EXACT TITLE
associationcompletedirectoryfreeprofessional
SHARED TOKENS (5): "association", "complete", "directory", "free", "professional". | EXACT TITLE in sports_recreation: "Disc golf".
0.300
actionsaddressbodyemploymentenforcementgovernmentinstitutionslaworganizationorganizationsprotectionpublicregulatereportresourceswork
SHARED TOKENS (16): "actions", "address", "body", "employment", "enforcement", "government", "institutions", "law", "organization", "organizations", "protection", "public", "regulate", "report", "resources", "work".
0.300
Franchising ↗ Q171947 KW CROSS HIGH
businesscorporateentityexpansionexplicitlyfeesfranchisegrowthintellectuallargelegalliabilitylicenseslicensingmarketobligationsownedpracticepropertyregulate
SHARED TOKENS (22): "business", "corporate", "entity", "expansion", "explicitly", "fees", "franchise", "growth", "intellectual", "large", "legal", "liability", "licenses", "licensing", "market", "obligations", "owned", "practice", "property", "regulate"....
0.300
authoritycodeconsumercourtcourtsdistrictfederalgovernedgovernsjurisdictionlawpropertyprotectionrightssectiontitle
SHARED TOKENS (16): "authority", "code", "consumer", "court", "courts", "district", "federal", "governed", "governs", "jurisdiction", "law", "property", "protection", "rights", "section", "title".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessactionsbenefitsdatafullgovernmentlargestlevellicensenameprogramrecordsreportresourcesresponsiblesecuritytechnologyuniversity
SHARED TOKENS (18): "access", "actions", "benefits", "data", "full", "government", "largest", "level", "license", "name", "program", "records", "report", "resources", "responsible", "security", "technology", "university".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
actionsadministrativeamericananalysisassociationbodiesbusinessconductcourtcourtscreateddepartmentseducationentityenvironmentestablishedexperiencefamilyformsfull
SHARED TOKENS (46): "actions", "administrative", "american", "analysis", "association", "bodies", "business", "conduct", "court", "courts", "created", "departments", "education", "entity", "environment", "established", "experience", "family", "forms", "full"....
0.300
agreementscommunityfoodformformsfreelawlegalmaterialnationalorganizationspowerprotectionpublicrecognizedrightssecurityspecialtrade
SHARED TOKENS (19): "agreements", "community", "food", "form", "forms", "free", "law", "legal", "material", "national", "organizations", "power", "protection", "public", "recognized", "rights", "security", "special", "trade".
0.300
approvalscommercialconstructioncontractorsdevelopersdevelopmentenvironmentalestategrowthlandpermitsplanningplansprogramprojectspropertypublicrealregulationregulatory
SHARED TOKENS (22): "approvals", "commercial", "construction", "contractors", "developers", "development", "environmental", "estate", "growth", "land", "permits", "planning", "plans", "program", "projects", "property", "public", "real", "regulation", "regulatory"....
0.300
Title IX ↗ Q3133007 KW CROSS HIGH
addressamericancivileducationemploymentfederalformsfullgovernmentjunelawprogramprohibitspublicrightsschooltitle
SHARED TOKENS (17): "address", "american", "civil", "education", "employment", "federal", "forms", "full", "government", "june", "law", "program", "prohibits", "public", "rights", "school", "title".
0.300
Probate court ↗ Q7246899 KW CROSS HIGH
actionsassetsauthoritycountiescourtcourtscreateddistributiondistrictestatejurisdictionlawlegislativematterspropertystatutory
SHARED TOKENS (16): "actions", "assets", "authority", "counties", "court", "courts", "created", "distribution", "district", "estate", "jurisdiction", "law", "legislative", "matters", "property", "statutory".
🫐 BERRY137 edges
0.280
commercialgrouporganizationsupport
SHARED TOKENS (4): "commercial", "group", "organization", "support". | EXACT TITLE in sports_recreation: "Sponsor (commercial)".
0.280
agenciesauthoritycommissioncoversfederallawlevelliabilitylistingorganizationsprimaryregulationregulatorysecurity
SHARED TOKENS (14): "agencies", "authority", "commission", "covers", "federal", "law", "level", "liability", "listing", "organizations", "primary", "regulation", "regulatory", "security".
0.280
amongannualchangescourtsfallgovernmentgroundsgrouphistorylegaloutsideprogramsecondsection
SHARED TOKENS (14): "among", "annual", "changes", "courts", "fall", "government", "grounds", "group", "history", "legal", "outside", "program", "second", "section".
0.280
additionalagenciesaidcontactdepartmentemployeesinjuriesmedicalprimarypublicresourcessearchsupporttraining
SHARED TOKENS (14): "additional", "agencies", "aid", "contact", "department", "employees", "injuries", "medical", "primary", "public", "resources", "search", "support", "training".
0.280
actionscodeemployeesemploymentenvironmentformgenerallegalorganizationsphysicalproprofessionalrelationshipswork
SHARED TOKENS (14): "actions", "code", "employees", "employment", "environment", "form", "general", "legal", "organizations", "physical", "pro", "professional", "relationships", "work".
0.280
americanclassestablishedexpansionhistoryidahoindependentmarketnationaloperatespartnerprofessionalsystemwestern
SHARED TOKENS (14): "american", "class", "established", "expansion", "history", "idaho", "independent", "market", "national", "operates", "partner", "professional", "system", "western".
0.280
communitycompletecomplexemploymenteventsfallinjuriesinjuryphysicalrecreationrequiredsafetysupporttraining
SHARED TOKENS (14): "community", "complete", "complex", "employment", "events", "fall", "injuries", "injury", "physical", "recreation", "required", "safety", "support", "training".
0.280
departmentsenvironmentgovernmentguidelinesindividualsinjuriesinjurynationalorganizationspresspropertystreetsustainedtraffic
SHARED TOKENS (14): "departments", "environment", "government", "guidelines", "individuals", "injuries", "injury", "national", "organizations", "press", "property", "street", "sustained", "traffic".
0.280
additionaladministeredcoversdepartmentemployeesemployersfamilylaborlawmedicalpublicwageworkworkers
SHARED TOKENS (14): "additional", "administered", "covers", "department", "employees", "employers", "family", "labor", "law", "medical", "public", "wage", "work", "workers".
0.280
knowledgelegalnationalorganization
SHARED TOKENS (4): "knowledge", "legal", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.280
Probation ↗ Q13961 KW CROSS HIGH
appliescommunitycontactcourtcourtsformerjurisdictionlawmaintainpartnerpermitpossessionprogramrequired
SHARED TOKENS (14): "applies", "community", "contact", "court", "courts", "former", "jurisdiction", "law", "maintain", "partner", "permit", "possession", "program", "required".
0.280
Road transport ↗ KW CROSS HIGH
developmentfoodformsfulllargelicensinglocalsafetyseparateshortspecialstandardtrafficvolume
SHARED TOKENS (14): "development", "food", "forms", "full", "large", "licensing", "local", "safety", "separate", "short", "special", "standard", "traffic", "volume".
0.280
civilcourtsformsirrigationlandlawlegalliabilitypossessionpowerresponsiblestandardsystemwater
SHARED TOKENS (14): "civil", "courts", "forms", "irrigation", "land", "law", "legal", "liability", "possession", "power", "responsible", "standard", "system", "water".
0.280
Boise River ↗ Q891080 EXACT TITLE
boiseidahoriverwestern
SHARED TOKENS (4): "boise", "idaho", "river", "western". | EXACT TITLE in sports_recreation: "Boise River".
0.280
appliescourtfederalgovernmentlawlevellocalpropertyprotectionpublicrequirementrequiresrightsserve
SHARED TOKENS (14): "applies", "court", "federal", "government", "law", "level", "local", "property", "protection", "public", "requirement", "requires", "rights", "serve".
0.260
Stadium ↗ Q483110 EXACT TITLE
associationeventslarge
SHARED TOKENS (3): "association", "events", "large". | EXACT TITLE in sports_recreation: "Stadium".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
cannotconductcourtinjuriesinsurancelawlegalliabilitypaidpublicrecognitionspecialsystem
SHARED TOKENS (13): "cannot", "conduct", "court", "injuries", "insurance", "law", "legal", "liability", "paid", "public", "recognition", "special", "system".
0.260
assetscollectiondevelopmentgovernmentinstitutionsoperatingoutsidepaidprojectspublicresultingtransactionwater
SHARED TOKENS (13): "assets", "collection", "development", "government", "institutions", "operating", "outside", "paid", "projects", "public", "resulting", "transaction", "water".
0.260
amongboisecollegeestablishedidaholevelmountainnationalprogramrepresentssubdivisionuniversitywest
SHARED TOKENS (13): "among", "boise", "college", "established", "idaho", "level", "mountain", "national", "program", "represents", "subdivision", "university", "west".
0.260
Family law ↗ Q384014 EXACT TITLE
familylawmatters
SHARED TOKENS (3): "family", "law", "matters". | EXACT TITLE in legal: "Family law".
0.260
competitivesinglesurface
SHARED TOKENS (3): "competitive", "single", "surface". | EXACT TITLE in sports_recreation: "Snowboarding".
0.260
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerdebtentityfamilyfullgovernmentlawlegaloralpaidpriorityrequires
SHARED TOKENS (13): "agreements", "consumer", "debt", "entity", "family", "full", "government", "law", "legal", "oral", "paid", "priority", "requires".
0.260
departmentidahoresponsible
SHARED TOKENS (3): "department", "idaho", "responsible". | EXACT TITLE in sports_recreation: "Idaho Department of Fish and Game".
0.260
civilcourtlaw
SHARED TOKENS (3): "civil", "court", "law". | EXACT TITLE in sports_recreation: "Discovery (law)".
0.260
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycivilcourtsformslawlegallocalpracticepublicresourcesservesstandards
SHARED TOKENS (13): "agreements", "authority", "civil", "courts", "forms", "law", "legal", "local", "practice", "public", "resources", "serves", "standards".
0.260
Skiing ↗ Q130949 EXACT TITLE
competitiveeventsrecognized
SHARED TOKENS (3): "competitive", "events", "recognized". | EXACT TITLE in sports_recreation: "Skiing".
0.260
Beneficiary ↗ Q2596417 KW CROSS HIGH
aidassetsbenefitscreateddevelopmententityfinanceinsurancelawlegalpaymentprimaryprojects
SHARED TOKENS (13): "aid", "assets", "benefits", "created", "development", "entity", "finance", "insurance", "law", "legal", "payment", "primary", "projects".
0.260
Public space ↗ Q294440 KW CROSS HIGH
experiencefeesgeneralgovernmentlandscapelegalownedownerspaidpropertypublicrequiredrights
SHARED TOKENS (13): "experience", "fees", "general", "government", "landscape", "legal", "owned", "owners", "paid", "property", "public", "required", "rights".
0.240
Family court ↗ Q82749 KW CROSS HIGH
addresschangescourtcourtscreatedfamilylawlegalmattersrelationshipssupportsystem
SHARED TOKENS (12): "address", "changes", "court", "courts", "created", "family", "law", "legal", "matters", "relationships", "support", "system".
0.240
americanamongcannotcourtcourtsgeneralindividualslegalpublicrequiredshortsystem
SHARED TOKENS (12): "american", "among", "cannot", "court", "courts", "general", "individuals", "legal", "public", "required", "short", "system".
0.240
Leisure ↗ Q180910 KW CROSS HIGH
analysisbusinesseducationexperiencefamilyfreeindividualsqualityrecreationrelationshipsrightswork
SHARED TOKENS (12): "analysis", "business", "education", "experience", "family", "free", "individuals", "quality", "recreation", "relationships", "rights", "work".
0.240
administersamericanbodyfullgovernsnationalnonprofitoperatesorganizationorganizationsprofessionaltraining
SHARED TOKENS (12): "administers", "american", "body", "full", "governs", "national", "nonprofit", "operates", "organization", "organizations", "professional", "training".
0.240
Civil liberties ↗ Q29556 KW CROSS HIGH
authoritycivilexpandinggovernmentlawpowerpresspropertyprotectionrightssecuritywork
SHARED TOKENS (12): "authority", "civil", "expanding", "government", "law", "power", "press", "property", "protection", "rights", "security", "work".
0.240
agenciesappliesassociationcivilcourtfinanceformsfreegovernmentpressrightsschool
SHARED TOKENS (12): "agencies", "applies", "association", "civil", "court", "finance", "forms", "free", "government", "press", "rights", "school".
0.240
Swimming pool ↗ Q1501 KW CROSS HIGH
basincompetitivecomplexconstructioneducationinstitutionallargestlocalphysicalresidentstrainingwater
SHARED TOKENS (12): "basin", "competitive", "complex", "construction", "education", "institutional", "largest", "local", "physical", "residents", "training", "water".
0.240
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesbodyconditiondistributionestatefamilyformsjurisdictionlawpropertyresultingstatutory
SHARED TOKENS (12): "applies", "body", "condition", "distribution", "estate", "family", "forms", "jurisdiction", "law", "property", "resulting", "statutory".
0.240
associationboisecollegeidaholevelmountainnationalnationallyprogramschooluniversitywest
SHARED TOKENS (12): "association", "boise", "college", "idaho", "level", "mountain", "national", "nationally", "program", "school", "university", "west".
0.240
analysisbodycivilcourtsfulljurisdictionlawlegallegislativepropertyrequiresstatutory
SHARED TOKENS (12): "analysis", "body", "civil", "courts", "full", "jurisdiction", "law", "legal", "legislative", "property", "requires", "statutory".
0.240
administrativecannotcivilcommissionemployersemploymentestablishedfederalgovernmentnationalpracticerights
SHARED TOKENS (12): "administrative", "cannot", "civil", "commission", "employers", "employment", "established", "federal", "government", "national", "practice", "rights".
0.240
actionscombinedcompleteconsentformhealthcareitselfjurisdictionlegalmedicalpowersingle
SHARED TOKENS (12): "actions", "combined", "complete", "consent", "form", "healthcare", "itself", "jurisdiction", "legal", "medical", "power", "single".
0.240
appliescannotcourtcourtsformfulljudgeslawmaterialrealstandardsupport
SHARED TOKENS (12): "applies", "cannot", "court", "courts", "form", "full", "judges", "law", "material", "real", "standard", "support".
0.220
conductcourtknowledgelawlegalpowerpropertyrequiredrequirementsearchstandard
SHARED TOKENS (11): "conduct", "court", "knowledge", "law", "legal", "power", "property", "required", "requirement", "search", "standard".
0.220
Kinesiology ↗ Q657632 EXACT TITLE
bodyphysical
SHARED TOKENS (2): "body", "physical". | EXACT TITLE in sports_recreation: "Kinesiology".
0.220
Tort ↗ Q158970 KW CROSS HIGH
actionscivilcodeestablishedindividualslawlegalliabilityobligationsresultingseparate
SHARED TOKENS (11): "actions", "civil", "code", "established", "individuals", "law", "legal", "liability", "obligations", "resulting", "separate".
0.220
Arena ↗ Q641226 EXACT TITLE
eventslarge
SHARED TOKENS (2): "events", "large". | EXACT TITLE in sports_recreation: "Arena".
0.220
Attorney ↗ Q1289214 EXACT TITLE
lawpower
SHARED TOKENS (2): "law", "power". | EXACT TITLE in legal: "Attorney".
0.220
Damages ↗ Q308922 KW CROSS HIGH
formgeneralinjurylawlegalmedicalpaidphysicalpropertyrecognizedspecial
SHARED TOKENS (11): "form", "general", "injury", "law", "legal", "medical", "paid", "physical", "property", "recognized", "special".
0.220
Referee ↗ Q202648 EXACT TITLE
judgesresponsible
SHARED TOKENS (2): "judges", "responsible". | EXACT TITLE in sports_recreation: "Referee".
0.220
U visa ↗ Q17086349 KW CROSS HIGH
agenciescreatedenforcementfamilygovernmentimmediatelawpermitsphysicalprotectionserve
SHARED TOKENS (11): "agencies", "created", "enforcement", "family", "government", "immediate", "law", "permits", "physical", "protection", "serve".
0.220
civilconsentcourtenforcementformfreelawlegalpropertypublicsearch
SHARED TOKENS (11): "civil", "consent", "court", "enforcement", "form", "free", "law", "legal", "property", "public", "search".
0.220
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployeesemployersemploymentlawlevelnationalsupplytradeworkworkers
SHARED TOKENS (11): "beyond", "employees", "employers", "employment", "law", "level", "national", "supply", "trade", "work", "workers".
0.220
eagleidaho
SHARED TOKENS (2): "eagle", "idaho". | EXACT TITLE in sports_recreation: "Eagle Island State Park".
0.220
Hiking ↗ Q12014035 EXACT TITLE
formsorganizations
SHARED TOKENS (2): "forms", "organizations". | EXACT TITLE in sports_recreation: "Hiking".
0.220
complexgroup
SHARED TOKENS (2): "complex", "group". | EXACT TITLE in sports_recreation: "Sports complex".
0.220
activeagenciesenvironmentenvironmentalfederalindividualslandnonprofitorganizationsprotectionresponsible
SHARED TOKENS (11): "active", "agencies", "environment", "environmental", "federal", "individuals", "land", "nonprofit", "organizations", "protection", "responsible".
0.220
amongbodycommissiondistrictlegaloversightownedpublicregulationregulatoryserves
SHARED TOKENS (11): "among", "body", "commission", "district", "legal", "oversight", "owned", "public", "regulation", "regulatory", "serves".
0.220
addresscivilcommercialgovernedlawlegalpropertyrealrequiredrightssales
SHARED TOKENS (11): "address", "civil", "commercial", "governed", "law", "legal", "property", "real", "required", "rights", "sales".
0.220
Lawsuit ↗ Q697327 KW CROSS HIGH
actionsbusinesscivilcourtindividualsinjurieslawlegalorganizationspublicrequired
SHARED TOKENS (11): "actions", "business", "civil", "court", "individuals", "injuries", "law", "legal", "organizations", "public", "required".
0.220
Legal clinic ↗ Q1351667 KW CROSS HIGH
aidconductexperiencefreejudgeslawlegalproprogramschoolwork
SHARED TOKENS (11): "aid", "conduct", "experience", "free", "judges", "law", "legal", "pro", "program", "school", "work".
0.210
Recreation ↗ Q184872 EXACT TITLE
recreation
SHARED TOKENS (1): "recreation". | EXACT TITLE in legal: "Recreation". | EXACT TITLE in sports_recreation: "Recreation".
0.210
training
SHARED TOKENS (1): "training". | EXACT TITLE in sports_recreation: "Coach (sport)".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in legal: "Subdivision". | EXACT TITLE in sports_recreation: "Subdivision".
0.210
Boating ↗ Q2141830 EXACT TITLE
itself
SHARED TOKENS (1): "itself". | EXACT TITLE in sports_recreation: "Boating".
0.210
Trail ↗ Q628179 EXACT TITLE
territory
SHARED TOKENS (1): "territory". | EXACT TITLE in sports_recreation: "Trail".
0.210
training
SHARED TOKENS (1): "training". | EXACT TITLE in sports_recreation: "Climbing gym".
0.210
Paternity ↗ Q16881001 EXACT TITLE
law
SHARED TOKENS (1): "law". | EXACT TITLE in legal: "Paternity".
0.210
mountain
SHARED TOKENS (1): "mountain". | EXACT TITLE in sports_recreation: "Mountain biking".
0.200
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotcourtfamilylegalmedicalprofessionalpropertypublicserve
SHARED TOKENS (10): "authority", "cannot", "court", "family", "legal", "medical", "professional", "property", "public", "serve".
0.200
appliescommunitycourtdistrictgovernmentlevelpublicrequirementrequiresrights
SHARED TOKENS (10): "applies", "community", "court", "district", "government", "level", "public", "requirement", "requires", "rights".
0.200
Expungement ↗ Q2352928 KW CROSS HIGH
enforcementfederalgeneraljudgesjurisdictionlawlegalpublicrecordsreview
SHARED TOKENS (10): "enforcement", "federal", "general", "judges", "jurisdiction", "law", "legal", "public", "records", "review".
0.200
civilcourtcourtscoversdistrictdistrictsfederaljurisdictionlawresidents
SHARED TOKENS (10): "civil", "court", "courts", "covers", "district", "districts", "federal", "jurisdiction", "law", "residents".
0.200
Workplace wellness ↗ KW CROSS HIGH
benefitscorporateeducationfoodinsurancelargestmedicaloutsidestrongsupport
SHARED TOKENS (10): "benefits", "corporate", "education", "food", "insurance", "largest", "medical", "outside", "strong", "support".
0.200
activeannualassociationassociationsbeyondbodygovernedlevelnationalresponsible
SHARED TOKENS (10): "active", "annual", "association", "associations", "beyond", "body", "governed", "level", "national", "responsible".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictgrowingidahonamepopulationschoolwest
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "growing", "idaho", "name", "population", "school", "west".
0.200
americanestablishedformgrowthnamepremierproprofessionalsupersystem
SHARED TOKENS (10): "american", "established", "form", "growth", "name", "premier", "pro", "professional", "super", "system".
0.200
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualbenefitscontractorsemployeesemployersindependentlawwagework
SHARED TOKENS (10): "among", "annual", "benefits", "contractors", "employees", "employers", "independent", "law", "wage", "work".
0.200
Trial court ↗ Q3125101 KW CROSS HIGH
authoritycourtcourtsestablishedjudgesjurisdictionlawmatterspowerreview
SHARED TOKENS (10): "authority", "court", "courts", "established", "judges", "jurisdiction", "law", "matters", "power", "review".
0.200
administersbusinesscoveringdepartmentdevelopmentfederallandnationaloperationssystem
SHARED TOKENS (10): "administers", "business", "covering", "department", "development", "federal", "land", "national", "operations", "system".
0.200
distributiongovernmentlargelawpossessionpracticeregulateregulationsystemvolume
SHARED TOKENS (10): "distribution", "government", "large", "law", "possession", "practice", "regulate", "regulation", "system", "volume".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will". | EXACT TITLE in sports_recreation: "Will".
0.180
Criminal law ↗ Q146491 KW CROSS HIGH
bodycivilcommissionconductestablishedjurisdictionlawpropertysafety
SHARED TOKENS (9): "body", "civil", "commission", "conduct", "established", "jurisdiction", "law", "property", "safety".
0.180
aidamericanassociationcollegeestablishedinstitutionsnationalnetworkserves
SHARED TOKENS (9): "aid", "american", "association", "college", "established", "institutions", "national", "network", "serves".
0.180
Injunction ↗ Q6495575 KW CROSS HIGH
civilconductcourtcourtsformfulllawlegalspecial
SHARED TOKENS (9): "civil", "conduct", "court", "courts", "form", "full", "law", "legal", "special".
0.180
americanemploymentindividualsjunepermitprotectionsecondsupportwork
SHARED TOKENS (9): "american", "employment", "individuals", "june", "permit", "protection", "second", "support", "work".
0.180
businessentitylegalnameownedownersseparatetradework
SHARED TOKENS (9): "business", "entity", "legal", "name", "owned", "owners", "separate", "trade", "work".
0.170
governmentidaho
SHARED TOKENS (2): "government", "idaho". | URL->A (1): https://sos.idaho.gov/.
0.160
amonglandlaworganizedpropertyrightssystemwater
SHARED TOKENS (8): "among", "land", "law", "organized", "property", "rights", "system", "water".
0.160
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsurancenameobligationsprimaryprincipalpropertytransaction
SHARED TOKENS (8): "established", "insurance", "name", "obligations", "primary", "principal", "property", "transaction".
0.160
Sex offender ↗ Q5659979 KW CROSS HIGH
civilcontinuingjurisdictionlawlegalpublicregistrationstatutory
SHARED TOKENS (8): "civil", "continuing", "jurisdiction", "law", "legal", "public", "registration", "statutory".
0.160
bodychangeseducationformsinjuriesphysicalprofessionalstraining
SHARED TOKENS (8): "body", "changes", "education", "forms", "injuries", "physical", "professionals", "training".
0.160
additionalcourtemployershistorynationalrecordsresultingtraffic
SHARED TOKENS (8): "additional", "court", "employers", "history", "national", "records", "resulting", "traffic".
0.160
Magistrate ↗ Q4594605 KW CROSS HIGH
administerscivilcourtgovernmentlawlocalmattersresponsible
SHARED TOKENS (8): "administers", "civil", "court", "government", "law", "local", "matters", "responsible".
0.160
Deed ↗ Q705914 KW CROSS HIGH
lawlegalliabilitylicensespracticepropertyrightstitle
SHARED TOKENS (8): "law", "legal", "liability", "licenses", "practice", "property", "rights", "title".
0.160
Drug court ↗ Q5308883 KW CROSS HIGH
addresscombinedcourtcourtsenforcementlawpublicwork
SHARED TOKENS (8): "address", "combined", "court", "courts", "enforcement", "law", "public", "work".
0.160
cannotcourtenforcementknowledgelawprotectionrequiredrights
SHARED TOKENS (8): "cannot", "court", "enforcement", "knowledge", "law", "protection", "required", "rights".
0.160
americanassociationidaholaborownerspaidservingwestern
SHARED TOKENS (8): "american", "association", "idaho", "labor", "owners", "paid", "serving", "western".
0.160
coveringcreateddepartmentdistrictfederalnationalpublictitle
SHARED TOKENS (8): "covering", "created", "department", "district", "federal", "national", "public", "title".
0.160
chaptercodefederalformgoverngovernssectiontitle
SHARED TOKENS (8): "chapter", "code", "federal", "form", "govern", "governs", "section", "title".
0.140
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfamilylawlegalmaintenancerequiredsupport
SHARED TOKENS (7): "agreements", "family", "law", "legal", "maintenance", "required", "support".
0.140
Ice hockey ↗ Q41466 KW CROSS HIGH
bodycontactfamilyfullnationalprofessionalrecognized
SHARED TOKENS (7): "body", "contact", "family", "full", "national", "professional", "recognized".
0.140
accesscontactcourtlawmattersparentalrights
SHARED TOKENS (7): "access", "contact", "court", "law", "matters", "parental", "rights".
0.140
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbenefitsbusinesslegalqualitystandard
SHARED TOKENS (7): "applies", "assets", "benefits", "business", "legal", "quality", "standard".
0.140
associationassociationsbodylargestnationalorganizationwest
SHARED TOKENS (7): "association", "associations", "body", "largest", "national", "organization", "west".
0.140
administrativecourtfederallawlegalremovalreview
SHARED TOKENS (7): "administrative", "court", "federal", "law", "legal", "removal", "review".
0.140
Nordic skiing ↗ Q216613 KW CROSS HIGH
combinedcompetitiveeventsjurisdictionrequiresseparatetraining
SHARED TOKENS (7): "combined", "competitive", "events", "jurisdiction", "requires", "separate", "training".
0.140
Deposition ↗ Q1174534 KW CROSS HIGH
authoritycourtlawoutsidepowerremovaluniversity
SHARED TOKENS (7): "authority", "court", "law", "outside", "power", "removal", "university".
0.140
actionscodecollectioncourtdebtlawsection
SHARED TOKENS (7): "actions", "code", "collection", "court", "debt", "law", "section".
0.140
bodycitiescountieslegallocalmunicipalowned
SHARED TOKENS (7): "body", "cities", "counties", "legal", "local", "municipal", "owned".
0.140
forminjurieslawliabilitypropertypublicresponsible
SHARED TOKENS (7): "form", "injuries", "law", "liability", "property", "public", "responsible".
0.120
administeredassociationjurisdictionlawpracticerequired
SHARED TOKENS (6): "administered", "association", "jurisdiction", "law", "practice", "required".
0.120
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlawlegalpublicrights
SHARED TOKENS (6): "employment", "jurisdiction", "law", "legal", "public", "rights".
0.120
corporategovernmentindividualslaborprofessionalswage
SHARED TOKENS (6): "corporate", "government", "individuals", "labor", "professionals", "wage".
0.120
Legal ethics ↗ Q3655952 KW CROSS HIGH
conductdevelopmentitselflegalpracticeprofessional
SHARED TOKENS (6): "conduct", "development", "itself", "legal", "practice", "professional".
0.120
benefitsbeyondenvironmenteventsgenerategrowth
SHARED TOKENS (6): "benefits", "beyond", "environment", "events", "generate", "growth".
0.120
activeformslargelevelphysicalpublic
SHARED TOKENS (6): "active", "forms", "large", "level", "physical", "public".
0.120
boisecollegeidahorepresentsschooluniversity
SHARED TOKENS (6): "boise", "college", "idaho", "represents", "school", "university".
0.120
americanfulllegalrightssystemwater
SHARED TOKENS (6): "american", "full", "legal", "rights", "system", "water".
0.120
americancivillegalmatterspublictrade
SHARED TOKENS (6): "american", "civil", "legal", "matters", "public", "trade".
0.120
Parasports ↗ Q814517 KW CROSS HIGH
competitivecreatedformsintellectuallevelphysical
SHARED TOKENS (6): "competitive", "created", "forms", "intellectual", "level", "physical".
0.120
courtfulllawlegaloldestprofessional
SHARED TOKENS (6): "court", "full", "law", "legal", "oldest", "professional".
0.120
Green belt ↗ Q1552255 KW CROSS HIGH
developmentestablishedgenerallandland-useplanning
SHARED TOKENS (6): "development", "established", "general", "land", "land-use", "planning".
0.120
Fraud ↗ Q28813 KW CROSS HIGH
benefitscivilitselflawlegalproperty
SHARED TOKENS (6): "benefits", "civil", "itself", "law", "legal", "property".
0.120
civillawlegalpaidresultingwork
SHARED TOKENS (6): "civil", "law", "legal", "paid", "resulting", "work".
0.120
businessformlawlegalpowerprincipal
SHARED TOKENS (6): "business", "form", "law", "legal", "power", "principal".
0.100
Kuna, Idaho ↗ KW CROSS HIGH
adaadditionalboiseidahopopulation
SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "population".
0.100
freegrowthprotectionsafetyshort
SHARED TOKENS (5): "free", "growth", "protection", "safety", "short".
0.100
Summons ↗ Q708245 KW CROSS HIGH
administrativecourtformgovernmentlegal
SHARED TOKENS (5): "administrative", "court", "form", "government", "legal".
0.100
assetsestatelawpaidproperty
SHARED TOKENS (5): "assets", "estate", "law", "paid", "property".
0.100
Parole ↗ Q5357120 KW CROSS HIGH
additionalformoutsideservingsystem
SHARED TOKENS (5): "additional", "form", "outside", "serving", "system".
0.100
boisecollegeidahorepresentsuniversity
SHARED TOKENS (5): "boise", "college", "idaho", "represents", "university".
0.100
authorityemploymentlawrightswage
SHARED TOKENS (5): "authority", "employment", "law", "rights", "wage".
0.100
Bail ↗ Q162351 KW CROSS HIGH
additionalcourtformpropertyrequired
SHARED TOKENS (5): "additional", "court", "form", "property", "required".
0.100
Discrimination ↗ Q169207 KW CROSS HIGH
classgroupinstitutionslegalrights
SHARED TOKENS (5): "class", "group", "institutions", "legal", "rights".
0.100
administeredindividualslevelnationalprofessional
SHARED TOKENS (5): "administered", "individuals", "level", "national", "professional".
0.100
Executor ↗ Q654437 KW CROSS HIGH
estateformlawpropertyresponsible
SHARED TOKENS (5): "estate", "form", "law", "property", "responsible".
0.100
Health club ↗ Q1065656 KW CROSS HIGH
amongexpandingphysicalpopulationroom
SHARED TOKENS (5): "among", "expanding", "physical", "population", "room".
◈ Frequently Asked Questions
Legal × Sports Recreation — Treasure Valley
HAIKU · HIGH GATE
What legal responsibilities do sports facilities in Boise and Meridian have under the Americans with Disabilities Act of 1990?
Public sports facilities in Boise and Meridian must comply with ADA accessibility standards for parking, entrances, seating, and restrooms. Negligence claims can arise when facilities in Ada County fail to maintain ADA-compliant conditions, exposing operators to liability.
How do water rights laws affect recreational use of rivers in the Treasure Valley?
Water rights in Ada County and Canyon County determine how much flow remains available for public recreation on rivers like the Boise River. Land-use planning decisions in Garden City, Eagle, and Caldwell must balance agricultural water claims against recreational access that drives population growth in the region.
What legal issues arise when private equity firms develop sports complexes in Nampa or Caldwell?
Private equity investments in sports facilities must comply with Ada County and Canyon County zoning laws and land-use planning requirements. Negligence liability and ADA compliance obligations apply equally to investor-owned recreational facilities as to public venues operated by Boise State University or city parks departments.
How do Boise State University's athletic facilities navigate water rights and land-use law?
Boise State's athletic fields and recreation areas in Ada County operate under specific water rights allocations that support turf maintenance and public use. Changes to regional water right assignments affect the university's ability to maintain sports facilities that serve both students and Treasure Valley residents.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Sports Recreation 16 QID bridges 325 edges 9,067 ext links 2026-07-17 21:49:47 UTC 5bb42fa6c0532a7f
Legal corridor ↗ Sports Recreation corridor ↗ Sports Recreation × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals