—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Photography

14 Wikipedia bridge articles confirmed in both vertical ledgers. 266 deterministic cross-vertical edges. 8,337 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
266 Cross Edges
8,337 External Sources
338 Wikipedia Articles
14 🌲 Evergreen
114 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Photography
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
266
External Sources Harvested
8,337
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  21 shared tokens
QID Bridge Titles (14)
IdahoReal estateContractBoise State UniversityTreasure ValleyLimited liability companyIntellectual propertyNampa, IdahoBoise, IdahoAda County, IdahoMeridian, IdahoCaldwell, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationlandnorthwestwestbusinesslegaladariverwesternrightscollegecanyonhomeagriculturalmountainnationalorganizedpacific
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:49:07 UTC
Content Hash
22adf86ad42289df
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in legal (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (21): "agricultural", "agriculture", "associated", "boise", "idaho", "land", "mining", "mountain", "national", "northwest", "organized", "pacific", "population", "products", "river", "sector", "separate", "technology", "territory", "west".... | EXACT TITLE in legal: "Idaho". | EXACT TITLE in photography: "Idaho".
agriculturalagricultureassociatedboiseidaholandminingmountainnationalnorthwestorganizedpacificpopulationproductsriversectorseparatetechnologyterritorywestwestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
R
Q684740 EXACT TITLE 1.000
QID OVERLAP: Q684740 in legal (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (15): "business", "commercial", "entity", "estate", "general", "government", "land", "legal", "natural", "owned", "personal", "property", "public", "real", "water". | EXACT TITLE in legal: "Real estate". | EXACT TITLE in photography: "Real estate".
businesscommercialentityestategeneralgovernmentlandlegalnaturalownedpersonalpropertypublicrealwater
ats, jewelry, furniture, tools, and the rolling stock of a farm and farm animals. The term real estate includes any land and buildings under private ownership, public (state) ownership or commercial (business) ownership. The purpose or usage of the real estate in question may differ from its ownership status. The property may be for residential or commercial use, used by the state, government or the general public. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S.
rty may be for residential or commercial use, used by the state, government or the general public. One example where ownership and purpose might differ would be an apartment block that is owned by a business but intended for residential use. In the United States, the transfer, ownership, or acquisition of real estate can be done by business corporations, individuals, nonprofit corporations, fiduciaries, or any legal entity as seen within the law of each U.S.
History of real estate The natural right of a person to own property as a concept can be seen as having roots in Roman law as well as Greek philosophy. The profession of appraisal can be seen as beginning in England during the 1500s, as agricultural needs required land clearing and land preparation. Textbooks on the subject of surveying began to be written and the term "surveying" was used in England, while the term "appraising" was more commonly used in North America. Natural law which can be seen as "universal law" was discussed among writers of the 15th and 16th centuries as it pertained to "property theory" and the inter-state relations dealing with foreign investments and the protection of citizens' private property abroad. Natural law can be seen as having an influence in Emerich de Vattel's 1758 treatise The Law of Nations which conceptualized the idea of private property. One of the largest initial real estate deals in history known as the "Louisiana Purchase" happened in 1803 when the Louisiana Purchase Treaty was signed. This treaty paved the way for western expansion and made the U.S. the owners of the "Louisiana Territory" as the land was bought from France for fifteen million dollars, making each acre roughly 4 cents. The oldest real estate brokerage firm was established in 1855 in Chicago, Illinois, and was initially known as "L. D. Olmsted & Co." but is now known as "Baird & Warner". In 1908, the National Association of Realtors was founded in Chicago and in 1916, the name was changed to the National Association of Real Estate Boards and this was also when the term "realtor" was coined to identify real estate professionals. The stock market crash of 1929 and the Great Depression in the U.S. caused a major drop in real estate value and prices and ultimately resulted in a depreciation of 50% for the four years after 1929. Housing financing in the U.S. was greatly affected by the Banking Act of 1933 and the National Housing Act in 1934 because it allowed for mortgage insurance for home buyers and this system was implemented by the Federal Deposit Insurance as well as the Federal Housing Administration. In 1938, an amendment was made to the National Housing Act and Fannie Mae, a government agency, was established to serve as a secondary market for mortgages and to give lenders more money in order for new homes to be funded. Title VIII of the Civil Rights Act in the U.S., which is also known as the Fair Housing Act, was put into place in 1968 and dealt with the incorporation of African Americans into neighborhoods as the issues of discrimination were analyzed with the renting, buying, and financing of homes. Internet real estate as a concept began with the first appearance of real estate platforms on the World Wide Web (www) and occurred in 1999. Residential real estate Residential real estate may contain either a single-family or multifamily structure that is available for occupation or for non-business purposes. Residences can be classified by how they are connected to neighbouring residences and land. Different types of housing tenure can be used for the same physical type. For example, connected residences might be owned by a single entity and leased out, or owned separately with an agreement covering the relationship between units and common areas and concerns. According to the Congressional Research Service, in 2021, 65% of homes in the U.S.
C
Q93288 EXACT TITLE 1.000
QID OVERLAP: Q93288 in legal (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (16): "agreements", "business", "code", "commercial", "consent", "enforcement", "framework", "general", "governed", "independent", "legal", "meeting", "national", "obligations", "practice", "rights". | EXACT TITLE in legal: "Contract". | EXACT TITLE in photography: "Contract".
agreementsbusinesscodecommercialconsentenforcementframeworkgeneralgovernedindependentlegalmeetingnationalobligationspracticerights
or rescission. A binding agreement between actors in international law is known as a treaty. Contract law, the field of the law of obligations concerned with contracts, is based on the principle that agreements must be honoured. Like other areas of private law, contract law varies between jurisdictions. In general, contract law is exercised and governed either under common law jurisdictions, civil law jurisdictions, or mixed-law jurisdictions that combine elements of both common and civil law. Common law jurisdictions typically require contracts to include consideration in order to be valid, whereas civil and most mixed-law jurisdictions solely require a meeting of the minds between the parties. Within the overarching category of civil law jurisdictions, there are several distinct varieties of contract law with their own distinct criteria: the German tradition is characterised by the unique doctrine of abstraction, systems based on the Napoleonic Code are characterised by their systematic distinction between different types of contracts, and Roman-Dutch law is largely based on the writings of renaissance-era Dutch jurists and case law applying general principles of Roman law prior to the Netherlands' adoption of the Napoleonic Code. The UNIDROIT Principles of International Commercial Contracts, published in 2016, aim to provide a general harmonised framework for international contracts, independent of the divergences between national laws, as well as a statement of common contractual principles for arbitrators and judges to apply where national laws are lacking. Notably, the Principles reject the doctrine of consideration, arguing that elimination of the doctrine "bring[s] about greater certainty and reduce litigation" in international trade. The Principles also rejected the abstraction principle on the grounds that it and similar doctrines are "not easily compatible with modern business perceptions and practice". Contract law can be contrasted with tort law (also referred to in some jurisdictions as the law of delicts), the other major area of the law of obligations. While tort law generally deals with private duties and obligations that exist by operation of law, and provide remedies for civil wrongs committed between individuals not in a pre-existing legal relationship, contract law provides for the creation and enforcement of duties and obligations through a prior agreement between parties.
A contract is often evidenced in writing or by deed. The general rule is that a person who signs a contractual document will be bound by the terms in that document. This rule is referred to as the rule in L'Estrange v Graucob or the "signature rule". This rule was approved by the High Court of Australia in Toll (FGCT) Pty Ltd v Alphapharm Pty Ltd. The rule typically binds a signatory to a contract regardless of whether they have actually read it, provided the document is contractual in nature. However, defences such as duress or unconscionability may enable the signer to avoid the obligation. Further, reasonable notice of a contract's terms must be given to the other party prior to their entry into the contract. Written contracts have typically been preferred in common law legal systems. In 1677 England passed the Statute of Frauds which influenced similar statute of frauds laws in the United States and other countries such as Australia. In general, the Uniform Commercial Code as adopted in the United States requires a written contract for tangible product sales in excess of $500, and for real estate contracts to be written. If the contract is not required by law to be written, an oral contract is generally valid and legally binding. The United Kingdom has since replaced the original Statute of Frauds, but written contracts are still required for various circumstances such as land (through the Law of Property Act 1925). Apart from using a written document, a valid contract may generally be made orally or even by conduct. An oral contract may also be called a parol contract or a verbal contract, with "verbal" meaning "spoken" rather than "in words", an established usage in British English with regards to contracts and agreements, and common although somewhat deprecated as "loose" in American English. An unwritten, unspoken contract, also known as "a contract implied by the acts of the parties", which can be legally implied either from the facts or as required in law. Implied-in-fact contracts are real contracts under which parties receive the "benefit of the bargain".
In commercial agreements it is presumed that parties intend to be legally bound unless the parties expressly state the opposite. For example, in Rose & Frank Co v JR Crompton & Bros Ltd, an agreement between two business parties was not enforced because an "honour clause" in the document stated "this is not a commercial or legal agreement, but is only a statement of the intention of the parties". In contrast, domestic and social agreements such as those between children and parents are typically unenforceable on the basis of public policy. For example, in the English case Balfour v. Balfour a husband agreed to give his wife £30 a month while he was away from home, but the court refused to enforce the agreement when the husband stopped paying. In contrast, in Merritt v Merritt the court enforced an agreement between an estranged couple because the circumstances suggested their agreement was intended to have legal consequences. If the terms of a contract are so uncertain or incomplete as to elude reasonable interpretation, the parties cannot have reached an agreement in the eyes of the law. An agreement to agree does not constitute a contract, and an inability to agree on key issues, which may include such things as price or safety, may cause an entire contract to fail. However, a court will attempt to give effect to commercial contracts where possible, by construing a reasonable construction of the contract. In New South Wales, even if there is uncertainty or incompleteness in a contract, the contract may still be binding on the parties if there is a sufficiently certain and complete clause requiring the parties to undergo arbitration, negotiation or mediation. Courts may also look to external standards, which are either mentioned explicitly in the contract or implied by common practice in a certain field. In addition, the court may also imply a term; if price is excluded, the court may imply a reasonable price, with the exception of land, and second-hand goods, which are unique. If there are uncertain or incomplete clauses in the contract, and all options in resolving its true meaning have failed, it may be possible to sever and void just those affected clauses if the contract includes a severability clause. The test of whether a clause is severable is an objective test—whether a reasonable person would see the contract standing even without the clauses. Typically, non-severable contracts only require the substantial performance of a promise rather than the whole or complete performance of a promise to warrant payment.
Boise State University
EXACT TITLE 0.980
QID OVERLAP: Q891082 in legal (tier:branch) and photography (tier:evergreen). | SHARED TOKENS (14): "among", "boise", "business", "college", "education", "idaho", "independent", "member", "mountain", "program", "public", "school", "university", "west". | EXACT TITLE in photography: "Boise State University".
amongboisebusinesscollegeeducationidahoindependentmembermountainprogrampublicschooluniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in legal (tier:evergreen) and photography (tier:evergreen). | SHARED TOKENS (11): "agricultural", "association", "boise", "chambers", "idaho", "land", "local", "river", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in photography: "Treasure Valley".
agriculturalassociationboisechambersidaholandlocalrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Limited liability company
Q149789 QID OVERLAP 0.800
QID OVERLAP: Q149789 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (23): "association", "business", "certificate", "corporate", "entity", "form", "governed", "legal", "liability", "license", "medical", "member", "operating", "operations", "organization", "organized", "owners", "physical", "professional", "required"....
associationbusinesscertificatecorporateentityformgovernedlegalliabilitylicensemedicalmemberoperatingoperationsorganizationorganizedownersphysicalprofessionalrequiredrightssingletax
PLLC). An LLC is a hybrid legal entity with characteristics of both a corporation and a partnership or sole proprietorship (depending on how many owners there are). An LLC is a type of unincorporated association, distinct from a corporation. The primary characteristic an LLC shares with a corporation is limited liability, and the primary characteristic it shares with a partnership is the availability of pass-through income taxation. As a business entity, an LLC is often more flexible than a corporation and may be well-suited for companies with a single owner. Although LLCs and corporations possess analogous features, the basic terminology used within the United States is different. When an LLC is formed, it is organized rather than incorporated, and its founding document is known as the articles of organization instead of the articles of incorporation. Internal operations of an LLC are governed by its operating agreement. An owner of an LLC is called a member rather than a shareholder. Additionally, ownership is represented by a membership interest (measured in units or percentages) rather than shares of stock.
History The first state to enact a law authorizing the creation of limited liability companies was Wyoming in 1977. The law was a project of the Hamilton Brothers Oil Company, which sought to organize its business in the United States with liability and tax advantages similar to those it had obtained in Panama. From 1960 to 1997, the classification of unincorporated business associations for the purpose of U.S. federal income tax law was governed by the Kintner regulations, which were named after the prevailing taxpayer in the 1954 legal precedent of that name. As promulgated by the Internal Revenue Service (IRS) in 1960, the Kintner regulations set forth a complex six-factor test for determining whether such business associations would be taxed as corporations or partnerships. Some of these factors had equal significance, so that the presence of only half of them would result in classification as a partnership. Accordingly, the Wyoming Legislature tailored its statute to grant LLCs particular corporate features without exceeding this threshold. For several years, other states were slow to adopt the LLC form because it was unclear how the IRS and courts would apply the Kintner regulations to it. After the IRS finally decided in 1988 in Revenue Ruling 88-76 that Wyoming LLCs were taxable as partnerships, other states began to take the LLC seriously and enacted their own LLC statutes. By 1996, all 50 states and the District of Columbia had LLC statutes.
A limited liability company (LLC) is a United States-specific form of a private limited company. It is a business structure that can combine the pass-through taxation of a partnership or sole proprietorship with the limited liability of a corporation. An LLC is not a corporation under the laws of every state; it is a legal form of a company that provides limited liability to its owners in many jurisdictions. LLCs are known for the flexibility that they provide to business owners. Depending on the situation, an LLC may elect to use corporate tax rules instead of being treated as a partnership, and under certain circumstances, LLCs may be organized as not-for-profit. In certain U.S. states (for example, Texas), businesses that provide professional services requiring a state professional license, such as legal or medical services, may not be allowed to form an LLC but may be required to form a similar entity called a professional limited liability company (PLLC). An LLC is a hybrid legal entity with characteristics of both a corporation and a partnership or sole proprietorship (depending on how many owners there are). An LLC is a type of unincorporated association, distinct from a corporation. The primary characteristic an LLC shares with a corporation is limited liability, and the primary characteristic it shares with a partnership is the availability of pass-through income taxation. As a business entity, an LLC is often more flexible than a corporation and may be well-suited for companies with a single owner. Although LLCs and corporations possess analogous features, the basic terminology used within the United States is different. When an LLC is formed, it is organized rather than incorporated, and its founding document is known as the articles of organization instead of the articles of incorporation. Internal operations of an LLC are governed by its operating agreement. An owner of an LLC is called a member rather than a shareholder. Additionally, ownership is represented by a membership interest (measured in units or percentages) rather than shares of stock.
Intellectual property
Q131257 EXACT TITLE 0.780
QID OVERLAP: Q131257 in legal (tier:evergreen) and photography (tier:branch). | SHARED TOKENS (4): "land", "legal", "property", "rights". | EXACT TITLE in legal: "Intellectual property".
landlegalpropertyrights
l property, and some countries recognize more than others. The best-known types are patents, copyrights, trademarks, and trade secrets. The modern concept of intellectual property was developed in England in the 17th and 18th centuries. The term "intellectual property" began to be used in the 19th century, though it was not until the late 20th century that intellectual property became commonplace in most of the world's legal systems. Supporters of intellectual property laws often describe their main purpose as encouraging the creation of a wide variety of intellectual goods. To achieve this, the law gives people and businesses property rights to certain information and intellectual goods they create, usually for a limited period of time. Supporters argue that because IP laws allow people to protect their original ideas and prevent unauthorized copying, creators derive greater individual economic benefit from the information and intellectual goods they create, and thus have more economic incentives to create them in the first place. Advocates of IP believe that these economic incentives and legal protections stimulate innovation and contribute to technological progress of certain kinds. The intangible nature of intellectual property presents difficulties when compared with traditional property like land or goods. Unlike traditional property, intellectual property is "indivisible", since an unlimited number of people can in theory "consume" an intellectual good without its being depleted. Additionally, investments in intellectual goods suffer from appropriation problems: Landowners can surround their land with a robust fence and hire armed guards to protect it, but producers of information or literature can usually do little to stop their first buyer from replicating it and selling it at a lower price.
tions stimulate innovation and contribute to technological progress of certain kinds. The intangible nature of intellectual property presents difficulties when compared with traditional property like land or goods. Unlike traditional property, intellectual property is "indivisible", since an unlimited number of people can in theory "consume" an intellectual good without its being depleted. Additionally, investments in intellectual goods suffer from appropriation problems: Landowners can surround their land with a robust fence and hire armed guards to protect it, but producers of information or literature can usually do little to stop their first buyer from replicating it and selling it at a lower price.
ible", since an unlimited number of people can in theory "consume" an intellectual good without its being depleted. Additionally, investments in intellectual goods suffer from appropriation problems: Landowners can surround their land with a robust fence and hire armed guards to protect it, but producers of information or literature can usually do little to stop their first buyer from replicating it and selling it at a lower price.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "northwest", "population", "principal", "student", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannampanorthwestpopulationprincipalstudentuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (12): "ada", "annual", "boise", "counties", "home", "idaho", "population", "river", "sectors", "technology", "treasure", "valley".
adaannualboisecountieshomeidahopopulationriversectorstechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.660
QID OVERLAP: Q109820 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (8): "ada", "boise", "home", "idaho", "local", "northwest", "pacific", "population".
adaboisehomeidaholocalnorthwestpacificpopulation
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "cities", "idaho", "meridian", "population".
adaamongboisecitiesidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.620
QID OVERLAP: Q486078 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (6): "boise", "caldwell", "canyon", "idaho", "nampa", "population".
boisecaldwellcanyonidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in legal (tier:branch) and photography (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
252 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP252 edges
🌿 BRANCH114 edges
0.500
License ↗ Q79719 EXACT TITLE
americanbeyondbusinessenglishfeegovernmentitselflandlegallicenselicensedlicenseslicensingmarketoperatingpermitpermitspropertyprotectionrights
SHARED TOKENS (25): "american", "beyond", "business", "english", "fee", "government", "itself", "land", "legal", "license", "licensed", "licenses", "licensing", "market", "operating", "permit", "permits", "property", "protection", "rights".... | EXACT TITLE in legal: "License". | EXACT TITLE in photography: "License".
0.500
Copyright ↗ Q1297822 EXACT TITLE
agreementsamongbeyondexclusiveformgroupitselflargelegallicensenationalpropertypublicregistrationrightssetterritoryworkworks
SHARED TOKENS (19): "agreements", "among", "beyond", "exclusive", "form", "group", "itself", "large", "legal", "license", "national", "property", "public", "registration", "rights", "set", "territory", "work", "works". | EXACT TITLE in photography: "Copyright".
0.500
Corporation ↗ Q167037 EXACT TITLE
bodybusinesscontextcorporateentityestablishedlegalliabilitylocalmembernaturalobligationsofficeownedownerspracticepublicregistrationsingleworkers
SHARED TOKENS (20): "body", "business", "context", "corporate", "entity", "established", "legal", "liability", "local", "member", "natural", "obligations", "office", "owned", "owners", "practice", "public", "registration", "single", "workers". | EXACT TITLE in legal: "Corporation".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetsbodybusinesscreatedenglishentityestablishedfederalgovernedlegalnaturalownerspropertypublicrequiressingletrust
SHARED TOKENS (17): "assets", "body", "business", "created", "english", "entity", "established", "federal", "governed", "legal", "natural", "owners", "property", "public", "requires", "single", "trust". | EXACT TITLE in legal: "Trust (law)". | EXACT TITLE in photography: "Trust (law)".
0.500
amongcommissiondevelopmentenglishestatefinancialgovernmentlegalmethodologynationalpropertyrealrightssystemtransactiontransactions
SHARED TOKENS (16): "among", "commission", "development", "english", "estate", "financial", "government", "legal", "methodology", "national", "property", "real", "rights", "system", "transaction", "transactions". | EXACT TITLE in legal: "Real estate transaction".
0.500
americanassociationcitiescommunitydevelopmentdistrictsenvironmentallandland-usenaturalneedsphysicalplanningprojectregionalwater
SHARED TOKENS (16): "american", "association", "cities", "community", "development", "districts", "environmental", "land", "land-use", "natural", "needs", "physical", "planning", "project", "regional", "water". | EXACT TITLE in photography: "Land-use planning".
0.500
Metadata ↗ Q180160 EXACT TITLE
accessanalysiscollectionscontextdataexperiencefilefilesgovernmenthistoryhtmlnationalonlineorganizationsstandardstrafficwork
SHARED TOKENS (17): "access", "analysis", "collections", "context", "data", "experience", "file", "files", "government", "history", "html", "national", "online", "organizations", "standards", "traffic", "work". | EXACT TITLE in photography: "Metadata".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongclaimsdisclosureexclusivefallindustriallegalmembernationalorganizationpropertyprotectionpublicrightstechnology
SHARED TOKENS (16): "agreements", "among", "claims", "disclosure", "exclusive", "fall", "industrial", "legal", "member", "national", "organization", "property", "protection", "public", "rights", "technology". | EXACT TITLE in legal: "Patent".
0.500
bodybusinesscommercialcommunityconductcorporateemployeesenvironmentfinancialformationgovernslegalmarketmattersorganizationspracticerightssystem
SHARED TOKENS (18): "body", "business", "commercial", "community", "conduct", "corporate", "employees", "environment", "financial", "formation", "governs", "legal", "market", "matters", "organizations", "practice", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalagriculturebeyondbodyconsumerdepartmentemploymentfeegrowthknowledgeleadphysicalpresenceprogramprojectsrequiredrequiressecurityspecialtywage
SHARED TOKENS (21): "additional", "agriculture", "beyond", "body", "consumer", "department", "employment", "fee", "growth", "knowledge", "lead", "physical", "presence", "program", "projects", "required", "requires", "security", "specialty", "wage".... | EXACT TITLE in legal: "H-1B visa".
0.500
appliesbusinesscommercialcompensationformgenerallegalliabilitylicenselicensesmaterialpaidpublicpublishesrequiredrightsseparatespecialwork
SHARED TOKENS (19): "applies", "business", "commercial", "compensation", "form", "general", "legal", "liability", "license", "licenses", "material", "paid", "public", "publishes", "required", "rights", "separate", "special", "work". | EXACT TITLE in photography: "Model release".
0.500
Zoning ↗ Q702232 EXACT TITLE
developmentformgoverngovernmentgrowthguidelinesindustriallandland-uselocalplanningpropertyregulatoryscalesetsinglezoning
SHARED TOKENS (17): "development", "form", "govern", "government", "growth", "guidelines", "industrial", "land", "land-use", "local", "planning", "property", "regulatory", "scale", "set", "single", "zoning". | EXACT TITLE in legal: "Zoning". | EXACT TITLE in photography: "Zoning".
0.500
LinkedIn ↗ Q213660 EXACT TITLE
accessamericanamongbeyondbusinessdevelopmenteventsfinancingfirmsmembersnetworkonlineportalprofessionalprofessionalssalessecurityvalley
SHARED TOKENS (18): "access", "american", "among", "beyond", "business", "development", "events", "financing", "firms", "members", "network", "online", "portal", "professional", "professionals", "sales", "security", "valley". | EXACT TITLE in photography: "LinkedIn".
0.500
americanannualassociationboisebusinesscollegeeducationemploymentenvironmentalestablishedexpansionfallfullidahomembernaturalplansprogrampropertypublic
SHARED TOKENS (23): "american", "annual", "association", "boise", "business", "college", "education", "employment", "environmental", "established", "expansion", "fall", "full", "idaho", "member", "natural", "plans", "program", "property", "public".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
combinedconsumercreatedfallfilefilesformhistorymarketsprocessingprofessionalprofessionalsqualityrequiredreviewsettechnologywork
SHARED TOKENS (18): "combined", "consumer", "created", "fall", "file", "files", "form", "history", "markets", "processing", "professional", "professionals", "quality", "required", "review", "set", "technology", "work". | EXACT TITLE in photography: "Digital photography".
0.500
Trademark ↗ Q167270 EXACT TITLE
agenciesagreementsassociatedenforcementexclusivelegalmemberofficeownersproductspropertyprotectionregistrationrightsstandards
SHARED TOKENS (15): "agencies", "agreements", "associated", "enforcement", "exclusive", "legal", "member", "office", "owners", "products", "property", "protection", "registration", "rights", "standards". | EXACT TITLE in photography: "Trademark".
0.500
agenciesamericandatadepartmentfamiliesfederalgovernmentlaborlocalmaintainofficeprincipalpublicqualityresourceservessystem
SHARED TOKENS (17): "agencies", "american", "data", "department", "families", "federal", "government", "labor", "local", "maintain", "office", "principal", "public", "quality", "resource", "serves", "system". | EXACT TITLE in photography: "Bureau of Labor Statistics".
0.500
amongcompensationcreatedemployeesemploymentformgeneralinsuranceliabilitymandatorymedicaloutsidepaymentplanssecuritysystemwageworkers
SHARED TOKENS (18): "among", "compensation", "created", "employees", "employment", "form", "general", "insurance", "liability", "mandatory", "medical", "outside", "payment", "plans", "security", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyoncommercialconstructioncreatedheavilyhistoryidahoirrigationlargenationalnorthwestpacificprojectspublicriverterritorytribalvalley
SHARED TOKENS (22): "agencies", "american", "canyon", "commercial", "construction", "created", "heavily", "history", "idaho", "irrigation", "large", "national", "northwest", "pacific", "projects", "public", "river", "territory", "tribal", "valley".... | EXACT TITLE in legal: "Snake River".
0.500
agenciesagreementscompensationdevelopmentenforcementenvironmentenvironmentalgrowthlegalnationalnationallynaturalneedsorganizationspreservationprotectionregulatoryresourcerightssafety
SHARED TOKENS (21): "agencies", "agreements", "compensation", "development", "enforcement", "environment", "environmental", "growth", "legal", "national", "nationally", "natural", "needs", "organizations", "preservation", "protection", "regulatory", "resource", "rights", "safety".... | EXACT TITLE in legal: "Environmental law".
0.500
appliesassetsbodybusinesscodecommercialconductconsumeremploymentfallfinancialfinancingfoodformationframeworkgeneralgovernguidelinesinsurancelegal
SHARED TOKENS (36): "applies", "assets", "body", "business", "code", "commercial", "conduct", "consumer", "employment", "fall", "financial", "financing", "food", "formation", "framework", "general", "govern", "guidelines", "insurance", "legal".... | EXACT TITLE in legal: "Commercial law".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteducationfallgovernedidaholargenampapopulationpublicsouthweststudenttreasurevalleywestern
SHARED TOKENS (20): "ada", "boise", "canyon", "college", "community", "counties", "development", "education", "fall", "governed", "idaho", "large", "nampa", "population", "public", "southwest", "student", "treasure", "valley", "western". | EXACT TITLE in photography: "College of Western Idaho".
0.500
collectioncreateddevelopmentenforcementfamilyfinancialguidelinesmemberneedsobligationspaidpaymentrequiredrequiresreviewrightssinglestandard
SHARED TOKENS (18): "collection", "created", "development", "enforcement", "family", "financial", "guidelines", "member", "needs", "obligations", "paid", "payment", "required", "requires", "review", "rights", "single", "standard". | EXACT TITLE in legal: "Child support".
0.480
enforcementenglishenvironmentalgovernslandlegalpersonalpropertypublicrealrightsseparatesettrust
SHARED TOKENS (14): "enforcement", "english", "environmental", "governs", "land", "legal", "personal", "property", "public", "real", "rights", "separate", "set", "trust". | EXACT TITLE in legal: "Property law".
0.480
combinedcommercialdevelopmentfineformhistorymeetingnaturalonlinepublicqualityrequiredrightsstandard
SHARED TOKENS (14): "combined", "commercial", "development", "fine", "form", "history", "meeting", "natural", "online", "public", "quality", "required", "rights", "standard". | EXACT TITLE in photography: "History of photography".
0.460
Arbitration ↗ Q207946 EXACT TITLE
alternativecommercialconsumercontextemploymententityformlocalmandatorymattersreviewrightstransactions
SHARED TOKENS (13): "alternative", "commercial", "consumer", "context", "employment", "entity", "form", "local", "mandatory", "matters", "review", "rights", "transactions". | EXACT TITLE in legal: "Arbitration".
0.460
amongcontextestablishedexperiencefamilyfinancialhomemembersofficeorganizationphysicalreligioustechnology
SHARED TOKENS (13): "among", "context", "established", "experience", "family", "financial", "home", "members", "office", "organization", "physical", "religious", "technology". | EXACT TITLE in legal: "Domestic violence".
0.460
claimsfamilylandlegalpropertypublicrealregistrationrepresentingrequiredrightsservesstatutes
SHARED TOKENS (13): "claims", "family", "land", "legal", "property", "public", "real", "registration", "representing", "required", "rights", "serves", "statutes". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in photography: "Title (property)".
0.460
Tourism ↗ Q49389 EXACT TITLE
beyondbusinesscommercialdevelopmentenvironmentenvironmentalgrowthlocalmarketsorganizationorganizationsoutsidereal
SHARED TOKENS (13): "beyond", "business", "commercial", "development", "environment", "environmental", "growth", "local", "markets", "organization", "organizations", "outside", "real". | EXACT TITLE in photography: "Tourism".
0.460
Architecture ↗ Q12271 EXACT TITLE
architectureconstructionformitselflocalmaterialmeetingneedsplanningpracticequalityreligiousworks
SHARED TOKENS (13): "architecture", "construction", "form", "itself", "local", "material", "meeting", "needs", "planning", "practice", "quality", "religious", "works". | EXACT TITLE in legal: "Architecture". | EXACT TITLE in photography: "Architecture".
0.460
Mediation ↗ Q223871 EXACT TITLE
agreementsamongassistancecommercialdifferencesformindependentlegallicensingneedspracticeprofessionaltraining
SHARED TOKENS (13): "agreements", "among", "assistance", "commercial", "differences", "form", "independent", "legal", "licensing", "needs", "practice", "professional", "training". | EXACT TITLE in legal: "Mediation".
0.460
adaboisecombinedcommercialcommissiondepartmentgeneralidahonationaloperatesprotectionrightswestern
SHARED TOKENS (13): "ada", "boise", "combined", "commercial", "commission", "department", "general", "idaho", "national", "operates", "protection", "rights", "western". | EXACT TITLE in photography: "Boise Airport".
0.440
attorneyscontinuingdevelopmenteducationlegallicensesmaintainmandatoryoutsidepracticeprofessionalrequired
SHARED TOKENS (12): "attorneys", "continuing", "development", "education", "legal", "licenses", "maintain", "mandatory", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.440
JCPenney ↗ Q920037 EXACT TITLE
americancombineddepartmentdepartmentsformgrouphomelegacyownedproductspropertytraffic
SHARED TOKENS (12): "american", "combined", "department", "departments", "form", "group", "home", "legacy", "owned", "products", "property", "traffic". | EXACT TITLE in photography: "JCPenney".
0.440
consumercreateddatahistorymaintainneedsoperatingproductsprofilerepresentationstandardsystem
SHARED TOKENS (12): "consumer", "created", "data", "history", "maintain", "needs", "operating", "products", "profile", "representation", "standard", "system". | EXACT TITLE in photography: "Color management".
0.440
compensationdevelopmentfeefullgovernmentlandlegalownerspaymentpropertypublictax
SHARED TOKENS (12): "compensation", "development", "fee", "full", "government", "land", "legal", "owners", "payment", "property", "public", "tax". | EXACT TITLE in legal: "Eminent domain".
0.430
boisecreatedidahooperations
SHARED TOKENS (4): "boise", "created", "idaho", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.420
americanbodyconductenglishentitylegalliabilitymedicalpersonalpropertyquality
SHARED TOKENS (11): "american", "body", "conduct", "english", "entity", "legal", "liability", "medical", "personal", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.420
Freelancer ↗ Q215279 EXACT TITLE
associationsclientscontractoremploymentenglishindependentlaborprofessionaltaxworkworkers
SHARED TOKENS (11): "associations", "clients", "contractor", "employment", "english", "independent", "labor", "professional", "tax", "work", "workers". | EXACT TITLE in photography: "Freelancer".
0.420
departmentdevelopmentestablishedfederalgovernmentirrigationprogramprojectsresourcewaterwestern
SHARED TOKENS (11): "department", "development", "established", "federal", "government", "irrigation", "program", "projects", "resource", "water", "western". | EXACT TITLE in photography: "Bureau of Reclamation".
0.420
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmentflowformationhomeindustriallandlayerleadmaterialwater
SHARED TOKENS (11): "beyond", "environment", "flow", "formation", "home", "industrial", "land", "layer", "lead", "material", "water". | EXACT TITLE in legal: "Aquifer".
0.420
Assault ↗ Q365680 EXACT TITLE
chargescombinedcontactfinelegalliabilityphysicalpoliceseparatesinglesystem
SHARED TOKENS (11): "charges", "combined", "contact", "fine", "legal", "liability", "physical", "police", "separate", "single", "system". | EXACT TITLE in legal: "Assault".
0.420
Lawyer ↗ Q40348 EXACT TITLE
educationknowledgelegalmatterspracticeprofessionalrequiredrightssystemtrainingwork
SHARED TOKENS (11): "education", "knowledge", "legal", "matters", "practice", "professional", "required", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.420
bodyclaimsgeneralgovernmentofficeonlinepublicrecordsregistrationservingworks
SHARED TOKENS (11): "body", "claims", "general", "government", "office", "online", "public", "records", "registration", "serving", "works". | EXACT TITLE in photography: "United States Copyright Office".
0.420
assistancecannotestablishedfederalfullgovernmentlegalofficepublicrepresentationrequires
SHARED TOKENS (11): "assistance", "cannot", "established", "federal", "full", "government", "legal", "office", "public", "representation", "requires". | EXACT TITLE in legal: "Public defender".
0.400
boisechambersdatadistrictsgovernmentidahomemberspopulationrepresentingsingle
SHARED TOKENS (10): "boise", "chambers", "data", "districts", "government", "idaho", "members", "population", "representing", "single". | EXACT TITLE in legal: "Idaho Legislature".
0.400
Photography ↗ Q11633 EXACT TITLE
businesscontactfileformmaterialoperatespracticeprocessingproducesreal
SHARED TOKENS (10): "business", "contact", "file", "form", "material", "operates", "practice", "processing", "produces", "real". | EXACT TITLE in photography: "Photography".
0.400
assetscommercialcreateddepartmentfederalgovernmentorganizationprotectionstandardstraffic
SHARED TOKENS (10): "assets", "commercial", "created", "department", "federal", "government", "organization", "protection", "standards", "traffic". | EXACT TITLE in photography: "Federal Aviation Administration".
0.400
Airspace ↗ Q272730 EXACT TITLE
enforcementestablishedguidelineslegalnationaloperationsorganizationregulatoryterritorytraffic
SHARED TOKENS (10): "enforcement", "established", "guidelines", "legal", "national", "operations", "organization", "regulatory", "territory", "traffic". | EXACT TITLE in photography: "Airspace".
0.400
bodyfederalgovernmentheavilylandpopulationrightsstatutesstatutorytax
SHARED TOKENS (10): "body", "federal", "government", "heavily", "land", "population", "rights", "statutes", "statutory", "tax". | EXACT TITLE in legal: "Constitutional law".
0.380
Law firm ↗ Q613142 EXACT TITLE
assistancebusinessclientsentitylegalmatterspracticerightstransactions
SHARED TOKENS (9): "assistance", "business", "clients", "entity", "legal", "matters", "practice", "rights", "transactions". | EXACT TITLE in legal: "Law firm".
0.380
businesscontractoremploymentindependentmemberneedsrealtaxwork
SHARED TOKENS (9): "business", "contractor", "employment", "independent", "member", "needs", "real", "tax", "work". | EXACT TITLE in photography: "Self-employment".
0.380
accessestablishedidahomaterialofficepreservationprogrampublicrecords
SHARED TOKENS (9): "access", "established", "idaho", "material", "office", "preservation", "program", "public", "records". | EXACT TITLE in photography: "Idaho State Historical Society".
0.380
homeidahoitselflargemountainpreservationpublicrecreationwestern
SHARED TOKENS (9): "home", "idaho", "itself", "large", "mountain", "preservation", "public", "recreation", "western". | EXACT TITLE in photography: "Bruneau Dunes State Park".
0.360
associatedconstructiondevelopmentfinancingindustrialplanningproductswork
SHARED TOKENS (8): "associated", "construction", "development", "financing", "industrial", "planning", "products", "work". | EXACT TITLE in legal: "Construction". | EXACT TITLE in photography: "Construction".
0.360
accesscontactfamilylegalmemberphysicalrightsstandard
SHARED TOKENS (8): "access", "contact", "family", "legal", "member", "physical", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.360
Pro bono ↗ Q127537 EXACT TITLE
communityenglishlegalpaymentprofessionalprofessionalspublicwork
SHARED TOKENS (8): "community", "english", "legal", "payment", "professional", "professionals", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.360
Inheritance ↗ Q200303 EXACT TITLE
amongassetslegalobligationspracticepropertyrightsstatutory
SHARED TOKENS (8): "among", "assets", "legal", "obligations", "practice", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.360
Green card ↗ Q6676995 EXACT TITLE
amongcertificatefederalformgeneralmemberregistrationworkers
SHARED TOKENS (8): "among", "certificate", "federal", "form", "general", "member", "registration", "workers". | EXACT TITLE in legal: "Green card".
0.360
Lifetouch ↗ Q6545544 EXACT TITLE
americanemployeesfamiliesheadquarterednationaloperatesoperationsschool
SHARED TOKENS (8): "american", "employees", "families", "headquartered", "national", "operates", "operations", "school". | EXACT TITLE in photography: "Lifetouch".
0.360
cannotdeterminesestablisheditselflegalreviewstandardsystem
SHARED TOKENS (8): "cannot", "determines", "established", "itself", "legal", "review", "standard", "system". | EXACT TITLE in legal: "Appellate court".
0.360
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationlegalprofessionalschoolsystemuniversity
SHARED TOKENS (8): "college", "department", "education", "legal", "professional", "school", "system", "university". | EXACT TITLE in legal: "Law school".
0.360
Jury ↗ Q837675 EXACT TITLE
bodyenglishgrouplegalprofessionalsetsinglesystem
SHARED TOKENS (8): "body", "english", "group", "legal", "professional", "set", "single", "system". | EXACT TITLE in legal: "Jury".
0.360
idaho
SHARED TOKENS (1): "idaho". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
0.360
itselflargeneedsproducesprofessionalqualityseparatespecial
SHARED TOKENS (8): "itself", "large", "needs", "produces", "professional", "quality", "separate", "special". | EXACT TITLE in photography: "Flash (photography)".
0.360
Sales tax ↗ Q11055488 EXACT TITLE
bodyconsumerdifferenceseducationfoodpaidsalestax
SHARED TOKENS (8): "body", "consumer", "differences", "education", "food", "paid", "sales", "tax". | EXACT TITLE in legal: "Sales tax". | EXACT TITLE in photography: "Sales tax".
0.360
businessdirectoriesdirectorylocalnationalonlineorganizedsystem
SHARED TOKENS (8): "business", "directories", "directory", "local", "national", "online", "organized", "system". | EXACT TITLE in photography: "Yellow pages".
0.360
E-commerce ↗ Q484847 EXACT TITLE
businesscollectioncommercialdataonlineprocessingproductstransaction
SHARED TOKENS (8): "business", "collection", "commercial", "data", "online", "processing", "products", "transaction". | EXACT TITLE in photography: "E-commerce".
0.360
Creditor ↗ Q157165 EXACT TITLE
assetsfinancialgeneralgovernmentorganizationpropertyrepresentssecurity
SHARED TOKENS (8): "assets", "financial", "general", "government", "organization", "property", "represents", "security". | EXACT TITLE in legal: "Creditor".
0.340
Darkroom ↗ Q601413 EXACT TITLE
associatedcollegedevelopmentprocessingprofessionaltechnologywater
SHARED TOKENS (7): "associated", "college", "development", "processing", "professional", "technology", "water". | EXACT TITLE in photography: "Darkroom".
0.340
assetsestatelegalneedsplanningpropertytax
SHARED TOKENS (7): "assets", "estate", "legal", "needs", "planning", "property", "tax". | EXACT TITLE in legal: "Estate planning".
0.340
Adoption ↗ Q180472 EXACT TITLE
governedlegalrecognitionreligiousrequiresrightsstatutes
SHARED TOKENS (7): "governed", "legal", "recognition", "religious", "requires", "rights", "statutes". | EXACT TITLE in legal: "Adoption".
0.340
Immigration law ↗ EXACT TITLE
governmentlegalmaintainmattersnationalrightsstatutes
SHARED TOKENS (7): "government", "legal", "maintain", "matters", "national", "rights", "statutes". | EXACT TITLE in legal: "Immigration law".
0.340
Probate ↗ Q6500369 EXACT TITLE
assetsclaimsestatelegalpersonalpropertypublic
SHARED TOKENS (7): "assets", "claims", "estate", "legal", "personal", "property", "public". | EXACT TITLE in legal: "Probate".
0.340
boiseidahooperatesownedplanningpropertywestern
SHARED TOKENS (7): "boise", "idaho", "operates", "owned", "planning", "property", "western". | EXACT TITLE in photography: "Boise Towne Square".
0.340
businesscommercialeventsgrouppersonalschoolspecial
SHARED TOKENS (7): "business", "commercial", "events", "group", "personal", "school", "special". | EXACT TITLE in photography: "Portrait photography".
0.340
constructionitselflaborpersonalpropertyrealsecurity
SHARED TOKENS (7): "construction", "itself", "labor", "personal", "property", "real", "security". | EXACT TITLE in legal: "Mechanic's lien".
0.340
clerkenglishfineformmarketsrecordssingle
SHARED TOKENS (7): "clerk", "english", "fine", "form", "markets", "records", "single". | EXACT TITLE in photography: "Color photography".
0.320
Divorce ↗ Q93190 EXACT TITLE
accesslegalpropertyreligiousrequiredrequires
SHARED TOKENS (6): "access", "legal", "property", "religious", "required", "requires". | EXACT TITLE in legal: "Divorce".
0.320
communityestateownedpropertyseparatesystem
SHARED TOKENS (6): "community", "estate", "owned", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.320
agenciesconductgovernmentpublicrecordstransactions
SHARED TOKENS (6): "agencies", "conduct", "government", "public", "records", "transactions". | EXACT TITLE in photography: "Public records".
0.320
groupinstitutionslegalmembersreligiousrights
SHARED TOKENS (6): "group", "institutions", "legal", "members", "religious", "rights". | EXACT TITLE in photography: "Discrimination".
0.320
agreementsestategovernlegalpropertyrights
SHARED TOKENS (6): "agreements", "estate", "govern", "legal", "property", "rights". | EXACT TITLE in legal: "Prenuptial agreement".
0.320
Camera ↗ Q15328 EXACT TITLE
consumerdevelopmentmaterialprofessionalseparatetechnology
SHARED TOKENS (6): "consumer", "development", "material", "professional", "separate", "technology". | EXACT TITLE in photography: "Camera".
0.320
cannotlegalmedicalprofessionalstandardstandards
SHARED TOKENS (6): "cannot", "legal", "medical", "professional", "standard", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.320
analysisdatadevelopmentexplicitlyframeworkmining
SHARED TOKENS (6): "analysis", "data", "development", "explicitly", "framework", "mining". | EXACT TITLE in photography: "Machine learning".
0.320
americangenerallegalreviewsinglesystem
SHARED TOKENS (6): "american", "general", "legal", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.320
citiesdevelopmentenvironmentlegacypreservationproducts
SHARED TOKENS (6): "cities", "development", "environment", "legacy", "preservation", "products". | EXACT TITLE in photography: "Historic preservation".
0.320
Olan Mills ↗ Q7083077 EXACT TITLE
americancorporatedirectoriesdirectoryheadquarteredowned
SHARED TOKENS (6): "american", "corporate", "directories", "directory", "headquartered", "owned". | EXACT TITLE in photography: "Olan Mills".
0.320
Court ↗ Q41487 EXACT TITLE
administrativeentityestablishedgovernmentlegalmatters
SHARED TOKENS (6): "administrative", "entity", "established", "government", "legal", "matters". | EXACT TITLE in legal: "Court".
0.320
Shutterfly ↗ Q7505672 EXACT TITLE
americanbusinessheadquarteredownedproductspublic
SHARED TOKENS (6): "american", "business", "headquartered", "owned", "products", "public". | EXACT TITLE in photography: "Shutterfly".
0.300
amongcommercialfoodprofessionalspecialization
SHARED TOKENS (5): "among", "commercial", "food", "professional", "specialization". | EXACT TITLE in photography: "Food photography".
0.300
annualbusinessconductdevelopmentemployeesentityfinancialfinancingfirmsformgrowthhistoryinstitutionalmarketmarketsoperatingoperationsownedpublicscale
SHARED TOKENS (21): "annual", "business", "conduct", "development", "employees", "entity", "financial", "financing", "firms", "form", "growth", "history", "institutional", "market", "markets", "operating", "operations", "owned", "public", "scale"....
0.300
agreementscompensationemployeesemploymentgrouporganizationrepresentingrightssafetysecuritysingletrainingwageworkworkers
SHARED TOKENS (15): "agreements", "compensation", "employees", "employment", "group", "organization", "representing", "rights", "safety", "security", "single", "training", "wage", "work", "workers".
0.300
Health care ↗ Q31207 KW CROSS HIGH
accessadditionaldevelopmentestablishedfinancialfinancinggeneralhealthcarehistoryinsurancemedicalneedsorganizationorganizationspaidpersonalphysicalprofessionalspublicquality
SHARED TOKENS (24): "access", "additional", "development", "established", "financial", "financing", "general", "healthcare", "history", "insurance", "medical", "needs", "organization", "organizations", "paid", "personal", "physical", "professionals", "public", "quality"....
0.300
Privacy law ↗ Q1247836 KW CROSS HIGH
collectioncontactdatafinancialgeneralgoverngovernshomemedicalorganizationspersonalphysicalpropertyprotectionrecordsrightssetstandardsstatutestechnology
SHARED TOKENS (20): "collection", "contact", "data", "financial", "general", "govern", "governs", "home", "medical", "organizations", "personal", "physical", "property", "protection", "records", "rights", "set", "standards", "statutes", "technology".
0.300
assetsbusinesscombinedcommissioncorporatedepartmententityfederalgovernedgovernmentlegalmarketoperatingoperationsorganizationprohibitsregulatoryrequiresreviewsingle
SHARED TOKENS (22): "assets", "business", "combined", "commission", "corporate", "department", "entity", "federal", "governed", "government", "legal", "market", "operating", "operations", "organization", "prohibits", "regulatory", "requires", "review", "single"....
0.300
agreementscontextemployeesemploymentfederalfeegeneralgovernmentlaborlocalmembermembersprohibitspublicrepresentationrequiredsectorsecuritysetstatutes
SHARED TOKENS (21): "agreements", "context", "employees", "employment", "federal", "fee", "general", "government", "labor", "local", "member", "members", "prohibits", "public", "representation", "required", "sector", "security", "set", "statutes"....
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalamericanassociationcorporatedepartmenteducationfederallegallicensedmattersnationalofficepracticeprofessionalpropertypublicqualifyingrequiresschoolspecialization
SHARED TOKENS (22): "additional", "american", "association", "corporate", "department", "education", "federal", "legal", "licensed", "matters", "national", "office", "practice", "professional", "property", "public", "qualifying", "requires", "school", "specialization"....
0.300
Use tax ↗ Q17155766 EXACT TITLE
paidpersonalpropertysalestax
SHARED TOKENS (5): "paid", "personal", "property", "sales", "tax". | EXACT TITLE in photography: "Use tax".
0.300
accessagreementsbusinesscannotclientcommunitycompensationdisclosureemployeesemploymenteventsknowledgelegalmaterialpaidprogramrequiredsingle
SHARED TOKENS (18): "access", "agreements", "business", "cannot", "client", "community", "compensation", "disclosure", "employees", "employment", "events", "knowledge", "legal", "material", "paid", "program", "required", "single".
0.300
activeamericanassociationassociationsbodycommercialcommunitycontextcreateddevelopmentestateformgoverngovernedgovernsgrowthindustriallandlargelegal
SHARED TOKENS (30): "active", "american", "association", "associations", "body", "commercial", "community", "context", "created", "development", "estate", "form", "govern", "governed", "governs", "growth", "industrial", "land", "large", "legal"....
0.300
activeadministrativeagenciesannualcitiesestablishedfederallargelegalnationalorganizedpopulationreviewsecuritysetsystemwest
SHARED TOKENS (17): "active", "administrative", "agencies", "annual", "cities", "established", "federal", "large", "legal", "national", "organized", "population", "review", "security", "set", "system", "west".
0.300
birthknowledgelegalnationalorganization
SHARED TOKENS (5): "birth", "knowledge", "legal", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
associationassociationsattorneysbodybusinessenglishgenerallegalmandatorymembersorganizationsorganizedphysicalpracticepracticingprofessionalpublicseparateserving
SHARED TOKENS (19): "association", "associations", "attorneys", "body", "business", "english", "general", "legal", "mandatory", "members", "organizations", "organized", "physical", "practice", "practicing", "professional", "public", "separate", "serving".
0.300
businesscommercialestatefeefinancialformgeneralindependentinstitutionalinsurancelandlargelegaloutsidepaymentpropertyraterealregistrationsecurity
SHARED TOKENS (23): "business", "commercial", "estate", "fee", "financial", "form", "general", "independent", "institutional", "insurance", "land", "large", "legal", "outside", "payment", "property", "rate", "real", "registration", "security"....
0.300
commercialcreatedeventsproductsrepresenting
SHARED TOKENS (5): "commercial", "created", "events", "products", "representing". | EXACT TITLE in photography: "Fine-art photography".
0.300
irrigationlegalphysicalriverwater
SHARED TOKENS (5): "irrigation", "legal", "physical", "river", "water". | EXACT TITLE in legal: "Water right".
0.300
annualassetsbusinessemployeesgovernmentheavilyhomelargelicensemedicaloperationsorganizationsprofessionalsregulatorysalesservingtaxwork
SHARED TOKENS (18): "annual", "assets", "business", "employees", "government", "heavily", "home", "large", "license", "medical", "operations", "organizations", "professionals", "regulatory", "sales", "serving", "tax", "work".
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessbirthdatafinancialfullgovernmentlicenseofficeonlinepersonalprogramrecordssecuritytechnologyuniversity
SHARED TOKENS (15): "access", "birth", "data", "financial", "full", "government", "license", "office", "online", "personal", "program", "records", "security", "technology", "university".
0.300
agenciesassociationcannotprofessionalwork
SHARED TOKENS (5): "agencies", "association", "cannot", "professional", "work". | EXACT TITLE in photography: "Sports photography".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
administrativeamericananalysisassistanceassociationbusinessconductcreateddepartmentseducationentityenvironmentestablishedexperienceexpertisefamilyfullgovernmentknowledgelabor
SHARED TOKENS (40): "administrative", "american", "analysis", "assistance", "association", "business", "conduct", "created", "departments", "education", "entity", "environment", "established", "experience", "expertise", "family", "full", "government", "knowledge", "labor"....
0.300
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahoriverwestern
SHARED TOKENS (5): "agricultural", "boise", "idaho", "river", "western". | EXACT TITLE in photography: "Boise River".
0.300
Yearbook ↗ Q9311446 EXACT TITLE
annualcollegeeventsphysicalschool
SHARED TOKENS (5): "annual", "college", "events", "physical", "school". | EXACT TITLE in photography: "Yearbook".
🫐 BERRY138 edges
0.280
Partnership ↗ Q728646 EXACT TITLE
businessgovernedorganizationorganizations
SHARED TOKENS (4): "business", "governed", "organization", "organizations". | EXACT TITLE in photography: "Partnership".
0.280
administrativeagenciescreatededucationenforcementenvironmentenvironmentalgovernmentitselflegalpublicreviewsectorsystem
SHARED TOKENS (14): "administrative", "agencies", "created", "education", "enforcement", "environment", "environmental", "government", "itself", "legal", "public", "review", "sector", "system".
0.280
consentcreateddistrictsentitygovernmentirrigationlargelocalorganizedprojectspublicsettaxwater
SHARED TOKENS (14): "consent", "created", "districts", "entity", "government", "irrigation", "large", "local", "organized", "projects", "public", "set", "tax", "water".
0.280
agriculturalcontractorsemployeesestablishedfederalformationgovernmentindependentlabormembersnationalorganizationsectorworkers
SHARED TOKENS (14): "agricultural", "contractors", "employees", "established", "federal", "formation", "government", "independent", "labor", "members", "national", "organization", "sector", "workers".
0.280
administrativeassociationformgrouplegalnaturalorganizationspersonalphysicalpressprotectionrightssafetysystem
SHARED TOKENS (14): "administrative", "association", "form", "group", "legal", "natural", "organizations", "personal", "physical", "press", "protection", "rights", "safety", "system".
0.280
chargescodeemployeesemploymentenvironmentfavorsformgenerallegalorganizationspersonalphysicalprofessionalwork
SHARED TOKENS (14): "charges", "code", "employees", "employment", "environment", "favors", "form", "general", "legal", "organizations", "personal", "physical", "professional", "work".
0.280
Foreclosure ↗ Q231710 KW CROSS HIGH
associationcannotcontractorsfeefeesfilelegalpaymentprincipalpropertyrealsecuritystatutorytrust
SHARED TOKENS (14): "association", "cannot", "contractors", "fee", "fees", "file", "legal", "payment", "principal", "property", "real", "security", "statutory", "trust".
0.280
Grand jury ↗ Q1323789 KW CROSS HIGH
chargesconductdeterminesindependentlargelegalmattersmembersphysicalpublicrequiredreviewseparatespecial
SHARED TOKENS (14): "charges", "conduct", "determines", "independent", "large", "legal", "matters", "members", "physical", "public", "required", "review", "separate", "special".
0.280
bodyclaimsdisclosureemploymentenforcementfinancialgovernmentinstitutionsorganizationorganizationsprotectionpublicsectorwork
SHARED TOKENS (14): "body", "claims", "disclosure", "employment", "enforcement", "financial", "government", "institutions", "organization", "organizations", "protection", "public", "sector", "work".
0.280
agreementscommunityfoodformlegalmaterialmembernationalorganizationsprotectionpublicrightssecurityspecial
SHARED TOKENS (14): "agreements", "community", "food", "form", "legal", "material", "member", "national", "organizations", "protection", "public", "rights", "security", "special".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
Felony ↗ Q178844 EXACT TITLE
additionalenglishland
SHARED TOKENS (3): "additional", "english", "land". | EXACT TITLE in legal: "Felony".
0.260
amonglegalpresence
SHARED TOKENS (3): "among", "legal", "presence". | EXACT TITLE in legal: "Manslaughter".
0.260
activeamericancommunitycreatedfallgovernmentgrouppermitspracticepublicreligiousrequiresrights
SHARED TOKENS (13): "active", "american", "community", "created", "fall", "government", "group", "permits", "practice", "public", "religious", "requires", "rights".
0.260
Fair use ↗ Q131562 KW CROSS HIGH
appliesclaimscreatedenglishgeneralmarketmaterialpermitspublicrightsstatutoryworkworks
SHARED TOKENS (13): "applies", "claims", "created", "english", "general", "market", "material", "permits", "public", "rights", "statutory", "work", "works".
0.260
activeadministrativeamericanchamberscoveringcreateddistrictsfederalheadquarteredidahomeetingpacificwestern
SHARED TOKENS (13): "active", "administrative", "american", "chambers", "covering", "created", "districts", "federal", "headquartered", "idaho", "meeting", "pacific", "western".
0.260
Labour law ↗ Q628967 KW CROSS HIGH
agenciescodecontractorsemployeesemploymentgoverngovernmentlaborregulatoryrightsstandardsworkworkers
SHARED TOKENS (13): "agencies", "code", "contractors", "employees", "employment", "govern", "government", "labor", "regulatory", "rights", "standards", "work", "workers".
0.260
alternativecommercialfoodhistorylandlandscapemarketnationalnaturalprofessionalsprojectspublicwork
SHARED TOKENS (13): "alternative", "commercial", "food", "history", "land", "landscape", "market", "national", "natural", "professionals", "projects", "public", "work".
0.260
activecannotcodecreateddistrictsexclusivefederalgoverngovernmentitselfmatterssystemwest
SHARED TOKENS (13): "active", "cannot", "code", "created", "districts", "exclusive", "federal", "govern", "government", "itself", "matters", "system", "west".
0.260
legalreviewsingle
SHARED TOKENS (3): "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.260
eventssessionspecialty
SHARED TOKENS (3): "events", "session", "specialty". | EXACT TITLE in photography: "Wedding photography".
0.260
agenciesbodyfoodgovernmenthealthcareindependentlicensingmarketsofficeproductsregulatorysafetystandards
SHARED TOKENS (13): "agencies", "body", "food", "government", "healthcare", "independent", "licensing", "markets", "office", "products", "regulatory", "safety", "standards".
0.260
Annexation ↗ Q194465 EXACT TITLE
legalphysicalterritory
SHARED TOKENS (3): "legal", "physical", "territory". | EXACT TITLE in legal: "Annexation".
0.260
bodyconstructiongovernmentgroupgrowthlocalorganizationorganizationsproducespublicqualitysectorworks
SHARED TOKENS (13): "body", "construction", "government", "group", "growth", "local", "organization", "organizations", "produces", "public", "quality", "sector", "works".
0.260
knowledgenaturalrequires
SHARED TOKENS (3): "knowledge", "natural", "requires". | EXACT TITLE in photography: "Wildlife photography".
0.240
cannotconductimpliedinsurancelegalliabilitypaidpublicraterecognitionspecialsystem
SHARED TOKENS (12): "cannot", "conduct", "implied", "insurance", "legal", "liability", "paid", "public", "rate", "recognition", "special", "system".
0.240
assistanceenvironmentalfederalformmaintainownedphysicalprotectionqualityresourcewaterworks
SHARED TOKENS (12): "assistance", "environmental", "federal", "form", "maintain", "owned", "physical", "protection", "quality", "resource", "water", "works".
0.240
consentestablishedfederalgovernmenthistorylegallocalphysicalprohibitspropertyrightssearch
SHARED TOKENS (12): "consent", "established", "federal", "government", "history", "legal", "local", "physical", "prohibits", "property", "rights", "search".
0.240
agreementsamongassociationsbusinessemployeeslaborlegalmarketmarketssectorsystemworkers
SHARED TOKENS (12): "agreements", "among", "associations", "business", "employees", "labor", "legal", "market", "markets", "sector", "system", "workers".
0.240
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanappliesenglishgovernmentimpliedlandlegalnaturalrightsstatutory
SHARED TOKENS (12): "administrative", "agencies", "american", "applies", "english", "government", "implied", "land", "legal", "natural", "rights", "statutory".
0.240
associateddepartmentsenvironmentfinancialgovernmentguidelinesnationalorganizationspresspropertyratetraffic
SHARED TOKENS (12): "associated", "departments", "environment", "financial", "government", "guidelines", "national", "organizations", "press", "property", "rate", "traffic".
0.240
administrativecannotclaimscommissionemploymentestablishedfederalfilegovernmentnationalpracticerights
SHARED TOKENS (12): "administrative", "cannot", "claims", "commission", "employment", "established", "federal", "file", "government", "national", "practice", "rights".
0.240
administrativecodeexclusiveexplicitlyofficeprotectionpublicregistrationrightssettransfersworks
SHARED TOKENS (12): "administrative", "code", "exclusive", "explicitly", "office", "protection", "public", "registration", "rights", "set", "transfers", "works".
0.240
appliescompensationfederalgovernmentimpliedlocalpolicepropertyprotectionpublicrequiresrights
SHARED TOKENS (12): "applies", "compensation", "federal", "government", "implied", "local", "police", "property", "protection", "public", "requires", "rights".
0.220
alternativeamericanamongcannotgenerallegalpublicrequiredsystemtransactionstrust
SHARED TOKENS (11): "alternative", "american", "among", "cannot", "general", "legal", "public", "required", "system", "transactions", "trust".
0.220
Jostens ↗ Q6291141 EXACT TITLE
americanproducts
SHARED TOKENS (2): "american", "products". | EXACT TITLE in photography: "Jostens".
0.220
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetsbusinesscommercialdisclosurelegallicensedmaintainpropertyregistration
SHARED TOKENS (11): "agreements", "among", "assets", "business", "commercial", "disclosure", "legal", "licensed", "maintain", "property", "registration".
0.220
citiescreatedenvironmenteventsexperienceindustriallandlandscapenaturalpresencewater
SHARED TOKENS (11): "cities", "created", "environment", "events", "experience", "industrial", "land", "landscape", "natural", "presence", "water".
0.220
accesscodeitselfliabilityonlineorganizationprincipalpropertyrightstechnologyworks
SHARED TOKENS (11): "access", "code", "itself", "liability", "online", "organization", "principal", "property", "rights", "technology", "works".
0.220
amongannualclaimsfallgovernmentgrouphistorylegaloutsideprogramrepresentation
SHARED TOKENS (11): "among", "annual", "claims", "fall", "government", "group", "history", "legal", "outside", "program", "representation".
0.220
Family law ↗ Q384014 EXACT TITLE
familymatters
SHARED TOKENS (2): "family", "matters". | EXACT TITLE in legal: "Family law".
0.220
americanapplieseducationfederalgovernmentitselflargelocalprotectionrequiresrights
SHARED TOKENS (11): "american", "applies", "education", "federal", "government", "itself", "large", "local", "protection", "requires", "rights".
0.220
claimscodefinancialformgeneralpersonalplanspropertyprotectionstatutesstatutory
SHARED TOKENS (11): "claims", "code", "financial", "form", "general", "personal", "plans", "property", "protection", "statutes", "statutory".
0.220
additionaldepartmentemployeesfamilylabormedicalmemberpublicwageworkworkers
SHARED TOKENS (11): "additional", "department", "employees", "family", "labor", "medical", "member", "public", "wage", "work", "workers".
0.220
Work for hire ↗ Q516039 KW CROSS HIGH
commissioncorporatecreatedemploymententitygenerallegalorganizationownedservingwork
SHARED TOKENS (11): "commission", "corporate", "created", "employment", "entity", "general", "legal", "organization", "owned", "serving", "work".
0.220
agenciescreatedenvironmentenvironmentalestablishedfederalgovernmentnationalqualityreportsrequires
SHARED TOKENS (11): "agencies", "created", "environment", "environmental", "established", "federal", "government", "national", "quality", "reports", "requires".
0.220
Road transport ↗ KW CROSS HIGH
developmentfoodfulllargelicensinglocalsafetyseparatespecialstandardtraffic
SHARED TOKENS (11): "development", "food", "full", "large", "licensing", "local", "safety", "separate", "special", "standard", "traffic".
0.220
Private equity ↗ Q476115 KW CROSS HIGH
activebusinessdevelopmentexpansionfinancialfinancingfirmsgeneralpressproductspublic
SHARED TOKENS (11): "active", "business", "development", "expansion", "financial", "financing", "firms", "general", "press", "products", "public".
0.210
governmentidahooffice
SHARED TOKENS (3): "government", "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.210
assistance
SHARED TOKENS (1): "assistance". | EXACT TITLE in photography: "Discovery (law)".
0.210
practice
SHARED TOKENS (1): "practice". | EXACT TITLE in photography: "Event photography".
0.200
associatedbusinessforminstitutionalorganizationpreservationrecordssecuritystandardtransactions
SHARED TOKENS (10): "associated", "business", "form", "institutional", "organization", "preservation", "records", "security", "standard", "transactions".
0.200
agenciescommissionfederalfinancialliabilitylistingorganizationsregulatorysecuritytransactions
SHARED TOKENS (10): "agencies", "commission", "federal", "financial", "liability", "listing", "organizations", "regulatory", "security", "transactions".
0.200
Attorney ↗ Q1289214 EXACT TITLE
attorneylawyerpower
EXACT TITLE in legal: "Attorney". | EXACT TITLE in photography: "Attorney".
0.200
focusgroundsurfacetop
EXACT TITLE in photography: "Aerial photography".
0.200
adaboiseidahoitselfmountainnationalpopulationrecreationvalleywestern
SHARED TOKENS (10): "ada", "boise", "idaho", "itself", "mountain", "national", "population", "recreation", "valley", "western".
0.200
emphasisprimary
EXACT TITLE in photography: "Architectural photography".
0.200
U visa ↗ Q17086349 KW CROSS HIGH
agenciescreatedenforcementfamilygovernmentmemberspermitsphysicalprotectionset
SHARED TOKENS (10): "agencies", "created", "enforcement", "family", "government", "members", "permits", "physical", "protection", "set".
0.200
subdivision
EXACT TITLE in legal: "Subdivision".
0.200
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerentityfamilyfullgovernmentlegalpaidpersonalrequires
SHARED TOKENS (10): "agreements", "consumer", "entity", "family", "full", "government", "legal", "paid", "personal", "requires".
0.200
Cyclorama ↗ Q1147753 EXACT TITLE
standing
EXACT TITLE in photography: "Cyclorama".
0.200
analysisassociatedbodyfulllegalpropertyrequiressetstatutesstatutory
SHARED TOKENS (10): "analysis", "associated", "body", "full", "legal", "property", "requires", "set", "statutes", "statutory".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will".
0.200
Paternity ↗ Q16881001 EXACT TITLE
childhousepaternitytelevision
EXACT TITLE in legal: "Paternity".
0.200
Beneficiary ↗ Q2596417 KW CROSS HIGH
assetscontextcreateddevelopmententityinsurancelegalpaymentprojectstrust
SHARED TOKENS (10): "assets", "context", "created", "development", "entity", "insurance", "legal", "payment", "projects", "trust".
0.200
Probate court ↗ Q7246899 KW CROSS HIGH
assetscountiescreateddeterminesestateexclusivematterspersonalpropertystatutory
SHARED TOKENS (10): "assets", "counties", "created", "determines", "estate", "exclusive", "matters", "personal", "property", "statutory".
0.180
Legal guardian ↗ Q157509 KW CROSS HIGH
cannotfamilylegalmedicalmemberpersonalprofessionalpropertypublic
SHARED TOKENS (9): "cannot", "family", "legal", "medical", "member", "personal", "professional", "property", "public".
0.180
amongdeterminesenglishlandorganizedpropertyrightssystemwater
SHARED TOKENS (9): "among", "determines", "english", "land", "organized", "property", "rights", "system", "water".
0.180
activeamongdataemployeesfirmsgeneralonlineproductspublic
SHARED TOKENS (9): "active", "among", "data", "employees", "firms", "general", "online", "products", "public".
0.180
beyondboiseeagleidahopermitriverspecialsystemwest
SHARED TOKENS (9): "beyond", "boise", "eagle", "idaho", "permit", "river", "special", "system", "west".
0.180
Civil liberties ↗ Q29556 KW CROSS HIGH
expandinggovernmentpersonalpresspropertyprotectionrightssecuritywork
SHARED TOKENS (9): "expanding", "government", "personal", "press", "property", "protection", "rights", "security", "work".
0.180
adabusinessemployeesnationalprohibitsprotectionpublicrequiresrights
SHARED TOKENS (9): "ada", "business", "employees", "national", "prohibits", "protection", "public", "requires", "rights".
0.180
Damages ↗ Q308922 KW CROSS HIGH
compensationformgenerallegalmedicalpaidphysicalpropertyspecial
SHARED TOKENS (9): "compensation", "form", "general", "legal", "medical", "paid", "physical", "property", "special".
0.180
Overtime ↗ Q667022 KW CROSS HIGH
beyondemployeesemploymentnationalratesectorsworkworkersworks
SHARED TOKENS (9): "beyond", "employees", "employment", "national", "rate", "sectors", "work", "workers", "works".
0.180
governmentlargepersonalpracticeproductsreligioussetsystemtax
SHARED TOKENS (9): "government", "large", "personal", "practice", "products", "religious", "set", "system", "tax".
0.180
Easement ↗ Q448405 KW CROSS HIGH
accessamongitselflandownedpropertypublicrealrights
SHARED TOKENS (9): "access", "among", "itself", "land", "owned", "property", "public", "real", "rights".
0.180
americanassociationidaholabormemberownerspaidservingwestern
SHARED TOKENS (9): "american", "association", "idaho", "labor", "member", "owners", "paid", "serving", "western".
0.180
architecturedevelopmenteducationknowledgeprotectionpublicresourcesectorsectors
SHARED TOKENS (9): "architecture", "development", "education", "knowledge", "protection", "public", "resource", "sector", "sectors".
0.180
combinedconsentformhealthcareitselflegalmedicalpersonalsingle
SHARED TOKENS (9): "combined", "consent", "form", "healthcare", "itself", "legal", "medical", "personal", "single".
0.180
codeconsumerfederalgovernedgovernspropertyprotectionrightstax
SHARED TOKENS (9): "code", "consumer", "federal", "governed", "governs", "property", "protection", "rights", "tax".
0.160
constructioncontextdataformmedicalprocessingrealrecognition
SHARED TOKENS (8): "construction", "context", "data", "form", "medical", "processing", "real", "recognition".
0.160
conductknowledgelegalpolicepropertyrequiredsearchstandard
SHARED TOKENS (8): "conduct", "knowledge", "legal", "police", "property", "required", "search", "standard".
0.160
environmenteventspresenceprojectspropertypublicsecuritywork
SHARED TOKENS (8): "environment", "events", "presence", "projects", "property", "public", "security", "work".
0.160
Camera trap ↗ Q1723004 KW CROSS HIGH
activeamongcommercialdevelopmentmarketpopulationpresencequality
SHARED TOKENS (8): "active", "among", "commercial", "development", "market", "population", "presence", "quality".
0.160
Deed ↗ Q705914 KW CROSS HIGH
associatedlegalliabilitylicensespracticepropertyrightsspecialty
SHARED TOKENS (8): "associated", "legal", "liability", "licenses", "practice", "property", "rights", "specialty".
0.160
agenciesappliesassociationgovernmentpressreligiousrightsschool
SHARED TOKENS (8): "agencies", "applies", "association", "government", "press", "religious", "rights", "school".
0.160
consentenforcementformlegalpolicepropertypublicsearch
SHARED TOKENS (8): "consent", "enforcement", "form", "legal", "police", "property", "public", "search".
0.160
Intestacy ↗ Q1188571 KW CROSS HIGH
appliesbodydeterminesestatefamilymemberspropertystatutory
SHARED TOKENS (8): "applies", "body", "determines", "estate", "family", "members", "property", "statutory".
0.160
amongbodycommissionlegalownedpublicregulatoryserves
SHARED TOKENS (8): "among", "body", "commission", "legal", "owned", "public", "regulatory", "serves".
0.160
agriculturalamericanfullindustriallegalrightssystemwater
SHARED TOKENS (8): "agricultural", "american", "full", "industrial", "legal", "rights", "system", "water".
0.160
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementschargeslegallocalpracticepublicservesstandards
SHARED TOKENS (8): "agreements", "charges", "legal", "local", "practice", "public", "serves", "standards".
0.160
commercialgovernedlegalpropertyrealrequiredrightssales
SHARED TOKENS (8): "commercial", "governed", "legal", "property", "real", "required", "rights", "sales".
0.160
Probation ↗ Q13961 KW CROSS HIGH
appliescommunitycontactmaintainpermitprogramrequiredset
SHARED TOKENS (8): "applies", "community", "contact", "maintain", "permit", "program", "required", "set".
0.160
Lawsuit ↗ Q697327 KW CROSS HIGH
attorneysbusinessclaimslegalorganizationspublicrepresentingrequired
SHARED TOKENS (8): "attorneys", "business", "claims", "legal", "organizations", "public", "representing", "required".
0.160
englishirrigationlandlegalliabilitystandardsystemwater
SHARED TOKENS (8): "english", "irrigation", "land", "legal", "liability", "standard", "system", "water".
0.140
adaboisegovernmentidahomunicipalpopulationseparate
SHARED TOKENS (7): "ada", "boise", "government", "idaho", "municipal", "population", "separate".
0.140
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsuranceobligationsprincipalpropertytransactiontrust
SHARED TOKENS (7): "established", "insurance", "obligations", "principal", "property", "transaction", "trust".
0.140
appliesassistancecommunitygovernmentpublicrequiresrights
SHARED TOKENS (7): "applies", "assistance", "community", "government", "public", "requires", "rights".
0.140
Expungement ↗ Q2352928 KW CROSS HIGH
enforcementfederalgenerallegalpublicrecordsreview
SHARED TOKENS (7): "enforcement", "federal", "general", "legal", "public", "records", "review".
0.140
Criminal law ↗ Q146491 KW CROSS HIGH
bodycommissioncompensationconductestablishedpropertysafety
SHARED TOKENS (7): "body", "commission", "compensation", "conduct", "established", "property", "safety".
0.140
additionalchargeshistorynationalpolicerecordstraffic
SHARED TOKENS (7): "additional", "charges", "history", "national", "police", "records", "traffic".
0.140
Tort ↗ Q158970 KW CROSS HIGH
codeenglishestablishedlegalliabilityobligationsseparate
SHARED TOKENS (7): "code", "english", "established", "legal", "liability", "obligations", "separate".
0.140
codecommercialfederalgeneraloperationspublictraining
SHARED TOKENS (7): "code", "commercial", "federal", "general", "operations", "public", "training".
0.140
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahopopulationschoolwest
SHARED TOKENS (7): "ada", "boise", "canyon", "idaho", "population", "school", "west".
0.140
Complaint ↗ Q836925 KW CROSS HIGH
associatedchargesfederalgovernlegalpolicestatutes
SHARED TOKENS (7): "associated", "charges", "federal", "govern", "legal", "police", "statutes".
0.140
Bail ↗ Q162351 KW CROSS HIGH
additionalchargesformpolicepropertyrequiredset
SHARED TOKENS (7): "additional", "charges", "form", "police", "property", "required", "set".
0.140
cannotenforcementknowledgepoliceprotectionrequiredrights
SHARED TOKENS (7): "cannot", "enforcement", "knowledge", "police", "protection", "required", "rights".
0.140
Legal ethics ↗ Q3655952 KW CROSS HIGH
conductdevelopmentitselflegalmemberspracticeprofessional
SHARED TOKENS (7): "conduct", "development", "itself", "legal", "members", "practice", "professional".
0.140
assetscollectiondatafilesoperationsrequiredsystem
SHARED TOKENS (7): "assets", "collection", "data", "files", "operations", "required", "system".
0.140
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualcontractorsemployeesindependentwagework
SHARED TOKENS (7): "among", "annual", "contractors", "employees", "independent", "wage", "work".
0.140
Cloud storage ↗ Q914359 KW CROSS HIGH
dataenvironmentnetworkorganizationorganizationsownedphysical
SHARED TOKENS (7): "data", "environment", "network", "organization", "organizations", "owned", "physical".
0.140
createddevelopmentformitselflayerprocessingseparate
SHARED TOKENS (7): "created", "development", "form", "itself", "layer", "processing", "separate".
0.140
agriculturedatadevelopmentenvironmentformmedicalprocessing
SHARED TOKENS (7): "agriculture", "data", "development", "environment", "form", "medical", "processing".
0.140
attorneysclientclientsfulllegalprofessionalrepresentation
SHARED TOKENS (7): "attorneys", "client", "clients", "full", "legal", "professional", "representation".
0.140
businessentitylegalownedownersseparatework
SHARED TOKENS (7): "business", "entity", "legal", "owned", "owners", "separate", "work".
0.140
appliescannotformfullmaterialrealstandard
SHARED TOKENS (7): "applies", "cannot", "form", "full", "material", "real", "standard".
0.140
Legal clinic ↗ Q1351667 KW CROSS HIGH
clientsconductexperiencelegalprogramschoolwork
SHARED TOKENS (7): "clients", "conduct", "experience", "legal", "program", "school", "work".
0.120
Sex offender ↗ Q5659979 KW CROSS HIGH
continuinglegalmandatorypublicregistrationstatutory
SHARED TOKENS (6): "continuing", "legal", "mandatory", "public", "registration", "statutory".
0.120
Parole ↗ Q5357120 KW CROSS HIGH
additionalassociatedformoutsideservingsystem
SHARED TOKENS (6): "additional", "associated", "form", "outside", "serving", "system".
0.120
corporatefinancialgovernmentlaborprofessionalswage
SHARED TOKENS (6): "corporate", "financial", "government", "labor", "professionals", "wage".
0.120
Due diligence ↗ Q794134 KW CROSS HIGH
appliesassetsbusinesslegalqualitystandard
SHARED TOKENS (6): "applies", "assets", "business", "legal", "quality", "standard".
0.120
americanattorneyslegalmattersmemberpublic
SHARED TOKENS (6): "american", "attorneys", "legal", "matters", "member", "public".
0.120
Injunction ↗ Q6495575 KW CROSS HIGH
conductenglishformfulllegalspecial
SHARED TOKENS (6): "conduct", "english", "form", "full", "legal", "special".
0.120
historyoutsidepresenceproductsrecognitionwork
SHARED TOKENS (6): "history", "outside", "presence", "products", "recognition", "work".
0.120
formliabilitypersonalproductspropertypublic
SHARED TOKENS (6): "form", "liability", "personal", "products", "property", "public".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahopopulation
SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "population".
0.100
Family court ↗ Q82749 KW CROSS HIGH
createdfamilylegalmatterssystem
SHARED TOKENS (5): "created", "family", "legal", "matters", "system".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
assetsestatepaidpropertytax
SHARED TOKENS (5): "assets", "estate", "paid", "property", "tax".
0.100
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfamilyfinanciallegalrequired
SHARED TOKENS (5): "agreements", "family", "financial", "legal", "required".
0.100
Camera lens ↗ KW CROSS HIGH
bodyconstructionpracticerequiredsystem
SHARED TOKENS (5): "body", "construction", "practice", "required", "system".
0.100
accesscontactenglishmattersrights
SHARED TOKENS (5): "access", "contact", "english", "matters", "rights".
0.100
employeesestatefoodplanningreal
SHARED TOKENS (5): "employees", "estate", "food", "planning", "real".
0.100
agricultureassetsenvironmentalriversystem
SHARED TOKENS (5): "agriculture", "assets", "environmental", "river", "system".
0.100
administrativefederallegalofficereview
SHARED TOKENS (5): "administrative", "federal", "legal", "office", "review".
0.100
americanemploymentpermitprotectionwork
SHARED TOKENS (5): "american", "employment", "permit", "protection", "work".
0.100
businessfinancialformlegalprincipal
SHARED TOKENS (5): "business", "financial", "form", "legal", "principal".
0.100
codefederalformgoverngoverns
SHARED TOKENS (5): "code", "federal", "form", "govern", "governs".
◈ Frequently Asked Questions
Legal × Photography — Treasure Valley
HAIKU · HIGH GATE
What intellectual property rights do photographers in Boise and Meridian need to protect their work?
Photographers operating in Ada County retain copyright ownership of their images under federal law, which protects the original expression in each photograph. Boise-based photographers should register their work with the U.S. Copyright Office to establish legal standing in Idaho courts if infringement occurs in the Treasure Valley.
Can a photography business in Nampa operate as a limited liability company, and what are the legal requirements?
A photography LLC in Nampa or Canyon County must file articles of organization with the Idaho Secretary of State and maintain compliance with state business formation statutes. This structure provides liability protection for the photographer's personal assets while allowing the business to operate in Boise, Eagle, Caldwell, and surrounding Treasure Valley markets.
What contract terms should photographers in Ada County include when licensing images to real estate agents in Boise?
Real estate photographers working with agents in Boise, Eagle, and Meridian should define in their contracts whether the client receives exclusive or limited use rights, the duration of the license, and geographic territory within Ada County and Canyon County. Idaho state law recognizes such usage restrictions in written contracts between the photographer and the real estate business.
Do photographers need separate legal coverage when teaching at Boise State University?
Boise State University instructors teaching photography maintain institutional liability coverage through the university, but independent photographers conducting private workshops in the Treasure Valley should obtain professional liability insurance. Idaho law distinguishes between employee instructors and independent contractors, affecting which party bears legal responsibility for incidents during Boise or Ada County photography sessions.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Photography 14 QID bridges 266 edges 8,337 ext links 2026-07-17 21:49:07 UTC be03d8b15602d02d
Legal corridor ↗ Photography corridor ↗ Photography × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals