—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Legal ↔ relates to ↔ Senior Services

23 Wikipedia bridge articles confirmed in both vertical ledgers. 303 deterministic cross-vertical edges. 8,721 external source links harvested. Every edge provenance-stamped. Every claim auditable.

23 QID Bridge Articles
303 Cross Edges
8,721 External Sources
358 Wikipedia Articles
23 🌲 Evergreen
166 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Legal
× Senior Services
QID Bridge Articles
23
confirmed Wikipedia overlap
Total Cross Edges
303
External Sources Harvested
8,721
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  19 shared tokens
QID Bridge Titles (20)
IdahoProbateTreasure ValleyZoningBoise State UniversityIdaho Supreme CourtIdaho LegislatureFraudLand-use planningMergers and acquisitionsIdentity theftBoise, IdahoNampa, IdahoAmericans with Disabilities Act of 1990Advance healthcare directivePrivate equityAda County, IdahoMeridian, IdahoGarden City, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationadalegalsecondlandlargestwestpublicsinglerivertechnologywashingtonwesternjurisdictionpersonalpowerpropertylocal
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:49:38 UTC
Content Hash
ea9b21dd9394ac2d
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
23 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in legal (tier:evergreen) and senior_services (tier:evergreen). | SHARED TOKENS (19): "agricultural", "associated", "boise", "idaho", "land", "largest", "mountain", "national", "plain", "population", "products", "river", "sector", "separate", "technology", "territory", "washington", "west", "western". | EXACT TITLE in legal: "Idaho". | EXACT TITLE in senior_services: "Idaho".
agriculturalassociatedboiseidaholandlargestmountainnationalplainpopulationproductsriversectorseparatetechnologyterritorywashingtonwestwestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
luded for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Probate
Q6500369 EXACT TITLE 0.960
QID OVERLAP: Q6500369 in legal (tier:evergreen) and senior_services (tier:evergreen). | SHARED TOKENS (13): "assets", "claims", "court", "courts", "estate", "judicial", "jurisdiction", "legal", "personal", "power", "probate", "property", "public". | EXACT TITLE in legal: "Probate". | EXACT TITLE in senior_services: "Probate".
assetsclaimscourtcourtsestatejudicialjurisdictionlegalpersonalpowerprobatepropertypublic
executor in the law courts if necessary. A probate also officially appoints the executor (or personal representative), generally named in the will, as having legal power to dispose of the testator's assets in the manner specified in the testator's will. Concurrent through the probate process, a will may be contested. Terminology Executor An executor is a person appointed by a will to act on behalf of the estate of the will-maker (the "testator") upon their death. An executor is the legal personal representative of a deceased person's estate. The appointment of an executor only becomes effective after the death of the testator. After the testator dies, the person named in the will as executor can decline or renounce the position, and if so should quickly notify the probate court accordingly. Executors "step into the shoes" of the deceased and have similar rights and powers to wind up the personal affairs of the deceased. This may include continuing or filing lawsuits that the deceased was entitled to bring, making claims for wrongful death, paying off creditors, or selling or disposing of assets not particularly gifted in the will, among others. But the role of the executor is to resolve the testator's estate and to distribute the estate to the beneficiaries or those otherwise entitled. Sometimes, in England and Wales, a professional executor is named in the will – not a family member but (for example) a solicitor, bank or other financial institution. Professional executors will charge the estate for carrying out duties related to the administration of the estate; this can leave the family facing additional costs.
An executor is a person appointed by a will to act on behalf of the estate of the will-maker (the "testator") upon their death. An executor is the legal personal representative of a deceased person's estate. The appointment of an executor only becomes effective after the death of the testator. After the testator dies, the person named in the will as executor can decline or renounce the position, and if so should quickly notify the probate court accordingly. Executors "step into the shoes" of the deceased and have similar rights and powers to wind up the personal affairs of the deceased. This may include continuing or filing lawsuits that the deceased was entitled to bring, making claims for wrongful death, paying off creditors, or selling or disposing of assets not particularly gifted in the will, among others. But the role of the executor is to resolve the testator's estate and to distribute the estate to the beneficiaries or those otherwise entitled. Sometimes, in England and Wales, a professional executor is named in the will – not a family member but (for example) a solicitor, bank or other financial institution. Professional executors will charge the estate for carrying out duties related to the administration of the estate; this can leave the family facing additional costs.
Probate is a process of improvement that proves a will of a deceased person is valid, so their property can in due course be retitled (US terminology) or transferred to beneficiaries of the will. As with any legal proceeding, there are technical aspects to probate administration: Creditors must be notified and legal notices published. Executors of the will must be guided in how and when to distribute assets and how to take creditors' rights into account. A petition to appoint a personal representative may need to be filed and letters of administration (often referred to as "letters testamentary") issued. A Grant of Letters of Administration can be used as proof that the 'Administrator' is entitled to handle the assets. Homestead property, which follows its own set of unique rules in states like Florida, must be dealt with separately from other assets. In many common law jurisdictions such as Canada, parts of the US, the UK, Australia and India, any jointly owned property passes automatically to the surviving joint owner separately from any will, unless the equitable title is held as tenants in common. There are time factors involved in filing and objecting to claims against the estate. There may be a lawsuit pending over the decedent's death or there may have been pending suits that are now continuing. There may be separate procedures required in contentious probate cases. Real estate or other property may need to be sold to effect the correct distribution of assets pursuant to the will, or merely to pay debts. Estate taxes, gift taxes or inheritance taxes must be considered if the estate exceeds certain thresholds. Costs of the administration including ordinary taxation such as income tax on interest and property taxation are deducted from assets in the estate before distribution by the executors of the will. Other assets may simply need to be transferred from the deceased to their beneficiaries, such as life insurance. Other assets may have pay on death or transfer on death designations, which avoids probate. The rights of beneficiaries must be respected, in terms of providing proper and adequate notice, making timely distribution of estate assets, and otherwise administering the estate properly and efficiently. Local laws governing the probate process often depend on the value and complexity of the estate. If the value of the estate is relatively small, the probate process may be avoided. In some jurisdictions and/or at a certain threshold, probate must be applied for by the executor/administrator or a probate lawyer filing on their behalf. A probate lawyer offers services in probate court, and may be retained to open an estate or offer service during the course of probate proceedings on behalf of the administrator or executor of the estate.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in legal (tier:evergreen) and senior_services (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "idaho", "land", "local", "payette", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in legal: "Treasure Valley". | EXACT TITLE in senior_services: "Treasure Valley".
agriculturalassociationboiseidaholandlocalpayetteresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Zoning
Q702232 EXACT TITLE 0.940
QID OVERLAP: Q702232 in legal (tier:evergreen) and senior_services (tier:evergreen). | SHARED TOKENS (12): "development", "form", "growth", "land", "land-use", "local", "planning", "property", "regulatory", "set", "single", "zoning". | EXACT TITLE in legal: "Zoning". | EXACT TITLE in senior_services: "Zoning".
developmentformgrowthlandland-uselocalplanningpropertyregulatorysetsinglezoning
In urban planning, zoning is a method in which a municipality or other tier of government divides land into land-use and building "zones", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
ed zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
itional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
Boise State University
EXACT TITLE 0.940
QID OVERLAP: Q891082 in legal (tier:branch) and senior_services (tier:evergreen). | SHARED TOKENS (12): "among", "boise", "college", "education", "idaho", "independent", "mountain", "program", "public", "sciences", "university", "west". | EXACT TITLE in senior_services: "Boise State University".
amongboisecollegeeducationidahoindependentmountainprogrampublicsciencesuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho Supreme Court
Q5987471 EXACT TITLE 0.930
QID OVERLAP: Q5987471 in legal (tier:evergreen) and senior_services (tier:branch). | SHARED TOKENS (4): "court", "courts", "idaho", "justice". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in legal: "Idaho Supreme Court".
courtcourtsidahojustice
The Idaho Supreme Court is the state supreme court of Idaho and is composed of the chief justice and four associate justices. The decisions of the Idaho Supreme Court are binding on all other Idaho state courts.
Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years. Prior to 1983, the position went to the justice with the least amount of time remaining in his term. The court originally had three justices; it was expanded to five in 1921. Current justices Vacancies and pending nomination Women on the Supreme Court The first female justice on the Idaho Supreme Court was Linda Copple Trout, appointed in 1992 by Governor Cecil Andrus and elected in 1996 and 2002. She remains as the state's only female chief justice (1997–2004). The second female justice was Cathy Silak, appointed by Andrus in 1993 and elected in 1994. She lost her reelection bid in 2000 to Dan Eismann and became the first incumbent justice from the court to be defeated since 1944. After Trout's retirement in 2007, no women were on the court until the election of Robyn Brody in 2016 to a vacant seat, the first by a female; she is the only justice on the current court not first appointed. Colleen Zahn joined the court in 2021, appointed by Governor Brad Little; Brody and Zahn ran unopposed in 2022.
Women on the Supreme Court The first female justice on the Idaho Supreme Court was Linda Copple Trout, appointed in 1992 by Governor Cecil Andrus and elected in 1996 and 2002. She remains as the state's only female chief justice (1997–2004). The second female justice was Cathy Silak, appointed by Andrus in 1993 and elected in 1994. She lost her reelection bid in 2000 to Dan Eismann and became the first incumbent justice from the court to be defeated since 1944. After Trout's retirement in 2007, no women were on the court until the election of Robyn Brody in 2016 to a vacant seat, the first by a female; she is the only justice on the current court not first appointed. Colleen Zahn joined the court in 2021, appointed by Governor Brad Little; Brody and Zahn ran unopposed in 2022.
Idaho Legislature
Q4256974 EXACT TITLE 0.880
QID OVERLAP: Q4256974 in legal (tier:evergreen) and senior_services (tier:branch). | SHARED TOKENS (9): "boise", "data", "district", "idaho", "members", "population", "residents", "single", "washington". | EXACT TITLE in legal: "Idaho Legislature".
boisedatadistrictidahomemberspopulationresidentssinglewashington
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Fraud
Q28813 EXACT TITLE 0.860
QID OVERLAP: Q28813 in legal (tier:branch) and senior_services (tier:evergreen). | SHARED TOKENS (8): "benefits", "cases", "civil", "criminal", "itself", "legal", "property", "right". | EXACT TITLE in senior_services: "Fraud".
benefitscasescivilcriminalitselflegalpropertyright
rnmental authorities), or it may be an element of another civil or criminal wrong despite itself causing no loss of money, property, or legal right. The purpose of fraud may be monetary gain or other benefits, such as obtaining a passport, travel document, or driver's licence. In cases of mortgage fraud, the perpetrator attempts to qualify for a mortgage by way of false statements. Terminology Fraud can be defined as either a civil wrong or a criminal act. For civil fraud, a government agency or person or entity harmed by fraud may bring litigation to stop the fraud, seek monetary damages, or both.
despite itself causing no loss of money, property, or legal right. The purpose of fraud may be monetary gain or other benefits, such as obtaining a passport, travel document, or driver's licence. In cases of mortgage fraud, the perpetrator attempts to qualify for a mortgage by way of false statements. Terminology Fraud can be defined as either a civil wrong or a criminal act. For civil fraud, a government agency or person or entity harmed by fraud may bring litigation to stop the fraud, seek monetary damages, or both.
Civil law In common law jurisdictions, as a civil wrong, fraud is considered a tort. While the precise definitions and requirements of proof vary among jurisdictions, the requisite elements of fraud as a tort generally are the intentional misrepresentation or concealment of an important fact upon which the victim is meant to rely, and in fact does rely, to the detriment of the victim. Proving fraud in a court of law is often said to be difficult as the intention to defraud is the key element in question. As such, proving fraud comes with a "greater evidentiary burden than other civil claims". This difficulty is exacerbated by the fact that some jurisdictions require the victim to prove fraud by clear and convincing evidence. In cases of a fraudulently induced contract, fraud may serve as a legal defence in a civil action for breach of contract or specific performance of a contract. Similarly, fraud may serve as a basis for a court to invoke its equitable jurisdiction.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (20): "american", "association", "authority", "changes", "cities", "community", "development", "environmental", "land", "land-use", "needs", "physical", "planning", "project", "regional", "regulate", "regulation", "resources", "second", "water".
americanassociationauthoritychangescitiescommunitydevelopmentenvironmentallandland-useneedsphysicalplanningprojectregionalregulateregulationresourcessecondwater
ic, and orderly disposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
Indigenous communities Land use planning is an important method for sustainable development for Indigenous communities. Indigenous peoples in the United States and Canada often have fragmented or diminishing land bases with limited uses. Oftentimes, these land bases are also far from urban centers and with limited expansion ability. Since European settlers first began colonizing the American Continent, Indigenous peoples have lost 98.9% of their land, a Yale study found. The lands indigenous peoples were forced onto are facing current and future climate-change related risks. This fact leads to the perpetuation of systematic inequity for Indigenous peoples, since livelihoods, preservation of culture and tradition, access to adequate housing, and access to resources are all factors that are deeply rooted in land. Many Indigenous groups are embracing land use planning to determine the future of their territories. In Canada, for example, the Dehcho First Nations have developed a land use plan that honors cultural traditions and Elders' knowledge, and incorporates conservation, development zones, and other categories.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (21): "assets", "combined", "commission", "competitive", "corporate", "department", "entity", "federal", "governed", "justice", "legal", "market", "operating", "operations", "organization", "regulatory", "requires", "review", "single", "transaction"....
assetscombinedcommissioncompetitivecorporatedepartmententityfederalgovernedjusticelegalmarketoperatingoperationsorganizationregulatoryrequiresreviewsingletransactiontransactions
l terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Acquisition An acquisition/takeover is the purchase of one business or company by another company or other business entity. Specific acquisition targets can be identified through myriad avenues, including market research, trade expos, sent up from internal business units, or supply chain analysis. Such purchase may be of 100%, or nearly 100%, of the assets or ownership equity of the acquired entity. A consolidation/amalgamation occurs when two companies combine to form a new enterprise altogether, and neither of the previous companies remains independently owned. Acquisitions are divided into "private" and "public" acquisitions, depending on whether the acquiree or merging company (also termed a target) is or is not publicly listed. Some public companies rely on acquisitions as an important value creation strategy. An additional dimension or categorization consists of whether an acquisition is friendly or hostile. Achieving acquisition success has proven to be very difficult, while various studies have shown that 50% of acquisitions were unsuccessful. "Serial acquirers" appear to be more successful with M&A than companies who make acquisitions only occasionally (see Douma & Schreuder, 2013, chapter 13). The new forms of buy out created since the 2008 financial crisis are based on serial type acquisitions known as an ECO Buyout which is a co-community ownership buy out and the new generation buy outs of the MIBO (Management Involved or Management & Institution Buy Out) and MEIBO (Management & Employee Involved Buy Out). Whether a purchase is perceived as being "friendly" or "hostile" depends significantly on how the proposed acquisition is communicated to and perceived by the target company's board of directors, employees, and shareholders. It is normal for M&A deal communications to take place in a so-called "confidentiality bubble", wherein the flow of information is restricted pursuant to confidentiality agreements. In the case of a friendly transaction, the companies cooperate in negotiations; in the case of a hostile deal, the board and/or management of the target is unwilling to be bought or the target's board has no prior knowledge of the offer. Hostile acquisitions can, and often do, ultimately become "friendly" as the acquirer secures endorsement of the transaction from the board of the acquiree company. This usually requires an improvement in the terms of the offer and/or through negotiation. "Acquisition" usually refers to a purchase of a smaller firm by a larger one. Sometimes, however, a smaller firm will acquire management control of a larger and/or longer-established company and retain the name of the latter for the post-acquisition combined entity. This is known as a reverse takeover. Another type of acquisition is the reverse merger, a form of transaction that enables a private company to be publicly listed in a relatively short time frame. A reverse merger is a type of merger where a privately held company, typically one with promising prospects and a need for financing, acquires a publicly listed shell company that has few assets and no significant business operations. The combined evidence suggests that the shareholders of acquired firms realize significant positive "abnormal returns," while shareholders of the acquiring company are most likely to experience a negative wealth effect. Most studies indicate that M&A transactions have a positive net effect, with investors in both the buyer and target companies seeing positive returns. This suggests that M&A creates economic value, likely by transferring assets to more efficient management teams who can better utilize them.
The buyer buys the shares, and therefore control, of the target company being purchased. Ownership control of the company in turn conveys effective control over the assets of the company, but since the company is acquired intact as a going concern, this form of transaction carries with it all of the liabilities accrued by that business over its past and all of the risks that company faces in its commercial environment and corporate environment The buyer buys the assets of the target company. The cash the target receives from the sell-off is paid back to its shareholders by dividend or through liquidation. This type of transaction leaves the target company as an empty shell, if the buyer buys out the entire assets. A buyer often structures the transaction as an asset purchase to "cherry-pick" the assets that it wants and leave out the assets and liabilities that it does not. This can be particularly important where foreseeable liabilities may include future, unquantified damage awards such as those that could arise from litigation over defective products, employee benefits or terminations, or environmental damage. A disadvantage of this structure is the tax that many jurisdictions, particularly outside the United States, impose on transfers of the individual assets, whereas stock transactions can frequently be structured as like-kind exchanges or other arrangements that are tax-free or tax-neutral, both to the buyer and to the seller's shareholders. The terms "demerger", "spin-off" and "spin-out" are sometimes used to indicate a situation where one company splits into two, generating a second company which may or may not become separately listed on a stock exchange. As per knowledge-based views, firms can generate greater values through the retention of knowledge-based resources which they generate and integrate. Extracting technological benefits during and after acquisition is an ever-challenging issue because of organizational differences.
Identity theft
Q471880 QID OVERLAP 0.800
QID OVERLAP: Q471880 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (18): "access", "benefits", "data", "financial", "largest", "level", "license", "office", "online", "personal", "program", "records", "report", "resources", "responsible", "security", "technology", "university".
accessbenefitsdatafinanciallargestlevellicenseofficeonlinepersonalprogramrecordsreportresourcesresponsiblesecuritytechnologyuniversity
date of birth, social security number, driver's license number, bank account or credit card numbers, PINs, electronic signatures, fingerprints, passwords, or any other information that can be used to access a person's financial resources. Determining the link between data breaches and identity theft is challenging, primarily because identity theft victims often do not know how their personal information was obtained. According to a report done for the FTC, identity theft is not always detectable by the individual victims. Identity fraud is often but not necessarily the consequence of identity theft. Someone can steal or misappropriate personal information without then committing identity theft using the information about every person, such as when a major data breach occurs. A U.S. Government Accountability Office study determined that "most breaches have not resulted in detected incidents of identity theft". The report also warned that "the full extent is unknown". A later unpublished study by Carnegie Mellon University noted that "Most often, the causes of identity theft is not known" but reported that someone else concluded that "the probability of becoming a victim to identity theft as a result of a data breach is ... around only 2%". For example, in a data breach involving the theft of payment card information, involving four million records and at the time one of the largest data breaches ever, the company claimed the breach resulted in only about 1,800 instances of identity theft. An October 2010 article entitled "Cyber Crime Made Easy" explained the level to which hackers are using malicious software. As Gunter Ollmann, Chief Technology Officer of security at Microsoft, said, "Interested in credit card theft? There's an app for that." This statement summed up the ease with which these hackers are accessing all kinds of information online. The new program for infecting users' computers was called Zeus, and the program is so hacker-friendly that even an inexperienced hacker can operate it. Although the hacking program is easy to use, that fact does not diminish the devastating effects that Zeus (or other software like Zeus) can do on a computer and the user. For example, programs like Zeus can steal credit card information, important documents, and even documents necessary for homeland security. If a hacker were to gain this information, it would mean nationwide identity theft or even a possible terrorist attack.
s Gunter Ollmann, Chief Technology Officer of security at Microsoft, said, "Interested in credit card theft? There's an app for that." This statement summed up the ease with which these hackers are accessing all kinds of information online. The new program for infecting users' computers was called Zeus, and the program is so hacker-friendly that even an inexperienced hacker can operate it. Although the hacking program is easy to use, that fact does not diminish the devastating effects that Zeus (or other software like Zeus) can do on a computer and the user. For example, programs like Zeus can steal credit card information, important documents, and even documents necessary for homeland security. If a hacker were to gain this information, it would mean nationwide identity theft or even a possible terrorist attack.
Identity protection by organizations In their May 1998 testimony before the United States Senate, the Federal Trade Commission (FTC) discussed the sale of Social Security numbers and other personal identifiers by credit-raters and data miners. The FTC agreed to the industry's self-regulating principles restricting access to information on credit reports. According to the industry, the restrictions vary according to the category of customer. Credit reporting agencies gather and disclose personal and credit information to a wide business client base. Poor stewardship of personal data by organizations, resulting in unauthorized access to sensitive data, can expose individuals to the risk of identity theft. The Privacy Rights Clearinghouse has documented over 900 individual data breaches by US companies and government agencies since January 2005, which together have involved over 200 million total records containing sensitive personal information, many containing social security numbers.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (13): "ada", "annual", "boise", "counties", "employers", "home", "idaho", "level", "population", "river", "technology", "treasure", "valley".
adaannualboisecountiesemployershomeidaholevelpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "population", "principal", "second", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannampapopulationprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Americans with Disabilities Act of 1990
Q1111004 QID OVERLAP 0.740
QID OVERLAP: Q1111004 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (12): "ada", "changes", "civil", "effective", "employers", "final", "national", "protection", "public", "requires", "rights", "sexual".
adachangescivileffectiveemployersfinalnationalprotectionpublicrequiresrightssexual
The Americans with Disabilities Act of 1990 (ADA) (42 U.S.C. § 12101) is a civil rights law that prohibits discrimination based on disability. It affords similar protections against discrimination to Americans with disabilities as the Civil Rights Act of 1964, which made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
h made discrimination based on race, religion, sex, national origin, and other characteristics illegal, and later sexual orientation and gender identity. In addition, unlike the Civil Rights Act, the ADA also requires covered employers to provide reasonable accommodations to employees with disabilities, and imposes accessibility requirements on public accommodations. In 1986, the National Council on Disability had recommended the enactment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
actment of an Americans with Disabilities Act and drafted the first version of the bill which was introduced in the House and Senate in 1988. A broad bipartisan coalition of legislators supported the ADA, while the bill was opposed by business interests (who argued the bill imposed costs on business) and conservative evangelicals (who opposed protection for individuals with HIV). The final version of the bill was signed into law on July 26, 1990, by President George H. W. Bush. It was later amended in 2008 and signed by President George W.
Advance healthcare directive
Q555118 QID OVERLAP 0.740
QID OVERLAP: Q555118 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (12): "attorney", "combined", "consent", "form", "healthcare", "itself", "jurisdiction", "legal", "medical", "personal", "power", "single".
attorneycombinedconsentformhealthcareitselfjurisdictionlegalmedicalpersonalpowersingle
some countries it is legally persuasive without being a legal document. A living will is one form of advance directive, leaving instructions for treatment. Another form is a specific type of power of attorney or health care proxy, in which the person authorizes someone (an agent) to make decisions on their behalf when they are incapacitated. People are often encouraged to complete both documents to provide comprehensive guidance regarding their care, although they may be combined into a single form. An example of combination documents includes the Five Wishes in the United States. The term living will is also the commonly recognised vernacular in many countries, especially the U.K.
Background Advance directives were created in response to the increasing sophistication and prevalence of medical technology. Numerous studies have documented critical deficits in the medical care of the dying; it has been found to be unnecessarily prolonged, painful, expensive, and emotionally burdensome to both patients and their families. Living will The living will is the oldest form of advance directive. It was first proposed by an Illinois attorney, Luis Kutner, in a speech to the Euthanasia Society of America in 1967 and published in a law journal in 1969. Kutner drew from existing estate law, by which an individual can control property affairs after death (i.e., when no longer available to speak for himself or herself) and devised a way for an individual to express their health care desires when no longer able to express current healthcare wishes. Because this form of "will" was to be used while an individual was still alive (but no longer able to make decisions), it was dubbed the "living will". The U.S. Patient Self-Determination Act (PSDA) went into effect in December 1991 and required healthcare providers (primarily hospitals, nursing homes, and home health agencies) to give patients information about their rights to make advance directives under state law. A living will usually provides specific directives about the course of treatment healthcare providers and caregivers are to follow. In some cases a living will may forbid the use of various kinds of burdensome medical treatment. It may also be used to express wishes about the use or foregoing of food and water, if supplied via tubes or other medical devices. The living will is used only if the individual has become unable to give informed consent or refusal due to incapacity. A living will can be very specific or very general. An example of a statement sometimes found in a living will is: "If I suffer an incurable, irreversible illness, disease, or condition and my attending physician determines that my condition is terminal, I direct that life-sustaining measures that would serve only to prolong my dying be withheld or discontinued." More specific living wills may include information regarding an individual's desire for such services such as analgesia (pain relief), antibiotics, hydration, feeding, and the use of ventilators or cardiopulmonary resuscitation. However, studies have also shown that adults are more likely to complete these documents if they are written in everyday language and less focused on technical treatments. However, by the late 1980s, public advocacy groups became aware that many people remained unaware of advance directives and even fewer actually completed them. In part, this was seen as a failure of health care providers and medical organizations to promote and support the use of these documents. The public's response was to press for further legislative support. The most recent result was the Patient Self-Determination Act of 1990, which attempted to address this awareness problem by requiring health care institutions to better promote and support the use of advance directives. Living wills proved to be very popular, and by 2007, 41% of Americans had completed a living will. In response to public needs, state legislatures soon passed laws in support of living wills in virtually every state in the union. However, as living wills began to be better recognized, key deficits were soon discovered. Most living wills tended to be limited in scope and often failed to fully address presenting problems and needs. Further, many individuals wrote out their wishes in ways that might conflict with quality medical practice. Ultimately, it was determined that a living will alone might be insufficient to address many important health care decisions.
The living will is the oldest form of advance directive. It was first proposed by an Illinois attorney, Luis Kutner, in a speech to the Euthanasia Society of America in 1967 and published in a law journal in 1969. Kutner drew from existing estate law, by which an individual can control property affairs after death (i.e., when no longer available to speak for himself or herself) and devised a way for an individual to express their health care desires when no longer able to express current healthcare wishes. Because this form of "will" was to be used while an individual was still alive (but no longer able to make decisions), it was dubbed the "living will". The U.S. Patient Self-Determination Act (PSDA) went into effect in December 1991 and required healthcare providers (primarily hospitals, nursing homes, and home health agencies) to give patients information about their rights to make advance directives under state law. A living will usually provides specific directives about the course of treatment healthcare providers and caregivers are to follow. In some cases a living will may forbid the use of various kinds of burdensome medical treatment. It may also be used to express wishes about the use or foregoing of food and water, if supplied via tubes or other medical devices. The living will is used only if the individual has become unable to give informed consent or refusal due to incapacity. A living will can be very specific or very general. An example of a statement sometimes found in a living will is: "If I suffer an incurable, irreversible illness, disease, or condition and my attending physician determines that my condition is terminal, I direct that life-sustaining measures that would serve only to prolong my dying be withheld or discontinued." More specific living wills may include information regarding an individual's desire for such services such as analgesia (pain relief), antibiotics, hydration, feeding, and the use of ventilators or cardiopulmonary resuscitation. However, studies have also shown that adults are more likely to complete these documents if they are written in everyday language and less focused on technical treatments. However, by the late 1980s, public advocacy groups became aware that many people remained unaware of advance directives and even fewer actually completed them. In part, this was seen as a failure of health care providers and medical organizations to promote and support the use of these documents. The public's response was to press for further legislative support. The most recent result was the Patient Self-Determination Act of 1990, which attempted to address this awareness problem by requiring health care institutions to better promote and support the use of advance directives. Living wills proved to be very popular, and by 2007, 41% of Americans had completed a living will. In response to public needs, state legislatures soon passed laws in support of living wills in virtually every state in the union. However, as living wills began to be better recognized, key deficits were soon discovered. Most living wills tended to be limited in scope and often failed to fully address presenting problems and needs. Further, many individuals wrote out their wishes in ways that might conflict with quality medical practice. Ultimately, it was determined that a living will alone might be insufficient to address many important health care decisions. This led to the development of what some have called "second generation" advance directives – the "health care proxy appointment" or "medical power of attorney." Living wills also reflect a moment in time, and may therefore need regular updating to ensure that the correct course of action can be chosen. Healthcare proxy Power of attorney statutes have existed in the United States since the days of "common law" (i.e., laws brought from England to the United States during the colonial period). These early powers of attorney allowed an individual to name someone to act in their stead. Drawing upon these laws, "durable powers of attorney for health care" and "healthcare proxy appointment" documents were created and codified in law, allowing an individual to appoint someone to make healthcare decisions in their behalf if they should ever be rendered incapable of making their wishes known. People will normally benefit from having both a durable power of attorney and a healthcare proxy. A healthcare proxy document appoints a person, the proxy, who can make decisions on behalf of the granting individual in the event of incapacity. The appointed healthcare proxy has, in essence, the same rights to request or refuse treatment that the individual would have if still capable of making and communicating health care decisions. The appointed representative is authorized to make real-time decisions in actual circumstances, as opposed to advance decisions framed in hypothetical situations, as might be recorded in a living will. The healthcare proxy was rapidly accepted within the U.S. and authorizing legislation was soon enacted in most states. One problem with a conventional healthcare proxy is that it may not be possible for the appointed proxy to determine what care choices the individual would have made if still capable, as healthcare proxies may be too vague for meaningful interpretation.
P
Q476115 QID OVERLAP 0.720
QID OVERLAP: Q476115 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (11): "changes", "development", "expansion", "finance", "financial", "financing", "firm", "firms", "general", "products", "public".
changesdevelopmentexpansionfinancefinancialfinancingfirmfirmsgeneralproductspublic
om their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
In January 1982, former United States Secretary of the Treasury William E. Simon and a group of investors acquired Gibson Greetings, a producer of greeting cards, for $80 million, of which only $1 million was rumored to have been contributed by the investors. By mid-1983, just sixteen months after the original deal, Gibson completed a $290 million IPO and Simon made approximately $66 million. The success of the Gibson Greetings investment attracted the attention of the wider media to the nascent boom in leveraged buyouts. Between 1979 and 1989, it was estimated that there were over 2,000 leveraged buyouts valued in excess of $250 million. During the 1980s, constituencies within acquired companies and the media ascribed the "corporate raid" label to many private-equity investments, particularly those that featured a hostile takeover of the company, perceived asset stripping, major layoffs or other significant corporate restructuring activities. Among the most notable investors to be labeled corporate raiders in the 1980s included Carl Icahn, Victor Posner, Nelson Peltz, Robert M. Bass, T. Boone Pickens, Harold Clark Simmons, Kirk Kerkorian, Sir James Goldsmith, Saul Steinberg and Asher Edelman. Carl Icahn developed a reputation as a ruthless corporate raider after his hostile takeover of TWA in 1985. Many of the corporate raiders were onetime clients of Michael Milken, whose investment banking firm, Drexel Burnham Lambert helped raise blind pools of capital with which corporate raiders could make a legitimate attempt to take over a company and provided high-yield debt ("junk bonds") financing of the buyouts. One of the final major buyouts of the 1980s proved to be its most ambitious and marked both a high-water mark and a sign of the beginning of the end of the boom. In 1989, KKR (Kohlberg Kravis Roberts) closed in on a $31.1 billion takeover of RJR Nabisco. It was, at that time and for over 17 years, the largest leveraged buyout in history. The event was chronicled in the book (and later the movie), Barbarians at the Gate: The Fall of RJR Nabisco. KKR would eventually prevail in acquiring RJR Nabisco at $109 per share, marking a dramatic increase from the original announcement that Shearson Lehman Hutton would take RJR Nabisco private at $75 per share. A fierce series of negotiations and horse-trading ensued which pitted KKR against Shearson and later Forstmann Little & Co. Many of the major banking players of the day, including Morgan Stanley, Goldman Sachs, Salomon Brothers, and Merrill Lynch were actively involved in advising and financing the parties. After Shearson's original bid, KKR quickly introduced a tender offer to obtain RJR Nabisco for $90 per share—a price that enabled it to proceed without the approval of RJR Nabisco's management. RJR's management team, working with Shearson and Salomon Brothers, submitted a bid of $112, a figure they felt certain would enable them to outflank any response by Kravis's team. KKR's final bid of $109, while a lower dollar figure, was ultimately accepted by the board of directors of RJR Nabisco. At $31.1 billion of transaction value, RJR Nabisco was by far the largest leveraged buyouts in history. In 2006 and 2007, a number of leveraged buyout transactions were completed that for the first time surpassed the RJR Nabisco leveraged buyout in terms of nominal purchase price. However, adjusted for inflation, none of the leveraged buyouts of the 2006–2007 period would surpass RJR Nabisco. By the end of the 1980s the excesses of the buyout market were beginning to show, with the bankruptcy of several large buyouts including Robert Campeau's 1988 buyout of Federated Department Stores, the 1986 buyout of the Revco drug stores, Walter Industries, FEB Trucking and Eaton Leonard. Additionally, the RJR Nabisco deal was showing signs of strain, leading to a recapitalization in 1990 that involved the contribution of $1.7 billion of new equity from KKR. In the end, KKR lost $700 million on RJR. Drexel reached an agreement with the government in which it pleaded nolo contendere (no contest) to six felonies – three counts of stock parking and three counts of stock manipulation. It also agreed to pay a fine of $650 million – at the time, the largest fine ever levied under securities laws. Milken left the firm after his own indictment in March 1989. On 13 February 1990 after being advised by United States Secretary of the Treasury Nicholas F. Brady, the U.S. Securities and Exchange Commission (SEC), the New York Stock Exchange and the Federal Reserve, Drexel Burnham Lambert officially filed for Chapter 11 bankruptcy protection. Age of the mega-buyout: 2005–2007 The combination of decreasing interest rates, loosening lending standards and regulatory changes for publicly traded companies (specifically the 2002 Sarbanes–Oxley Act) would set the stage for the largest boom private equity had seen. Marked by the buyout of Dex Media in 2002, large multibillion-dollar U.S. buyouts could once again obtain significant high yield debt financing, and larger transactions could be completed. By 2004 and 2005, major buyouts were once again becoming common, including the acquisitions of Toys "R" Us, The Hertz Corporation, Metro-Goldwyn-Mayer and SunGard in 2005. As 2006 began, new "largest buyout" records were set and surpassed several times; nine of the top ten buyouts by the end of 2007 had been announced in an 18-month period from the beginning of 2006 through the middle of 2007. In 2006, private-equity firms bought 654 U.S. companies for $375 billion, representing 18 times the level of transactions closed in 2003. Additionally, U.S.-based private-equity firms raised $215.4 billion in investor commitments to 322 funds, surpassing the previous record set in 2000 by 22% and 33% higher than the 2005 fundraising total The following year, despite the onset of turmoil in the credit markets in the summer, saw yet another record year of fundraising with $302 billion of investor commitments to 415 funds Among the mega-buyouts completed during the 2006 to 2007 boom were: EQ Office, HCA, Alliance Boots and TXU. In July 2007, the turmoil that had been affecting the mortgage markets, spilled over into the leveraged finance and high-yield debt markets. The markets had been highly robust during the first six months of 2007, with highly issuer friendly developments including PIK and PIK Toggle (interest is "Payable In Kind") and covenant light debt widely available to finance large leveraged buyouts. July and August saw a notable slowdown in issuance levels in the high yield and leveraged loan markets with few issuers accessing the market. Uncertain market conditions led to a significant widening of yield spreads, which coupled with the typical summer slowdown led many companies and investment banks to put their plans to issue debt on hold until the autumn. However, the expected rebound in the market after 1 May 2007 did not materialize, and the lack of market confidence prevented deals from pricing. By the end of September, the full extent of the credit situation became obvious as major lenders including Citigroup and UBS announced major writedowns due to credit losses. The leveraged finance markets came to a near standstill during a week in 2007. As 2008 began, lending standards tightened and the era of "mega-buyouts" came to an end.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (11): "ada", "boise", "district", "home", "idaho", "jurisdiction", "largest", "local", "population", "second", "washington".
adaboisedistricthomeidahojurisdictionlargestlocalpopulationsecondwashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "cities", "fastest-growing", "idaho", "meridian", "population", "second".
adaamongboisecitiesfastest-growingidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Garden City, Idaho
Q1516892 QID OVERLAP 0.660
QID OVERLAP: Q1516892 in legal (tier:branch) and senior_services (tier:evergreen). | SHARED TOKENS (8): "ada", "boise", "idaho", "municipal", "population", "second", "separate", "street".
adaboiseidahomunicipalpopulationsecondseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in legal (tier:branch) and senior_services (tier:evergreen). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "largest", "nampa", "population".
boisecaldwellcanyonidaholargestnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Power of attorney
Q159733 QID OVERLAP 0.620
QID OVERLAP: Q159733 in legal (tier:berry) and senior_services (tier:branch). | SHARED TOKENS (6): "attorney", "financial", "form", "legal", "power", "principal".
attorneyfinancialformlegalpowerprincipal
A power of attorney (POA) or letter of attorney is a written authorization to represent or act on another's behalf in private affairs (which may be financial or regarding health and welfare), business, or some other legal matter. The person authorizing the other to act is the principal, grantor, or donor (of the power). The one authorized to act is the agent, attorney, or in some common law jurisdictions, the attorney-in-fact. Formerly, the term "power" referred to an instrument signed under seal while a "letter" was an instrument under hand, meaning that it was simply signed by the parties, but today a power of attorney does not need to be signed under seal.
er legal matter. The person authorizing the other to act is the principal, grantor, or donor (of the power). The one authorized to act is the agent, attorney, or in some common law jurisdictions, the attorney-in-fact. Formerly, the term "power" referred to an instrument signed under seal while a "letter" was an instrument under hand, meaning that it was simply signed by the parties, but today a power of attorney does not need to be signed under seal.
y-in-fact. Formerly, the term "power" referred to an instrument signed under seal while a "letter" was an instrument under hand, meaning that it was simply signed by the parties, but today a power of attorney does not need to be signed under seal.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in legal (tier:branch) and senior_services (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
280 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP280 edges
🌿 BRANCH166 edges
0.590
educationhealthcarejurisdictionlicensednationalpracticeprofessionalprogramresponsibletitletrainingwork
SHARED TOKENS (12): "education", "healthcare", "jurisdiction", "licensed", "national", "practice", "professional", "program", "responsible", "title", "training", "work". | URL->B (1): http://www.bls.gov/ooh/Healthcare/Licensed-practical-and-licensed-vocational-nurses.htm. | EXACT TITLE in senior_services: "Licensed practical nurse".
0.500
Arbitration ↗ Q207946 EXACT TITLE
alternativecommercialconsumercontextcourtcourtsdisputesemploymententityformjudiciallocalmattersproceedingsreviewrightrightsthirdtransactions
SHARED TOKENS (19): "alternative", "commercial", "consumer", "context", "court", "courts", "disputes", "employment", "entity", "form", "judicial", "local", "matters", "proceedings", "review", "right", "rights", "third", "transactions". | EXACT TITLE in legal: "Arbitration".
0.500
amongcommunitydepartmenteducationenvironmentenvironmentaleventsfamilygrouphealthcareinstitutionslevelmaintenancemedicalmembersneedsorganizationoutsidephysicalplanning
SHARED TOKENS (31): "among", "community", "department", "education", "environment", "environmental", "events", "family", "group", "healthcare", "institutions", "level", "maintenance", "medical", "members", "needs", "organization", "outside", "physical", "planning".... | EXACT TITLE in senior_services: "Community health".
0.500
accessassistancecitiescommunitycriticaleventsfederalfinancialintellectuallocalmembersmunicipalneedsoutsidephysicalrecreationservesourcestitle
SHARED TOKENS (19): "access", "assistance", "cities", "community", "critical", "events", "federal", "financial", "intellectual", "local", "members", "municipal", "needs", "outside", "physical", "recreation", "serve", "sources", "title". | EXACT TITLE in senior_services: "Senior center".
0.500
Corporation ↗ Q167037 EXACT TITLE
contextcorporateentityestablishedinvestorsjurisdictionlegallocalobligationsofficeownedownerspracticepublicrightservesinglethirdworkers
SHARED TOKENS (19): "context", "corporate", "entity", "established", "investors", "jurisdiction", "legal", "local", "obligations", "office", "owned", "owners", "practice", "public", "right", "serve", "single", "third", "workers". | EXACT TITLE in legal: "Corporation".
0.500
civilcourtenforcementenvironmentalgovernsintellectualjurisdictionlandlegalpersonalpropertypublicrealrelationshipsrightsseparatesettrust
SHARED TOKENS (18): "civil", "court", "enforcement", "environmental", "governs", "intellectual", "jurisdiction", "land", "legal", "personal", "property", "public", "real", "relationships", "rights", "separate", "set", "trust". | EXACT TITLE in legal: "Property law".
0.500
Trust (law) ↗ Q854022 EXACT TITLE
assetscourtcreatedcriminalentityestablishedfederalgovernedincomejurisdictionlegallifeownerspropertypublicrequiresrightsingletrust
SHARED TOKENS (19): "assets", "court", "created", "criminal", "entity", "established", "federal", "governed", "income", "jurisdiction", "legal", "life", "owners", "property", "public", "requires", "right", "single", "trust". | EXACT TITLE in legal: "Trust (law)". | EXACT TITLE in senior_services: "Trust (law)".
0.500
amongcasescontextestablishedexperiencefamilyfinancialformshomelevellifemaritalmembersofficeorganizationphysicalpowerratesrelationshipsreligious
SHARED TOKENS (23): "among", "cases", "context", "established", "experience", "family", "financial", "forms", "home", "level", "life", "marital", "members", "office", "organization", "physical", "power", "rates", "relationships", "religious".... | EXACT TITLE in legal: "Domestic violence".
0.500
Patent ↗ Q253623 EXACT TITLE
agreementsamongclaimsdisclosurefallformsintellectuallegalnationalorganizationpropertyprotectionpublicrightrightstechnology
SHARED TOKENS (16): "agreements", "among", "claims", "disclosure", "fall", "forms", "intellectual", "legal", "national", "organization", "property", "protection", "public", "right", "rights", "technology". | EXACT TITLE in legal: "Patent".
0.500
assistancecannotcommunityenvironmentexpansionfederalgrouphomeindustrylargestmedicalmedicationorganizationsoutsideoversightownedpersonalpopulationregulatoryreports
SHARED TOKENS (23): "assistance", "cannot", "community", "environment", "expansion", "federal", "group", "home", "industry", "largest", "medical", "medication", "organizations", "outside", "oversight", "owned", "personal", "population", "regulatory", "reports".... | EXACT TITLE in senior_services: "Assisted living".
0.500
Social work ↗ Q205398 EXACT TITLE
advocacyagenciescommunitydevelopmenteducationfamiliesfamilygrouplaborneedsorganizationspracticepublicreligiousworkworkers
SHARED TOKENS (16): "advocacy", "agencies", "community", "development", "education", "families", "family", "group", "labor", "needs", "organizations", "practice", "public", "religious", "work", "workers". | EXACT TITLE in senior_services: "Social work".
0.500
americanbenefitschangesemploymentfederalinsurancelargelegallevellocalpaidpayprogramresidentssecuritysystemtrustwageworkers
SHARED TOKENS (19): "american", "benefits", "changes", "employment", "federal", "insurance", "large", "legal", "level", "local", "paid", "pay", "program", "residents", "security", "system", "trust", "wage", "workers". | EXACT TITLE in senior_services: "Social Security (United States)".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessdataeducationhealthcarehomeintegrationmedicalonlinephysicalpracticeprofessionalpublicrecordssupportsystemtechnology
SHARED TOKENS (16): "access", "data", "education", "healthcare", "home", "integration", "medical", "online", "physical", "practice", "professional", "public", "records", "support", "system", "technology". | EXACT TITLE in senior_services: "Telehealth".
0.500
administersadministrativedepartmentfederalfinancinggovhealthcarehomeinsuranceoversightprogramqualityreportsstandardssystem
SHARED TOKENS (15): "administers", "administrative", "department", "federal", "financing", "gov", "healthcare", "home", "insurance", "oversight", "program", "quality", "reports", "standards", "system". | EXACT TITLE in senior_services: "Centers for Medicare & Medicaid Services".
0.500
Elder abuse ↗ Q427883 EXACT TITLE
agenciescommunitycriminaleldereventsfamilyformsgeneralhomemembersnetworkorganizationpaidprofessionalpropertystreet
SHARED TOKENS (16): "agencies", "community", "criminal", "elder", "events", "family", "forms", "general", "home", "members", "network", "organization", "paid", "professional", "property", "street". | EXACT TITLE in senior_services: "Elder abuse".
0.500
appealsauthoritycannotcasescivilcourtcourtsdisputesestablishedfinalitselfjurisdictionlegallevelpowerproceedingproceedingsreviewrightsecond
SHARED TOKENS (22): "appeals", "authority", "cannot", "cases", "civil", "court", "courts", "disputes", "established", "final", "itself", "jurisdiction", "legal", "level", "power", "proceeding", "proceedings", "review", "right", "second".... | EXACT TITLE in legal: "Appellate court".
0.500
H-1B visa ↗ Q974595 EXACT TITLE
additionalbeyondconsumerdepartmentemployersemploymentgrowthknowledgeleadphysicalprogramprojectsregulationrequiredrequiressectionsecurityspecialtywageworkers
SHARED TOKENS (20): "additional", "beyond", "consumer", "department", "employers", "employment", "growth", "knowledge", "lead", "physical", "program", "projects", "regulation", "required", "requires", "section", "security", "specialty", "wage", "workers". | EXACT TITLE in legal: "H-1B visa".
0.500
agenciesamericancreatedeffectiveelderfamilyfederalhomelevellocalnationalnetworkpopulationprogramrightssupport
SHARED TOKENS (16): "agencies", "american", "created", "effective", "elder", "family", "federal", "home", "level", "local", "national", "network", "population", "program", "rights", "support". | EXACT TITLE in senior_services: "Older Americans Act of 1965".
0.500
Retirement ↗ Q946865 EXACT TITLE
accessbenefitsbeyondemployersemploymentfamilyindustrylifenationalpublicrightsectorsecuritysupportwesternworkworkers
SHARED TOKENS (17): "access", "benefits", "beyond", "employers", "employment", "family", "industry", "life", "national", "public", "right", "sector", "security", "support", "western", "work", "workers". | EXACT TITLE in senior_services: "Retirement".
0.500
additionaladvocateagenciescommissionconsentconsumereducationenforcementenvironmentestablishedfederalfoodgeneralneedsorganizationspracticeproductsprotectionpublicright
SHARED TOKENS (23): "additional", "advocate", "agencies", "commission", "consent", "consumer", "education", "enforcement", "environment", "established", "federal", "food", "general", "needs", "organizations", "practice", "products", "protection", "public", "right".... | EXACT TITLE in legal: "Consumer protection".
0.500
americanannualassociationboisecollegeeducationemploymentenvironmentalestablishedexpansionfallfallsidahointellectualnewsprogrampropertypublicreportresources
SHARED TOKENS (23): "american", "annual", "association", "boise", "college", "education", "employment", "environmental", "established", "expansion", "fall", "falls", "idaho", "intellectual", "news", "program", "property", "public", "report", "resources".... | EXACT TITLE in legal: "University of Idaho College of Law".
0.500
changesenvironmentexperienceformgrouphealthcareinjurylargestlifenationalneedsphysicalprimarysetsupportthirdwork
SHARED TOKENS (17): "changes", "environment", "experience", "form", "group", "healthcare", "injury", "largest", "life", "national", "needs", "physical", "primary", "set", "support", "third", "work". | EXACT TITLE in senior_services: "Occupational therapy".
0.500
Court ↗ Q41487 EXACT TITLE
administrativeauthoritycivilcourtcourtscriminaldisputesentityestablishedjudicialjurisdictionjusticelegalmatterspower
SHARED TOKENS (15): "administrative", "authority", "civil", "court", "courts", "criminal", "disputes", "entity", "established", "judicial", "jurisdiction", "justice", "legal", "matters", "power". | EXACT TITLE in legal: "Court". | EXACT TITLE in senior_services: "Court".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessamericanannualassetsbenefitscourtcoverseffectiveelderestablishedexpandedfamiliesfederalfinancialgeneralhealthcarehomeincomeinsurancelargest
SHARED TOKENS (33): "access", "american", "annual", "assets", "benefits", "court", "covers", "effective", "elder", "established", "expanded", "families", "federal", "financial", "general", "healthcare", "home", "income", "insurance", "largest".... | EXACT TITLE in senior_services: "Medicaid".
0.500
Disability ↗ Q12131 EXACT TITLE
accesscommunityconditioncreatedeffectiveexperiencefocusframeworkhistoryintegrationintellectuallegalmedicalphysicalpopulationrequiresrightsservessettechnology
SHARED TOKENS (20): "access", "community", "condition", "created", "effective", "experience", "focus", "framework", "history", "integration", "intellectual", "legal", "medical", "physical", "population", "requires", "rights", "serves", "set", "technology". | EXACT TITLE in senior_services: "Disability".
0.500
Mediation ↗ Q223871 EXACT TITLE
agreementsamongassistanceauthoritycivilcommercialdisputesformformsindependentlegallicensingneedspracticeprofessionalreachthirdtraining
SHARED TOKENS (18): "agreements", "among", "assistance", "authority", "civil", "commercial", "disputes", "form", "forms", "independent", "legal", "licensing", "needs", "practice", "professional", "reach", "third", "training". | EXACT TITLE in legal: "Mediation". | EXACT TITLE in senior_services: "Mediation".
0.500
Real estate ↗ Q684740 EXACT TITLE
commercialentityestategeneralgrowinglandlegalnonprofitownedpersonalpropertypublicrealresourceswater
SHARED TOKENS (15): "commercial", "entity", "estate", "general", "growing", "land", "legal", "nonprofit", "owned", "personal", "property", "public", "real", "resources", "water". | EXACT TITLE in legal: "Real estate". | EXACT TITLE in senior_services: "Real estate".
0.500
amongbenefitscreatedemployersemploymentformgeneralinsurancemedicaloutsiderightsecuritysystemwageworkers
SHARED TOKENS (15): "among", "benefits", "created", "employers", "employment", "form", "general", "insurance", "medical", "outside", "right", "security", "system", "wage", "workers". | EXACT TITLE in legal: "Workers' compensation".
0.500
accessassociationcompetitivedevelopmentestatefinancialformsgeneralindustrylocalmembersmunicipalnetworkoperatingoperationsplanningpublicrealregionalrequired
SHARED TOKENS (21): "access", "association", "competitive", "development", "estate", "financial", "forms", "general", "industry", "local", "members", "municipal", "network", "operating", "operations", "planning", "public", "real", "regional", "required".... | EXACT TITLE in senior_services: "Public transport".
0.500
Snake River ↗ EXACT TITLE
agenciesamericancanyoncommercialconstructioncreatedfallsheavilyhistoryidaholargelargestnationalplainpopulationsprojectspublicremovalriversection
SHARED TOKENS (26): "agencies", "american", "canyon", "commercial", "construction", "created", "falls", "heavily", "history", "idaho", "large", "largest", "national", "plain", "populations", "projects", "public", "removal", "river", "section".... | EXACT TITLE in legal: "Snake River".
0.500
Contract ↗ Q93288 EXACT TITLE
agreementscivilcodecommercialconsentenforcementframeworkgeneralgovernedgroundsindependentjudiciallegalnationalobligationspracticerights
SHARED TOKENS (17): "agreements", "civil", "code", "commercial", "consent", "enforcement", "framework", "general", "governed", "grounds", "independent", "judicial", "legal", "national", "obligations", "practice", "rights". | EXACT TITLE in legal: "Contract". | EXACT TITLE in senior_services: "Contract".
0.500
amongbenefitscommissionexperiencefamiliesfamilyfinancialhealthcarehomepersonalphysicalprimaryqualitysupportwashington
SHARED TOKENS (15): "among", "benefits", "commission", "experience", "families", "family", "financial", "healthcare", "home", "personal", "physical", "primary", "quality", "support", "washington". | EXACT TITLE in senior_services: "Respite care".
0.500
agenciesagreementsdevelopmentenforcementenvironmentenvironmentalgrowthjudicialjurisdictionlegalnationalnationallyneedsorganizationsprotectionregulatoryresourceresourcesrightssafety
SHARED TOKENS (20): "agencies", "agreements", "development", "enforcement", "environment", "environmental", "growth", "judicial", "jurisdiction", "legal", "national", "nationally", "needs", "organizations", "protection", "regulatory", "resource", "resources", "rights", "safety". | EXACT TITLE in legal: "Environmental law".
0.500
additionalalternativeannualbenefitscoversfederalgrouphealthcareinsurancepaidprogramreportreportsresultingsecuritytrust
SHARED TOKENS (16): "additional", "alternative", "annual", "benefits", "covers", "federal", "group", "healthcare", "insurance", "paid", "program", "report", "reports", "resulting", "security", "trust". | EXACT TITLE in senior_services: "Medicare (United States)".
0.500
assetscivilcodecommercialconsumerdistrictemploymentfallfinancefinancialfinancingfoodframeworkgeneralinsuranceintellectualjurisdictionlegalmarketsmatters
SHARED TOKENS (36): "assets", "civil", "code", "commercial", "consumer", "district", "employment", "fall", "finance", "financial", "financing", "food", "framework", "general", "insurance", "intellectual", "jurisdiction", "legal", "markets", "matters".... | EXACT TITLE in legal: "Commercial law".
0.500
Franchising ↗ Q171947 EXACT TITLE
alternativecorporateentityexpansionexplicitlyfinancialfranchisegrowthintellectuallargelegallicensingmarketobligationsownedpracticeproductspropertyregulaterights
SHARED TOKENS (22): "alternative", "corporate", "entity", "expansion", "explicitly", "financial", "franchise", "growth", "intellectual", "large", "legal", "licensing", "market", "obligations", "owned", "practice", "products", "property", "regulate", "rights".... | EXACT TITLE in senior_services: "Franchising".
0.500
adaboisecanyoncollegecommunitycountiesdevelopmenteducationfallgovernedidaholargenampapopulationprimarypublicresidentssouthwesttreasurevalley
SHARED TOKENS (21): "ada", "boise", "canyon", "college", "community", "counties", "development", "education", "fall", "governed", "idaho", "large", "nampa", "population", "primary", "public", "residents", "southwest", "treasure", "valley".... | EXACT TITLE in senior_services: "College of Western Idaho".
0.500
casescivilcollectioncreateddevelopmentenforcementfamilyfinancialincomejurisdictionmaintenancemaritalneedsobligationspaidpayprimaryrequiredrequiresreview
SHARED TOKENS (25): "cases", "civil", "collection", "created", "development", "enforcement", "family", "financial", "income", "jurisdiction", "maintenance", "marital", "needs", "obligations", "paid", "pay", "primary", "required", "requires", "review".... | EXACT TITLE in legal: "Child support".
0.500
accessagenciesalternativebeyondcasescitiescommunityformincomelocaloperatesorganizationspublicregulationserving
SHARED TOKENS (15): "access", "agencies", "alternative", "beyond", "cases", "cities", "community", "form", "income", "local", "operates", "organizations", "public", "regulation", "serving". | EXACT TITLE in senior_services: "Paratransit".
0.500
assetsauthoritycasescountiescourtcourtscreateddistrictestateguardianshipsjudicialjurisdictionmattersmedicationpersonalprobatepropertystatutory
SHARED TOKENS (18): "assets", "authority", "cases", "counties", "court", "courts", "created", "district", "estate", "guardianships", "judicial", "jurisdiction", "matters", "medication", "personal", "probate", "property", "statutory". | EXACT TITLE in senior_services: "Probate court".
0.480
Divorce ↗ Q93190 EXACT TITLE
accessauthoritycivilcourtdebtlegalmaritalpropertyreligiousrequiredrequiressexualsupporttermination
SHARED TOKENS (14): "access", "authority", "civil", "court", "debt", "legal", "marital", "property", "religious", "required", "requires", "sexual", "support", "termination". | EXACT TITLE in legal: "Divorce".
0.480
additionalagenciesalongsidedepartmentsmedicalmunicipalpaidpracticeprofessionalpublicservingsettrainingwork
SHARED TOKENS (14): "additional", "agencies", "alongside", "departments", "medical", "municipal", "paid", "practice", "professional", "public", "serving", "set", "training", "work". | EXACT TITLE in senior_services: "Emergency medical technician".
0.480
Green card ↗ Q6676995 EXACT TITLE
amongappealsattorneycasescriminalfederalformgeneralgoodproceedingsremovalresidentsserveworkers
SHARED TOKENS (14): "among", "appeals", "attorney", "cases", "criminal", "federal", "form", "general", "good", "proceedings", "removal", "residents", "serve", "workers". | EXACT TITLE in legal: "Green card".
0.480
Complaint ↗ Q836925 EXACT TITLE
associatedauthoritycasescivilcourtcourtscriminalfederaljusticelegalpolicepowerprosecutorsupport
SHARED TOKENS (14): "associated", "authority", "cases", "civil", "court", "courts", "criminal", "federal", "justice", "legal", "police", "power", "prosecutor", "support". | EXACT TITLE in senior_services: "Complaint".
0.480
casesclaimsfamilygoodlandlegalpropertypublicrealrequiredrightrightsservestitle
SHARED TOKENS (14): "cases", "claims", "family", "good", "land", "legal", "property", "public", "real", "required", "right", "rights", "serves", "title". | EXACT TITLE in legal: "Title (property)". | EXACT TITLE in senior_services: "Title (property)".
0.480
commercialcommunitycorporateenvironmentfinancialgovernsinvestorslegalmarketmattersorganizationspracticerightssystem
SHARED TOKENS (14): "commercial", "community", "corporate", "environment", "financial", "governs", "investors", "legal", "market", "matters", "organizations", "practice", "rights", "system". | EXACT TITLE in legal: "Corporate law".
0.480
amongassociatedcomplexfamilieshealthcarehomelifemedicalneedsorganizationphysicalqualitysupportworkers
SHARED TOKENS (14): "among", "associated", "complex", "families", "healthcare", "home", "life", "medical", "needs", "organization", "physical", "quality", "support", "workers". | EXACT TITLE in senior_services: "Palliative care".
0.480
continuingcriminaleducationhealthcarejurisdictionlicenselicensedlicensingpracticeprofessionalprogramrequirementresponsibleworkers
SHARED TOKENS (14): "continuing", "criminal", "education", "healthcare", "jurisdiction", "license", "licensed", "licensing", "practice", "professional", "program", "requirement", "responsible", "workers". | EXACT TITLE in senior_services: "Registered nurse".
0.470
appealsboisecourtcreatedidahooperations
SHARED TOKENS (6): "appeals", "boise", "court", "created", "idaho", "operations". | URL->A (1): http://www.iic.idaho.gov/. | EXACT TITLE in legal: "Idaho Court of Appeals".
0.460
amongcommissiondevelopmentestatefinanciallegalnationalpropertyrealrightssystemtransactiontransactions
SHARED TOKENS (13): "among", "commission", "development", "estate", "financial", "legal", "national", "property", "real", "rights", "system", "transaction", "transactions". | EXACT TITLE in legal: "Real estate transaction".
0.460
americancasescivilconcentratedcourtcriminalgeneraljudiciallegalproceedingreviewsinglesystem
SHARED TOKENS (13): "american", "cases", "civil", "concentrated", "court", "criminal", "general", "judicial", "legal", "proceeding", "review", "single", "system". | EXACT TITLE in legal: "Jury trial".
0.460
addressassociatedcannotcommunityhomelevellifemedicalneedspopulationsqualityrequirestransfers
SHARED TOKENS (13): "address", "associated", "cannot", "community", "home", "level", "life", "medical", "needs", "populations", "quality", "requires", "transfers". | EXACT TITLE in senior_services: "Long-term care".
0.460
Dementia ↗ Q83030 EXACT TITLE
associatedbodiescaseschangesconditiondevelopmentformformsgeneralhistorylifequalityrelationships
SHARED TOKENS (13): "associated", "bodies", "cases", "changes", "condition", "development", "form", "forms", "general", "history", "life", "quality", "relationships". | EXACT TITLE in senior_services: "Dementia".
0.460
aidassistancecannotcasescourtcriminalestablishedfederallegalofficepublicrepresentationrequires
SHARED TOKENS (13): "aid", "assistance", "cannot", "cases", "court", "criminal", "established", "federal", "legal", "office", "public", "representation", "requires". | EXACT TITLE in legal: "Public defender".
0.440
complexfinalfirmintegrationlargemarketownedproducesproductsriversupplyvertical
SHARED TOKENS (12): "complex", "final", "firm", "integration", "large", "market", "owned", "produces", "products", "river", "supply", "vertical". | EXACT TITLE in senior_services: "Vertical integration".
0.440
Law firm ↗ Q613142 EXACT TITLE
assistancecasescivilcriminalentityfirmlegalmatterspracticeprimaryrightstransactions
SHARED TOKENS (12): "assistance", "cases", "civil", "criminal", "entity", "firm", "legal", "matters", "practice", "primary", "rights", "transactions". | EXACT TITLE in legal: "Law firm".
0.440
additionalconditioncontactcontinuingfamilygeneralhealthcarephysicalprimaryprincipalprofessionalsystem
SHARED TOKENS (12): "additional", "condition", "contact", "continuing", "family", "general", "healthcare", "physical", "primary", "principal", "professional", "system". | EXACT TITLE in senior_services: "Primary care".
0.440
Assault ↗ Q365680 EXACT TITLE
civilcombinedcontactcriminallegalphysicalpoliceprosecutionseparatesexualsinglesystem
SHARED TOKENS (12): "civil", "combined", "contact", "criminal", "legal", "physical", "police", "prosecution", "separate", "sexual", "single", "system". | EXACT TITLE in legal: "Assault".
0.440
Lawyer ↗ Q40348 EXACT TITLE
educationjurisdictionknowledgelegalmatterspracticeprofessionalrequiredrightssystemtrainingwork
SHARED TOKENS (12): "education", "jurisdiction", "knowledge", "legal", "matters", "practice", "professional", "required", "rights", "system", "training", "work". | EXACT TITLE in legal: "Lawyer".
0.440
Pharmacy ↗ Q614304 EXACT TITLE
communityeffectiveinstitutionalmedicationofficepracticeprimaryproductsprofessionalsafetyscienceswork
SHARED TOKENS (12): "community", "effective", "institutional", "medication", "office", "practice", "primary", "products", "professional", "safety", "sciences", "work". | EXACT TITLE in senior_services: "Pharmacy".
0.440
americanassociationgrouphomeinjuryinstitutionsinsurancemedicalneedsphysicalpublicresidents
SHARED TOKENS (12): "american", "association", "group", "home", "injury", "institutions", "insurance", "medical", "needs", "physical", "public", "residents". | EXACT TITLE in senior_services: "Nursing home".
0.440
developmentexpandedfinallandlegalownerspowerpropertypublicrightthirdtitle
SHARED TOKENS (12): "development", "expanded", "final", "land", "legal", "owners", "power", "property", "public", "right", "third", "title". | EXACT TITLE in legal: "Eminent domain".
0.420
americandepartmentsfinancialformslegallocalphysicalregulatoryservesexualvulnerable
SHARED TOKENS (11): "american", "departments", "financial", "forms", "legal", "local", "physical", "regulatory", "serve", "sexual", "vulnerable". | EXACT TITLE in senior_services: "Adult Protective Services".
0.420
Home care ↗ Q1642542 EXACT TITLE
aidassistancecommunityhomelocalmarketnationalorganizationspersonalprofessionalvolunteer
SHARED TOKENS (11): "aid", "assistance", "community", "home", "local", "market", "national", "organizations", "personal", "professional", "volunteer". | EXACT TITLE in senior_services: "Home care".
0.420
agreementsbenefitscasescivilestatelegalmaritalpropertyrightrightssupport
SHARED TOKENS (11): "agreements", "benefits", "cases", "civil", "estate", "legal", "marital", "property", "right", "rights", "support". | EXACT TITLE in legal: "Prenuptial agreement".
0.410
Elder rights ↗ Q22908078 KW CROSS HIGH
accessbenefitselderfederalfinancialincomelifemedicalphysicalrightssecuritysexualtechnology
SHARED TOKENS (13): "access", "benefits", "elder", "federal", "financial", "income", "life", "medical", "physical", "rights", "security", "sexual", "technology". | URL->B (1): https://acl.gov/about-acl/administration-aging.
0.400
americancasesentityinjurylegallifemedicalpersonalpropertyquality
SHARED TOKENS (10): "american", "cases", "entity", "injury", "legal", "life", "medical", "personal", "property", "quality". | EXACT TITLE in legal: "Personal injury".
0.400
casescivilcommunityestatemaritalownedprobatepropertyseparatesystem
SHARED TOKENS (10): "cases", "civil", "community", "estate", "marital", "owned", "probate", "property", "separate", "system". | EXACT TITLE in legal: "Community property".
0.400
attorneyscontinuingdevelopmentdistricteducationlegaloutsidepracticeprofessionalrequired
SHARED TOKENS (10): "attorneys", "continuing", "development", "district", "education", "legal", "outside", "practice", "professional", "required". | EXACT TITLE in legal: "Continuing legal education".
0.400
Gerontology ↗ Q10387 EXACT TITLE
amongarchitecturecreateddevelopmenthomephysicalplanningpopulationpublicwork
SHARED TOKENS (10): "among", "architecture", "created", "development", "home", "physical", "planning", "population", "public", "work". | EXACT TITLE in senior_services: "Gerontology".
0.400
assetscomplexestatelegallifeneedsnetplanningprobateproperty
SHARED TOKENS (10): "assets", "complex", "estate", "legal", "life", "needs", "net", "planning", "probate", "property". | EXACT TITLE in legal: "Estate planning". | EXACT TITLE in senior_services: "Estate planning".
0.400
Inheritance ↗ Q200303 EXACT TITLE
amongassetscivillegalobligationspracticeprobatepropertyrightsstatutory
SHARED TOKENS (10): "among", "assets", "civil", "legal", "obligations", "practice", "probate", "property", "rights", "statutory". | EXACT TITLE in legal: "Inheritance".
0.400
Stroke ↗ Q12202 EXACT TITLE
annualassociatedcasesconditionmedicalmedicationphysicalresponsiblesecondthird
SHARED TOKENS (10): "annual", "associated", "cases", "condition", "medical", "medication", "physical", "responsible", "second", "third". | EXACT TITLE in senior_services: "Stroke".
0.400
Overtime ↗ Q667022 EXACT TITLE
beyondemployersemploymentlevelnationalpayratessupplyworkworkers
SHARED TOKENS (10): "beyond", "employers", "employment", "level", "national", "pay", "rates", "supply", "work", "workers". | EXACT TITLE in senior_services: "Overtime".
0.400
authorityeducationhealthcarelifemedicalmedicationphysicalpracticeprimarypublic
SHARED TOKENS (10): "authority", "education", "healthcare", "life", "medical", "medication", "physical", "practice", "primary", "public". | EXACT TITLE in senior_services: "Physical therapy".
0.400
Creditor ↗ Q157165 EXACT TITLE
assetscourtdebtfinancialgeneralorganizationpaypropertysecondsecurity
SHARED TOKENS (10): "assets", "court", "debt", "financial", "general", "organization", "pay", "property", "second", "security". | EXACT TITLE in legal: "Creditor".
0.380
accesscontactfamilylegalphysicalproceedingsrightrightsstandard
SHARED TOKENS (9): "access", "contact", "family", "legal", "physical", "proceedings", "right", "rights", "standard". | EXACT TITLE in legal: "Child custody".
0.380
administrativecommercialconstructiondevelopmentinstitutionalplanningprojectssinglezoning
SHARED TOKENS (9): "administrative", "commercial", "construction", "development", "institutional", "planning", "projects", "single", "zoning". | EXACT TITLE in senior_services: "Mixed-use development".
0.380
Jury ↗ Q837675 EXACT TITLE
bodiescivilcourtgrouplegalprofessionalsetsinglesystem
SHARED TOKENS (9): "bodies", "civil", "court", "group", "legal", "professional", "set", "single", "system". | EXACT TITLE in legal: "Jury". | EXACT TITLE in senior_services: "Jury".
0.380
Geriatrics ↗ Q10384 EXACT TITLE
complexenvironmentalfamilyinjurylifemedicalneedsqualityspecialty
SHARED TOKENS (9): "complex", "environmental", "family", "injury", "life", "medical", "needs", "quality", "specialty". | EXACT TITLE in senior_services: "Geriatrics".
0.380
appealscivilcourtcourtsfinaljurisdictionlegalreviewsingle
SHARED TOKENS (9): "appeals", "civil", "court", "courts", "final", "jurisdiction", "legal", "review", "single". | EXACT TITLE in legal: "Supreme court".
0.380
authoritycasesfederalheavilylandpopulationpowerrightsstatutory
SHARED TOKENS (9): "authority", "cases", "federal", "heavily", "land", "population", "power", "rights", "statutory". | EXACT TITLE in legal: "Constitutional law".
0.370
communitydepartment
SHARED TOKENS (2): "community", "department". | URL->B (2): https://www.acl.gov/about-acl/authorizing-statutes/older-americans-act, https://acl.gov/about-acl/administration-aging. | EXACT TITLE in senior_services: "Administration on Aging".
0.360
focusgoodintellectuallandlegalprimarypropertyrights
SHARED TOKENS (8): "focus", "good", "intellectual", "land", "legal", "primary", "property", "rights". | EXACT TITLE in legal: "Intellectual property".
0.360
Aquifer ↗ Q208791 EXACT TITLE
beyondenvironmenthomelandlayerleadmaterialwater
SHARED TOKENS (8): "beyond", "environment", "home", "land", "layer", "lead", "material", "water". | EXACT TITLE in legal: "Aquifer".
0.360
communitydepartmentfamiliesofficeprincipalprogramreportsserves
SHARED TOKENS (8): "community", "department", "families", "office", "principal", "program", "reports", "serves". | EXACT TITLE in senior_services: "Administration for Community Living".
0.360
Law school ↗ Q1321960 EXACT TITLE
collegedepartmenteducationjurisdictionlegalprofessionalsystemuniversity
SHARED TOKENS (8): "college", "department", "education", "jurisdiction", "legal", "professional", "system", "university". | EXACT TITLE in legal: "Law school".
0.360
authorityestatefinancialhealthcarelegalorganizationspersonalphysical
SHARED TOKENS (8): "authority", "estate", "financial", "healthcare", "legal", "organizations", "personal", "physical". | EXACT TITLE in senior_services: "Conservatorship".
0.360
constructionitselflaborpersonalpropertyrealsecuritytitle
SHARED TOKENS (8): "construction", "itself", "labor", "personal", "property", "real", "security", "title". | EXACT TITLE in legal: "Mechanic's lien".
0.360
cannotincomeinjurylegalmedicalprofessionalstandardstandards
SHARED TOKENS (8): "cannot", "income", "injury", "legal", "medical", "professional", "standard", "standards". | EXACT TITLE in legal: "Medical malpractice".
0.360
amongbackgroundcriminaleducationemploymenthistorysearchsecurity
SHARED TOKENS (8): "among", "background", "criminal", "education", "employment", "history", "search", "security". | EXACT TITLE in senior_services: "Background check".
0.340
cannotconditionfalllifemedicalorganizationweeks
SHARED TOKENS (7): "cannot", "condition", "fall", "life", "medical", "organization", "weeks". | EXACT TITLE in senior_services: "Chronic condition".
0.340
Immigration law ↗ EXACT TITLE
freedomlegalmattersnationalregulaterightrights
SHARED TOKENS (7): "freedom", "legal", "matters", "national", "regulate", "right", "rights". | EXACT TITLE in legal: "Immigration law".
0.340
Caregiver ↗ Q553079 EXACT TITLE
cannotfamilyhealthcarehomepaidsupportworkers
SHARED TOKENS (7): "cannot", "family", "healthcare", "home", "paid", "support", "workers". | EXACT TITLE in senior_services: "Caregiver".
0.340
amongfoodhomelifeorganizationprogramquality
SHARED TOKENS (7): "among", "food", "home", "life", "organization", "program", "quality". | EXACT TITLE in senior_services: "Meals on Wheels".
0.320
Pro bono ↗ Q127537 EXACT TITLE
communitygoodlegalprofessionalpublicwork
SHARED TOKENS (6): "community", "good", "legal", "professional", "public", "work". | EXACT TITLE in legal: "Pro bono".
0.320
communityeducationgrouplabortrainingwork
SHARED TOKENS (6): "community", "education", "group", "labor", "training", "work". | EXACT TITLE in senior_services: "Volunteering".
0.320
civilcriminalpolicereportrequiredvulnerable
SHARED TOKENS (6): "civil", "criminal", "police", "report", "required", "vulnerable". | EXACT TITLE in senior_services: "Mandated reporter".
0.320
amongfallsidahomeridianpublicuniversity
SHARED TOKENS (6): "among", "falls", "idaho", "meridian", "public", "university". | EXACT TITLE in senior_services: "Idaho State University".
0.320
Annexation ↗ Q194465 EXACT TITLE
annexationbodieslegalphysicalterritorytitle
SHARED TOKENS (6): "annexation", "bodies", "legal", "physical", "territory", "title". | EXACT TITLE in legal: "Annexation". | EXACT TITLE in senior_services: "Annexation".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalboiseidahoplainriverwestern
SHARED TOKENS (6): "agricultural", "boise", "idaho", "plain", "river", "western". | EXACT TITLE in senior_services: "Boise River".
0.300
assetscasescommercialdevelopmentestatefinancefinancialfinancingindustryinstitutionalinvestorsmarketsnetofficeoperatesoperationspayrealstandardtrust
SHARED TOKENS (20): "assets", "cases", "commercial", "development", "estate", "finance", "financial", "financing", "industry", "institutional", "investors", "markets", "net", "office", "operates", "operations", "pay", "real", "standard", "trust".
0.300
additionalagenciesalternativeassistancechangesfamilyfinancialhealthcarehomeindependentinsurancelargestlevellicensedmedicalneedspaidpayphysicalpopulation
SHARED TOKENS (26): "additional", "agencies", "alternative", "assistance", "changes", "family", "financial", "healthcare", "home", "independent", "insurance", "largest", "level", "licensed", "medical", "needs", "paid", "pay", "physical", "population"....
0.300
alternativeamericanamongcannotcaseloadcasescourtcourtsdisputesgenerallegalproceedingspublicrequiredrightsystemthirdtransactionstrust
SHARED TOKENS (19): "alternative", "american", "among", "cannot", "caseload", "cases", "court", "courts", "disputes", "general", "legal", "proceedings", "public", "required", "right", "system", "third", "transactions", "trust".
0.300
accessaidamericanchangescivilconsumerdevelopmenteducationestablishedexpandinggeneralheavilyhistorylargestlow-incomenationalprimaryprogramprotectionpublic
SHARED TOKENS (24): "access", "aid", "american", "changes", "civil", "consumer", "development", "education", "established", "expanding", "general", "heavily", "history", "largest", "low-income", "national", "primary", "program", "protection", "public"....
0.300
adaboisecanyoncitiescombinedcountieshomeidaholargestmeridianmetromountainnampapayettepopulationsectionthirdtreasurevalley
SHARED TOKENS (19): "ada", "boise", "canyon", "cities", "combined", "counties", "home", "idaho", "largest", "meridian", "metro", "mountain", "nampa", "payette", "population", "section", "third", "treasure", "valley".
0.300
Adoption ↗ Q180472 EXACT TITLE
governedlegalreligiousrequiresrights
SHARED TOKENS (5): "governed", "legal", "religious", "requires", "rights". | EXACT TITLE in legal: "Adoption".
0.300
expandedgrouphealthcarehomelicenselicensedneedspersonalphysicalpracticeprofessionalresidentsresponsiblestandardsupportsystemworkers
SHARED TOKENS (17): "expanded", "group", "healthcare", "home", "license", "licensed", "needs", "personal", "physical", "practice", "professional", "residents", "responsible", "standard", "support", "system", "workers".
0.300
administrativeagenciesbodieschangescivilcourtscreatededucationenforcementenvironmentenvironmentalexpandeditselfjudiciallegalorderspublicregulatereviewsector
SHARED TOKENS (21): "administrative", "agencies", "bodies", "changes", "civil", "courts", "created", "education", "enforcement", "environment", "environmental", "expanded", "itself", "judicial", "legal", "orders", "public", "regulate", "review", "sector"....
0.300
americanassistanceassociatedbenefitscannotcommercialcoveringexpansionfederalfinancialforminsurancelargemedicalneedspaidpaypopulationprogramprotection
SHARED TOKENS (25): "american", "assistance", "associated", "benefits", "cannot", "commercial", "covering", "expansion", "federal", "financial", "form", "insurance", "large", "medical", "needs", "paid", "pay", "population", "program", "protection"....
0.300
annualdebtdevelopmententityfinancefinancialfinancingfirmsformgrowthhistoryinstitutionalinvestorsmarketmarketsoperatingoperationsownedpublicrates
SHARED TOKENS (23): "annual", "debt", "development", "entity", "finance", "financial", "financing", "firms", "form", "growth", "history", "institutional", "investors", "market", "markets", "operating", "operations", "owned", "public", "rates"....
0.300
agreementsbenefitschangesemployersemploymentgrouporganizationpayreachregulaterightssafetysecuritysingletrainingwageworkworkers
SHARED TOKENS (18): "agreements", "benefits", "changes", "employers", "employment", "group", "organization", "pay", "reach", "regulate", "rights", "safety", "security", "single", "training", "wage", "work", "workers".
0.300
agriculturalcontractorscourtemployersestablishedfederalindependentlabormembersnationalorganizationpowerrightsectorworkers
SHARED TOKENS (15): "agricultural", "contractors", "court", "employers", "established", "federal", "independent", "labor", "members", "national", "organization", "power", "right", "sector", "workers".
0.300
administrativeassociationcivilformfreedomgroupjusticelegallifeorganizationspersonalphysicalprotectionrightrightssafetysecondsystem
SHARED TOKENS (18): "administrative", "association", "civil", "form", "freedom", "group", "justice", "legal", "life", "organizations", "personal", "physical", "protection", "right", "rights", "safety", "second", "system".
0.300
additionalbenefitscannotchangescourteducationexpandedexpansionfederalhealthcareincomeinsurancelegalmarketmarketsofficepaypopulationprotectionquality
SHARED TOKENS (26): "additional", "benefits", "cannot", "changes", "court", "education", "expanded", "expansion", "federal", "healthcare", "income", "insurance", "legal", "market", "markets", "office", "pay", "population", "protection", "quality"....
0.300
agenciesauthoritycommissioncoverscriminalfederalfinancialindustrylevellistingorganizationsprimaryregulationregulatorysecuritytransactions
SHARED TOKENS (16): "agencies", "authority", "commission", "covers", "criminal", "federal", "financial", "industry", "level", "listing", "organizations", "primary", "regulation", "regulatory", "security", "transactions".
0.300
Civil liberties ↗ Q29556 KW CROSS HIGH
advocateauthoritycivilexpandingfreedomjudiciallifepersonalpowerpropertyprotectionrightrightssecuritywork
SHARED TOKENS (15): "advocate", "authority", "civil", "expanding", "freedom", "judicial", "life", "personal", "power", "property", "protection", "right", "rights", "security", "work".
0.300
assetsbenefitslegalqualitystandard
SHARED TOKENS (5): "assets", "benefits", "legal", "quality", "standard". | EXACT TITLE in senior_services: "Due diligence".
0.300
agreementsconditioncontextcourtemployersemploymentfallsfederalgenerallaborlocalmemberspaypublicrepresentationrequiredrightsectorsecurityset
SHARED TOKENS (21): "agreements", "condition", "context", "court", "employers", "employment", "falls", "federal", "general", "labor", "local", "members", "pay", "public", "representation", "required", "right", "sector", "security", "set"....
0.300
americanassistancebenefitsdepartmenteducationestablishedexpandedfamilyfederalhealthcarehomeinsuranceleadlifemedicalmembersnationalnetofficesprogram
SHARED TOKENS (20): "american", "assistance", "benefits", "department", "education", "established", "expanded", "family", "federal", "healthcare", "home", "insurance", "lead", "life", "medical", "members", "national", "net", "offices", "program".
0.300
americancasescivilcommunitycourtcreatedfallformsfreedomgrouppracticepublicreligiousrequiresrightrightsthird
SHARED TOKENS (17): "american", "cases", "civil", "community", "court", "created", "fall", "forms", "freedom", "group", "practice", "public", "religious", "requires", "right", "rights", "third".
0.300
amongannualchangesclaimscourtsfallfirmgroundsgrouphistorylegaloutsideprogramratesrepresentationsecondsectionthird
SHARED TOKENS (18): "among", "annual", "changes", "claims", "courts", "fall", "firm", "grounds", "group", "history", "legal", "outside", "program", "rates", "representation", "second", "section", "third".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
additionalalongsideamericanassociationcasescivilcorporatecourtscriminaldepartmenteducationfederallegallicensedmattersnationalofficepracticeprofessionalproperty
SHARED TOKENS (25): "additional", "alongside", "american", "association", "cases", "civil", "corporate", "courts", "criminal", "department", "education", "federal", "legal", "licensed", "matters", "national", "office", "practice", "professional", "property"....
0.300
agenciesassistancecitiescommunitycomplexcontinuingelderenvironmentestablishedestatefinancialhomeincomeindependentlargelargestownedpersonalpopulationreal
SHARED TOKENS (24): "agencies", "assistance", "cities", "community", "complex", "continuing", "elder", "environment", "established", "estate", "financial", "home", "income", "independent", "large", "largest", "owned", "personal", "population", "real"....
0.300
addressconsentcourtcriminalestablishedfederalfourthhistorylegallocalphysicalplainpropertyrightssearchweeks
SHARED TOKENS (16): "address", "consent", "court", "criminal", "established", "federal", "fourth", "history", "legal", "local", "physical", "plain", "property", "rights", "search", "weeks".
0.300
accessagreementsattorneycannotcasescommunitydisclosuredisputesemploymenteventsknowledgelegalmaterialpaidprogramrequiredsingle
SHARED TOKENS (17): "access", "agreements", "attorney", "cannot", "cases", "community", "disclosure", "disputes", "employment", "events", "knowledge", "legal", "material", "paid", "program", "required", "single".
0.300
administrativeamericanappealscasescourtcourtscoveringcreateddistrictfederalidahojudicialjurisdictionlargestservewashingtonwestern
SHARED TOKENS (17): "administrative", "american", "appeals", "cases", "court", "courts", "covering", "created", "district", "federal", "idaho", "judicial", "jurisdiction", "largest", "serve", "washington", "western".
0.300
assistancedebtdepartmentdepartmentseducationfamiliesfamilyfederalfoodgrowthincomemedicalnationalpopulationpowerprogrampublicregionalsecuritysingle
SHARED TOKENS (22): "assistance", "debt", "department", "departments", "education", "families", "family", "federal", "food", "growth", "income", "medical", "national", "population", "power", "program", "public", "regional", "security", "single"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedcitiescommercialdevelopmentenvironmentenvironmentalexpansionformgroundsgrowthlandlargeplanningpopulationpropertyprotectionratesspecialsupportzoning
SHARED TOKENS (20): "associated", "cities", "commercial", "development", "environment", "environmental", "expansion", "form", "grounds", "growth", "land", "large", "planning", "population", "property", "protection", "rates", "special", "support", "zoning".
0.300
advocateagreementsamongcasescompetitivecourtscoversemployersfirmindustrylaborlegalmarketmarketssectorsupportsystemworkers
SHARED TOKENS (18): "advocate", "agreements", "among", "cases", "competitive", "courts", "covers", "employers", "firm", "industry", "labor", "legal", "market", "markets", "sector", "support", "system", "workers".
0.300
americancivilcourteducationfederalitselfjurisdictionjusticelargelocalprimaryprotectionrequiresrightrightssection
SHARED TOKENS (16): "american", "civil", "court", "education", "federal", "itself", "jurisdiction", "justice", "large", "local", "primary", "protection", "requires", "right", "rights", "section".
0.300
agenciesalternativeassociatedcasescompetitiveemploymentfirmfirmsindustrylandmarketorganizationpowerpracticeproducesregulationregulatorywork
SHARED TOKENS (18): "agencies", "alternative", "associated", "cases", "competitive", "employment", "firm", "firms", "industry", "land", "market", "organization", "power", "practice", "produces", "regulation", "regulatory", "work".
0.300
Patient advocacy ↗ KW CROSS HIGH
advocacyadvocateconsenteducationemploymentgrouphealthcareindependentmattersmedicalorganizationorganizationspublicregulatoryrepresentationresponsiblerightsstandardssupporttraining
SHARED TOKENS (21): "advocacy", "advocate", "consent", "education", "employment", "group", "healthcare", "independent", "matters", "medical", "organization", "organizations", "public", "regulatory", "representation", "responsible", "rights", "standards", "support", "training"....
0.300
administrativecasesconsentemployersentityfamiliesfamilyfederalgovernsgrouphealthcareinsurancelifemedicalmembersnationalrequiresstandardstitletransactions
SHARED TOKENS (21): "administrative", "cases", "consent", "employers", "entity", "families", "family", "federal", "governs", "group", "healthcare", "insurance", "life", "medical", "members", "national", "requires", "standards", "title", "transactions"....
0.300
coversmedicalneedspracticetraining
SHARED TOKENS (5): "covers", "medical", "needs", "practice", "training". | EXACT TITLE in senior_services: "Nurse practitioner".
0.300
Trademark ↗ Q167270 KW CROSS HIGH
agenciesagreementsassociatedenforcementintellectualjurisdictionlegalofficeownersprimaryproductspropertyprotectionrightssourcesstandards
SHARED TOKENS (16): "agencies", "agreements", "associated", "enforcement", "intellectual", "jurisdiction", "legal", "office", "owners", "primary", "products", "property", "protection", "rights", "sources", "standards".
0.300
consentcreateddepartmenteducationfederalgeneralhealthcaremattersmedicalprimarypublicresponsibleseparatesetsystem
SHARED TOKENS (15): "consent", "created", "department", "education", "federal", "general", "healthcare", "matters", "medical", "primary", "public", "responsible", "separate", "set", "system".
0.300
Foreclosure ↗ Q231710 KW CROSS HIGH
associationattorneycannotcontractorscourtcourtsdebtlegalpayprincipalpropertyrealrightsecuritystatutoryterminationtitletrust
SHARED TOKENS (18): "association", "attorney", "cannot", "contractors", "court", "courts", "debt", "legal", "pay", "principal", "property", "real", "right", "security", "statutory", "termination", "title", "trust".
0.300
associationcorporateentityformgovernedincomelegallicensemedicaloperatingoperationsorganizationownersphysicalprimaryprofessionalrequiredrightssingle
SHARED TOKENS (19): "association", "corporate", "entity", "form", "governed", "income", "legal", "license", "medical", "operating", "operations", "organization", "owners", "physical", "primary", "professional", "required", "rights", "single".
0.300
americanassociationcasescommercialcommunitycontextcreateddevelopmentestatefastest-growingformgovernedgovernsgrowthjurisdictionlandlargelegallevellife
SHARED TOKENS (32): "american", "association", "cases", "commercial", "community", "context", "created", "development", "estate", "fastest-growing", "form", "governed", "governs", "growth", "jurisdiction", "land", "large", "legal", "level", "life"....
0.300
appealscannotcaseschaptercodecourtcourtscreateddistricteffectivefederalitselfjudicialjurisdictionmattersproceedingproceedingssystemwest
SHARED TOKENS (19): "appeals", "cannot", "cases", "chapter", "code", "court", "courts", "created", "district", "effective", "federal", "itself", "judicial", "jurisdiction", "matters", "proceeding", "proceedings", "system", "west".
0.300
chapterclaimscodecourtcourtsdebtfinancialformgeneralincomepaypersonalpowerpropertyprotectionsectionstatutorytitle
SHARED TOKENS (18): "chapter", "claims", "code", "court", "courts", "debt", "financial", "form", "general", "income", "pay", "personal", "power", "property", "protection", "section", "statutory", "title".
0.300
communitydepartmentfederalhealthcarehomelargestmedicalofficeoutsideownedpayprogramreportsecondsectorstandardsystem
SHARED TOKENS (17): "community", "department", "federal", "healthcare", "home", "largest", "medical", "office", "outside", "owned", "pay", "program", "report", "second", "sector", "standard", "system".
0.300
administrativeagenciesannualappealscasescitiescourtcourtscoversdistrictestablishedfederalfinaljurisdictionlargelegalnationalpopulationreviewsecurity
SHARED TOKENS (25): "administrative", "agencies", "annual", "appeals", "cases", "cities", "court", "courts", "covers", "district", "established", "federal", "final", "jurisdiction", "large", "legal", "national", "population", "review", "security"....
0.300
knowledgelegalmigrationnationalorganization
SHARED TOKENS (5): "knowledge", "legal", "migration", "national", "organization". | EXACT TITLE in legal: "Naturalization".
0.300
associationattorneyscasescourtgeneraljurisdictionlegalmembersorganizationsphysicalpracticeprofessionalpublicregulationresponsibleseparateserving
SHARED TOKENS (17): "association", "attorneys", "cases", "court", "general", "jurisdiction", "legal", "members", "organizations", "physical", "practice", "professional", "public", "regulation", "responsible", "separate", "serving".
0.300
casescommercialestatefinancialformgeneralindependentinstitutionalinsurancelandlargelegallifeoutsidepropertyrealrequirementsecuritysystemtitle
SHARED TOKENS (22): "cases", "commercial", "estate", "financial", "form", "general", "independent", "institutional", "insurance", "land", "large", "legal", "life", "outside", "property", "real", "requirement", "security", "system", "title"....
0.300
Plea bargain ↗ Q664736 KW CROSS HIGH
agreementsauthoritycasescivilcourtscriminalfinalformsjudicialjusticelegallocalpracticeprosecutionprosecutorpublicresourcesservesstandards
SHARED TOKENS (19): "agreements", "authority", "cases", "civil", "courts", "criminal", "final", "forms", "judicial", "justice", "legal", "local", "practice", "prosecution", "prosecutor", "public", "resources", "serves", "standards".
0.300
Grand jury ↗ Q1323789 KW CROSS HIGH
casescivilcourtcourtscriminalfocusindependentjurisdictionlargelegalmattersmembersphysicalproceedingsprosecutionpublicrequiredreviewseparateserve
SHARED TOKENS (21): "cases", "civil", "court", "courts", "criminal", "focus", "independent", "jurisdiction", "large", "legal", "matters", "members", "physical", "proceedings", "prosecution", "public", "required", "review", "separate", "serve"....
0.300
administersamericanbenefitscreatedestablishedfederalincomeindependentinsurancelargestlocallow-incomenationalofficeofficesoperatespayprogrampublicregional
SHARED TOKENS (24): "administers", "american", "benefits", "created", "established", "federal", "income", "independent", "insurance", "largest", "local", "low-income", "national", "office", "offices", "operates", "pay", "program", "public", "regional"....
0.300
advocateassistancecommunitycompetitiveemploymentenvironmentexperiencefoodindependentintegrationintellectualleadmedicationneedsprofessionalsupporttransferswork
SHARED TOKENS (18): "advocate", "assistance", "community", "competitive", "employment", "environment", "experience", "food", "independent", "integration", "intellectual", "lead", "medication", "needs", "professional", "support", "transfers", "work".
0.300
accessaddressamericanamongassociationcomplexconstructioneducationemployersestablishedexpansionfederalfocusgrowinghealthcareincomeinsurancelow-incomemedicalpaid
SHARED TOKENS (28): "access", "address", "american", "among", "association", "complex", "construction", "education", "employers", "established", "expansion", "federal", "focus", "growing", "healthcare", "income", "insurance", "low-income", "medical", "paid"....
0.300
legalphysicalrightriverwater
SHARED TOKENS (5): "legal", "physical", "right", "river", "water". | EXACT TITLE in legal: "Water right".
0.300
agenciesauthorityeffectivefoodhealthcareindependentjurisdictionlicensingmarketsofficeproductsregulationregulatoryresponsiblesafetystandards
SHARED TOKENS (16): "agencies", "authority", "effective", "food", "healthcare", "independent", "jurisdiction", "licensing", "markets", "office", "products", "regulation", "regulatory", "responsible", "safety", "standards".
0.300
agenciesassistancecontractorscreateddepartmenteducationemploymentfederalfinancialprincipalrequiresspecialstandardstitletraining
SHARED TOKENS (15): "agencies", "assistance", "contractors", "created", "department", "education", "employment", "federal", "financial", "principal", "requires", "special", "standards", "title", "training".
0.300
developmentfallsfamilygrowthheavilyidahointegrationknowledgelargelevelmedicalpersonalpracticeprimaryprogramspecialtystandardtraininguniversity
SHARED TOKENS (19): "development", "falls", "family", "growth", "heavily", "idaho", "integration", "knowledge", "large", "level", "medical", "personal", "practice", "primary", "program", "specialty", "standard", "training", "university".
0.300
addressclaimsdisclosureemploymentenforcementfinancialinstitutionsorganizationorganizationsprotectionpublicregulatereportresourcessectorterminationthirdwork
SHARED TOKENS (18): "address", "claims", "disclosure", "employment", "enforcement", "financial", "institutions", "organization", "organizations", "protection", "public", "regulate", "report", "resources", "sector", "termination", "third", "work".
0.300
Food security ↗ Q1229911 KW CROSS HIGH
accessagriculturalbeyonddevelopmentfamilyfoodgrowthlandleadlegallevellifememberspopulationprotectionrelationshipsrightsecuritysupplywater
SHARED TOKENS (20): "access", "agricultural", "beyond", "development", "family", "food", "growth", "land", "lead", "legal", "level", "life", "members", "population", "protection", "relationships", "right", "security", "supply", "water".
0.300
accessconditionexpandedfamiliesfinalgeneralhomeinsurancelevellifemedicalneedsphysicalprimaryprofessionalprogramrequiredresourcessystemweeks
SHARED TOKENS (21): "access", "condition", "expanded", "families", "final", "general", "home", "insurance", "level", "life", "medical", "needs", "physical", "primary", "professional", "program", "required", "resources", "system", "weeks"....
0.300
authoritycasescodeconsumercourtcourtsdistrictfederalgovernedgovernsjudicialjurisdictionpropertyprotectionrightssectiontitle
SHARED TOKENS (17): "authority", "cases", "code", "consumer", "court", "courts", "district", "federal", "governed", "governs", "judicial", "jurisdiction", "property", "protection", "rights", "section", "title".
0.300
Paralegal ↗ Q620413 KW CROSS HIGH
administrativeamericananalysisassistanceassociationattorneybodiescasescourtcourtscreateddepartmentseducationentityenvironmentestablishedexperiencefamilyformsintellectual
SHARED TOKENS (45): "administrative", "american", "analysis", "assistance", "association", "attorney", "bodies", "cases", "court", "courts", "created", "departments", "education", "entity", "environment", "established", "experience", "family", "forms", "intellectual"....
0.300
addressannualassistanceassociatedcasesconditiondevelopmentenvironmentaleventsfamilyfinancialformhistoryinjurylargeleadlifemedicalnationalphysical
SHARED TOKENS (23): "address", "annual", "assistance", "associated", "cases", "condition", "development", "environmental", "events", "family", "financial", "form", "history", "injury", "large", "lead", "life", "medical", "national", "physical"....
0.300
agreementscommunityfoodformformsfreedomlegalmaterialnationalorganizationspowerprotectionpublicrightrightssecurityspecial
SHARED TOKENS (17): "agreements", "community", "food", "form", "forms", "freedom", "legal", "material", "national", "organizations", "power", "protection", "public", "right", "rights", "security", "special".
0.300
aidamongcasescourtcreatedestablishedfamiliesfederalhealthcareinsurancelabornationalprogramsecuritysinglesupportsystem
SHARED TOKENS (17): "aid", "among", "cases", "court", "created", "established", "families", "federal", "healthcare", "insurance", "labor", "national", "program", "security", "single", "support", "system".
0.300
adaamericanarchitectureboiseconstructiondepartmentdistrictfederalfinalfirmhomeidaholistingnationalterritorywest
SHARED TOKENS (16): "ada", "american", "architecture", "boise", "construction", "department", "district", "federal", "final", "firm", "home", "idaho", "listing", "national", "territory", "west".
0.300
courtcriminalfederallevellifelocalpolicepropertyprotectionpublicrequirementrequiresrightrightsserve
SHARED TOKENS (15): "court", "criminal", "federal", "level", "life", "local", "police", "property", "protection", "public", "requirement", "requires", "right", "rights", "serve".
🫐 BERRY114 edges
0.280
courtcriminalfourthknowledgelegalpolicepowerpropertyprosecutionrequiredrequirementrightsearchstandard
SHARED TOKENS (14): "court", "criminal", "fourth", "knowledge", "legal", "police", "power", "property", "prosecution", "required", "requirement", "right", "search", "standard".
0.280
Felony ↗ Q178844 EXACT TITLE
additionalcivilcourtland
SHARED TOKENS (4): "additional", "civil", "court", "land". | EXACT TITLE in legal: "Felony".
0.280
amongcriminallegallevel
SHARED TOKENS (4): "among", "criminal", "legal", "level". | EXACT TITLE in legal: "Manslaughter".
0.280
benefitscivilemployersemploymentexplicitlygenerallaborneedspublicrequiresrightsstandardstitleworkers
SHARED TOKENS (14): "benefits", "civil", "employers", "employment", "explicitly", "general", "labor", "needs", "public", "requires", "rights", "standards", "title", "workers".
0.280
americancivilcodedevelopmentenforcementexpandedfamiliesfamilyfederalfinancingnationalrightssectiontitle
SHARED TOKENS (14): "american", "civil", "code", "development", "enforcement", "expanded", "families", "family", "federal", "financing", "national", "rights", "section", "title".
0.280
americanauthoritycivilemploymentfinalhistorylabornationalpowerprotectionpublicregulaterightssection
SHARED TOKENS (14): "american", "authority", "civil", "employment", "final", "history", "labor", "national", "power", "protection", "public", "regulate", "rights", "section".
0.280
communityhomeincomelevel
SHARED TOKENS (4): "community", "home", "income", "level". | EXACT TITLE in senior_services: "Aging in place".
0.280
Due process ↗ Q1068288 KW CROSS HIGH
administrativeagenciesamericanbodiesconditioncourtsjusticelandlegalpowerproceedingsrequirementrightsstatutory
SHARED TOKENS (14): "administrative", "agencies", "american", "bodies", "condition", "courts", "justice", "land", "legal", "power", "proceedings", "requirement", "rights", "statutory".
0.280
agenciesamongchangescommissionenvironmentalfocusgrouplifeorganizationphysicalpopulationpopulationspublicresponsible
SHARED TOKENS (14): "agencies", "among", "changes", "commission", "environmental", "focus", "group", "life", "organization", "physical", "population", "populations", "public", "responsible".
0.280
administrativecannotcivilclaimscommissionemployersemploymentestablishedfederalnationalpracticeproceedingrightssexual
SHARED TOKENS (14): "administrative", "cannot", "civil", "claims", "commission", "employers", "employment", "established", "federal", "national", "practice", "proceeding", "rights", "sexual".
0.280
agenciesauthoritycourtscreatedenvironmentenvironmentalestablishedfederalfinalnationalqualityreportsrequirementrequires
SHARED TOKENS (14): "agencies", "authority", "courts", "created", "environment", "environmental", "established", "federal", "final", "national", "quality", "reports", "requirement", "requires".
0.280
casescontextcourtlegal
SHARED TOKENS (4): "cases", "context", "court", "legal". | EXACT TITLE in senior_services: "Settlement (litigation)".
0.280
Beneficiary ↗ Q2596417 KW CROSS HIGH
aidassetsbenefitscontextcreateddevelopmententityfinanceinsurancelegallifeprimaryprojectstrust
SHARED TOKENS (14): "aid", "assets", "benefits", "context", "created", "development", "entity", "finance", "insurance", "legal", "life", "primary", "projects", "trust".
0.260
Legal guardian ↗ Q157509 KW CROSS HIGH
authoritycannotcourtcriticalfamilylegallifemedicalpersonalprofessionalpropertypublicserve
SHARED TOKENS (13): "authority", "cannot", "court", "critical", "family", "legal", "life", "medical", "personal", "professional", "property", "public", "serve".
0.260
assistanceattorneycasescommunitycourtcriminaldistrictlevelpublicrequirementrequiresrightrights
SHARED TOKENS (13): "assistance", "attorney", "cases", "community", "court", "criminal", "district", "level", "public", "requirement", "requires", "right", "rights".
0.260
Homicide ↗ Q149086 EXACT TITLE
legalrequiressystem
SHARED TOKENS (3): "legal", "requires", "system". | EXACT TITLE in legal: "Homicide".
0.260
Family court ↗ Q82749 KW CROSS HIGH
addresscaseschangescourtcourtscreatedfamilylegalmattersordersrelationshipssupportsystem
SHARED TOKENS (13): "address", "cases", "changes", "court", "courts", "created", "family", "legal", "matters", "orders", "relationships", "support", "system".
0.260
appealscasescivilcourtcourtscoverscriminaldisputesdistrictfederaljudicialjurisdictionresidents
SHARED TOKENS (13): "appeals", "cases", "civil", "court", "courts", "covers", "criminal", "disputes", "district", "federal", "judicial", "jurisdiction", "residents".
0.260
departmentidahopublic
SHARED TOKENS (3): "department", "idaho", "public". | EXACT TITLE in senior_services: "Idaho Department of Health and Welfare".
0.260
Phlebotomy ↗ Q3595842 EXACT TITLE
itselfmedicalremoval
SHARED TOKENS (3): "itself", "medical", "removal". | EXACT TITLE in senior_services: "Phlebotomy".
0.260
cannotcasescourtcriminaldisputesgoodinsurancejusticelegalpaidpublicspecialsystem
SHARED TOKENS (13): "cannot", "cases", "court", "criminal", "disputes", "good", "insurance", "justice", "legal", "paid", "public", "special", "system".
0.260
agenciesassociationcasescivilcourtexpandedfinanceformsfreedomreligiousrightrightsthird
SHARED TOKENS (13): "agencies", "association", "cases", "civil", "court", "expanded", "finance", "forms", "freedom", "religious", "right", "rights", "third".
0.260
addressassistancechangesenvironmentalfederalformownedphysicalprimaryprotectionqualityresourcewater
SHARED TOKENS (13): "address", "assistance", "changes", "environmental", "federal", "form", "owned", "physical", "primary", "protection", "quality", "resource", "water".
0.260
U visa ↗ Q17086349 KW CROSS HIGH
agenciescasescreatedcriminalenforcementfamilymembersphysicalprosecutionprotectionservesetsexual
SHARED TOKENS (13): "agencies", "cases", "created", "criminal", "enforcement", "family", "members", "physical", "prosecution", "protection", "serve", "set", "sexual".
0.260
Labour law ↗ Q628967 KW CROSS HIGH
agenciescasescodecontractorsemployersemploymentjudiciallaborregulatoryrightsstandardsworkworkers
SHARED TOKENS (13): "agencies", "cases", "code", "contractors", "employers", "employment", "judicial", "labor", "regulatory", "rights", "standards", "work", "workers".
0.260
codeemploymentenvironmentformgenerallegalorganizationspersonalphysicalprofessionalrelationshipssexualwork
SHARED TOKENS (13): "code", "employment", "environment", "form", "general", "legal", "organizations", "personal", "physical", "professional", "relationships", "sexual", "work".
0.260
Theft ↗ Q2727213 EXACT TITLE
consentpropertystatutory
SHARED TOKENS (3): "consent", "property", "statutory". | EXACT TITLE in senior_services: "Theft".
0.260
assistancecivilcourt
SHARED TOKENS (3): "assistance", "civil", "court". | EXACT TITLE in senior_services: "Discovery (law)".
0.260
addressfastest-growingfinanceformhealthcareindustryintegrationlargestmedicalpowerproductssectorsystem
SHARED TOKENS (13): "address", "fastest-growing", "finance", "form", "healthcare", "industry", "integration", "largest", "medical", "power", "products", "sector", "system".
0.260
Probation ↗ Q13961 KW CROSS HIGH
communitycontactcourtcourtscriminaljurisdictionorderspaypermitprogramrequiredsetsexual
SHARED TOKENS (13): "community", "contact", "court", "courts", "criminal", "jurisdiction", "orders", "pay", "permit", "program", "required", "set", "sexual".
0.260
Lawsuit ↗ Q697327 KW CROSS HIGH
attorneyscivilclaimscourtcriminaldisputeslegalordersorganizationsproceedingpublicrequiredright
SHARED TOKENS (13): "attorneys", "civil", "claims", "court", "criminal", "disputes", "legal", "orders", "organizations", "proceeding", "public", "required", "right".
0.260
Psychiatry ↗ Q7867 KW CROSS HIGH
americanassociationcommunityemploymenthistoryindustrymattersmedicalnationalorganizationphysicalspecialtyworkers
SHARED TOKENS (13): "american", "association", "community", "employment", "history", "industry", "matters", "medical", "national", "organization", "physical", "specialty", "workers".
0.240
agenciesassistancebenefitscreatedgeneralincomeleveloperationsprogramsecuritytitletrust
SHARED TOKENS (12): "agencies", "assistance", "benefits", "created", "general", "income", "level", "operations", "program", "security", "title", "trust".
0.240
authorityconsentcreateddistrictentitylargelocalpowerprojectspublicsetwater
SHARED TOKENS (12): "authority", "consent", "created", "district", "entity", "large", "local", "power", "projects", "public", "set", "water".
0.240
bodieschangesconditioncriticaleffectiveenvironmentalformlifemedicalsinglesupportsystem
SHARED TOKENS (12): "bodies", "changes", "condition", "critical", "effective", "environmental", "form", "life", "medical", "single", "support", "system".
0.240
agenciesalongsideconsumercontextlifemembersnationalorganizationspopulationpopulationsproductsrates
SHARED TOKENS (12): "agencies", "alongside", "consumer", "context", "life", "members", "national", "organizations", "population", "populations", "products", "rates".
0.240
cannotcompelledcourtcriminalenforcementknowledgepoliceproceedingsprotectionrequiredrightrights
SHARED TOKENS (12): "cannot", "compelled", "court", "criminal", "enforcement", "knowledge", "police", "proceedings", "protection", "required", "right", "rights".
0.240
casescivilconsentcourtenforcementformlegalpolicepropertypublicrightsearch
SHARED TOKENS (12): "cases", "civil", "consent", "court", "enforcement", "form", "legal", "police", "property", "public", "right", "search".
0.240
americanchangescitiesdevelopmentenvironmentalexpansionformsgrowinggrowthpopulationpopulationsresidents
SHARED TOKENS (12): "american", "changes", "cities", "development", "environmental", "expansion", "forms", "growing", "growth", "population", "populations", "residents".
0.240
analysisassociatedcivilcourtscriminaljurisdictionlegalproceedingspropertyrequiressetstatutory
SHARED TOKENS (12): "analysis", "associated", "civil", "courts", "criminal", "jurisdiction", "legal", "proceedings", "property", "requires", "set", "statutory".
0.240
additionalcoversdepartmentemployersfamilylabormedicalpublicwageweeksworkworkers
SHARED TOKENS (12): "additional", "covers", "department", "employers", "family", "labor", "medical", "public", "wage", "weeks", "work", "workers".
0.240
continuingfamiliesfocuslifeneedspopulationpopulationsqualityratesspecialtysupportwork
SHARED TOKENS (12): "continuing", "families", "focus", "life", "needs", "population", "populations", "quality", "rates", "specialty", "support", "work".
0.220
Escrow ↗ Q338451 KW CROSS HIGH
establishedinsuranceobligationspayprimaryprincipalpropertyterminationthirdtransactiontrust
SHARED TOKENS (11): "established", "insurance", "obligations", "pay", "primary", "principal", "property", "termination", "third", "transaction", "trust".
0.220
Trade secret ↗ Q602938 KW CROSS HIGH
agreementsamongassetscommercialcompetitivedisclosureformsintellectuallegallicensedproperty
SHARED TOKENS (11): "agreements", "among", "assets", "commercial", "competitive", "disclosure", "forms", "intellectual", "legal", "licensed", "property".
0.220
Attorney ↗ Q1289214 EXACT TITLE
attorneypower
SHARED TOKENS (2): "attorney", "power". | EXACT TITLE in legal: "Attorney". | EXACT TITLE in senior_services: "Attorney".
0.220
Family law ↗ Q384014 EXACT TITLE
familymatters
SHARED TOKENS (2): "family", "matters". | EXACT TITLE in legal: "Family law".
0.220
associatedcomplexdemandformshomeincomelocalmarketsnationalsetsupply
SHARED TOKENS (11): "associated", "complex", "demand", "forms", "home", "income", "local", "markets", "national", "set", "supply".
0.220
Debtor ↗ Q157470 KW CROSS HIGH
agreementsconsumerdebtentityfamilyfirmlegalpaidpaypersonalrequires
SHARED TOKENS (11): "agreements", "consumer", "debt", "entity", "family", "firm", "legal", "paid", "pay", "personal", "requires".
0.220
amongcommissiondistrictinvestorslegaloversightownedpublicregulationregulatoryserves
SHARED TOKENS (11): "among", "commission", "district", "investors", "legal", "oversight", "owned", "public", "regulation", "regulatory", "serves".
0.220
associateddepartmentsenvironmentfinancialinjurylow-incomenationalorganizationspropertyratesstreet
SHARED TOKENS (11): "associated", "departments", "environment", "financial", "injury", "low-income", "national", "organizations", "property", "rates", "street".
0.220
Easement ↗ Q448405 KW CROSS HIGH
accessamongitselflandownedpropertypublicrealrightrightsthird
SHARED TOKENS (11): "access", "among", "itself", "land", "owned", "property", "public", "real", "right", "rights", "third".
0.220
Loneliness ↗ Q223270 KW CROSS HIGH
amongcommunityexperiencefocusgeneralgrouplifemedicalphysicalrelationshipsreligious
SHARED TOKENS (11): "among", "community", "experience", "focus", "general", "group", "life", "medical", "physical", "relationships", "religious".
0.220
civilcourtscriminalformslandlegalpowerresponsiblestandardsystemwater
SHARED TOKENS (11): "civil", "courts", "criminal", "forms", "land", "legal", "power", "responsible", "standard", "system", "water".
0.200
accessattorneyelderfinancialformhomepowerpropertyresourcessupport
SHARED TOKENS (10): "access", "attorney", "elder", "financial", "form", "home", "power", "property", "resources", "support".
0.200
Expungement ↗ Q2352928 KW CROSS HIGH
criminalenforcementfederalgeneraljurisdictionlegalproceedingspublicrecordsreview
SHARED TOKENS (10): "criminal", "enforcement", "federal", "general", "jurisdiction", "legal", "proceedings", "public", "records", "review".
0.200
additionalcasescourtcriminalemployershistorynationalpolicerecordsresulting
SHARED TOKENS (10): "additional", "cases", "court", "criminal", "employers", "history", "national", "police", "records", "resulting".
0.200
Deed ↗ Q705914 KW CROSS HIGH
associatedattorneylegalpracticepropertyrightrightsspecialtythirdtitle
SHARED TOKENS (10): "associated", "attorney", "legal", "practice", "property", "right", "rights", "specialty", "third", "title".
0.200
Bail ↗ Q162351 KW CROSS HIGH
additionalcasescourtcriminalformjudicialpolicepropertyrequiredset
SHARED TOKENS (10): "additional", "cases", "court", "criminal", "form", "judicial", "police", "property", "required", "set".
0.200
americancontinuinghealthcarehomeidahonetworkoperatesoperatingsupportsystem
SHARED TOKENS (10): "american", "continuing", "healthcare", "home", "idaho", "network", "operates", "operating", "support", "system".
0.200
Trial court ↗ Q3125101 KW CROSS HIGH
appealsauthoritycasescourtcourtsestablishedjurisdictionmatterspowerreview
SHARED TOKENS (10): "appeals", "authority", "cases", "court", "courts", "established", "jurisdiction", "matters", "power", "review".
0.200
subdivision
EXACT TITLE in legal: "Subdivision".
0.200
communityexperiencefamilyhealthcaremedicalphysicalprofessionalpublictrainingwork
SHARED TOKENS (10): "community", "experience", "family", "healthcare", "medical", "physical", "professional", "public", "training", "work".
0.200
NNN lease ↗ Q6954788 KW CROSS HIGH
commercialestateinsurancemaintenancenetpaidpropertyrealresponsiblesingle
SHARED TOKENS (10): "commercial", "estate", "insurance", "maintenance", "net", "paid", "property", "real", "responsible", "single".
0.200
EXACT TITLE in senior_services: "Rehabilitation".
0.200
judiciallargepersonalpracticeproductsregulateregulationreligioussetsystem
SHARED TOKENS (10): "judicial", "large", "personal", "practice", "products", "regulate", "regulation", "religious", "set", "system".
0.200
americanassociationfourthidaholaborlifeownerspaidservingwestern
SHARED TOKENS (10): "american", "association", "fourth", "idaho", "labor", "life", "owners", "paid", "serving", "western".
0.200
Will ↗ Q1498271 EXACT TITLE
EXACT TITLE in legal: "Will". | EXACT TITLE in senior_services: "Will".
0.200
assistancedemandgeneralgroupinjurylifemedicalneedsqualityright
SHARED TOKENS (10): "assistance", "demand", "general", "group", "injury", "life", "medical", "needs", "quality", "right".
0.200
Paternity ↗ Q16881001 EXACT TITLE
childhousepaternitytelevision
EXACT TITLE in legal: "Paternity".
0.200
Road transport ↗ KW CROSS HIGH
developmentfoodformslargelicensinglocalsafetyseparatespecialstandard
SHARED TOKENS (10): "development", "food", "forms", "large", "licensing", "local", "safety", "separate", "special", "standard".
0.200
cannotcasescourtcourtsformmaterialordersrealstandardsupport
SHARED TOKENS (10): "cannot", "cases", "court", "courts", "form", "material", "orders", "real", "standard", "support".
0.180
Tort ↗ Q158970 KW CROSS HIGH
civilcodecriminalestablishedlegalobligationsprosecutionresultingseparate
SHARED TOKENS (9): "civil", "code", "criminal", "established", "legal", "obligations", "prosecution", "resulting", "separate".
0.180
Magistrate ↗ Q4594605 KW CROSS HIGH
administerscasescivilcourtcriminaljudiciallocalmattersresponsible
SHARED TOKENS (9): "administers", "cases", "civil", "court", "criminal", "judicial", "local", "matters", "responsible".
0.180
Drug court ↗ Q5308883 KW CROSS HIGH
addresscombinedcourtcourtscriminalenforcementprosecutionpublicwork
SHARED TOKENS (9): "address", "combined", "court", "courts", "criminal", "enforcement", "prosecution", "public", "work".
0.180
Damages ↗ Q308922 KW CROSS HIGH
formgeneralinjurylegalmedicalpaidphysicalpropertyspecial
SHARED TOKENS (9): "form", "general", "injury", "legal", "medical", "paid", "physical", "property", "special".
0.180
Wage theft ↗ Q7959502 KW CROSS HIGH
amongannualbenefitscontractorsemployersindependentpaywagework
SHARED TOKENS (9): "among", "annual", "benefits", "contractors", "employers", "independent", "pay", "wage", "work".
0.180
Intestacy ↗ Q1188571 KW CROSS HIGH
conditionestatefamilyformsjurisdictionmemberspropertyresultingstatutory
SHARED TOKENS (9): "condition", "estate", "family", "forms", "jurisdiction", "members", "property", "resulting", "statutory".
0.180
combinedhistorylevelpopulationpopulationsprojectsratesreachsingle
SHARED TOKENS (9): "combined", "history", "level", "population", "populations", "projects", "rates", "reach", "single".
0.180
addresscivilcommercialgovernedlegalpropertyrealrequiredrights
SHARED TOKENS (9): "address", "civil", "commercial", "governed", "legal", "property", "real", "required", "rights".
0.170
idahooffice
SHARED TOKENS (2): "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.160
Alimony ↗ Q368305 KW CROSS HIGH
agreementsfamilyfinanciallegalmaintenancemaritalrequiredsupport
SHARED TOKENS (8): "agreements", "family", "financial", "legal", "maintenance", "marital", "required", "support".
0.160
Star, Idaho ↗ KW CROSS HIGH
adaboisecanyondistrictgrowingidahopopulationwest
SHARED TOKENS (8): "ada", "boise", "canyon", "district", "growing", "idaho", "population", "west".
0.160
administrativecourtfederallegalofficeproceedingsremovalreview
SHARED TOKENS (8): "administrative", "court", "federal", "legal", "office", "proceedings", "removal", "review".
0.160
advocateamericanattorneyscivilcriminallegalmatterspublic
SHARED TOKENS (8): "advocate", "american", "attorneys", "civil", "criminal", "legal", "matters", "public".
0.160
attorneyattorneyscourteffectivelegalprofessionalrepresentationright
SHARED TOKENS (8): "attorney", "attorneys", "court", "effective", "legal", "professional", "representation", "right".
0.160
americanemploymentpermitprotectionrightsecondsupportwork
SHARED TOKENS (8): "american", "employment", "permit", "protection", "right", "second", "support", "work".
0.160
communitycontinuingindependentlevellifeneedsresidentssingle
SHARED TOKENS (8): "community", "continuing", "independent", "level", "life", "needs", "residents", "single".
0.140
collegeeducationgenerallevelmedicalprofessionaltraining
SHARED TOKENS (7): "college", "education", "general", "level", "medical", "professional", "training".
0.140
Sex offender ↗ Q5659979 KW CROSS HIGH
civilcontinuingjurisdictionlegalpublicsexualstatutory
SHARED TOKENS (7): "civil", "continuing", "jurisdiction", "legal", "public", "sexual", "statutory".
0.140
communitycomplexdepartmentsfamiliesintellectualprofessionalwork
SHARED TOKENS (7): "community", "complex", "departments", "families", "intellectual", "professional", "work".
0.140
Criminal law ↗ Q146491 KW CROSS HIGH
civilcommissioncriminalestablishedjurisdictionpropertysafety
SHARED TOKENS (7): "civil", "commission", "criminal", "established", "jurisdiction", "property", "safety".
0.140
Discrimination ↗ Q169207 KW CROSS HIGH
groupinstitutionslegalmembersreligiousrightssexual
SHARED TOKENS (7): "group", "institutions", "legal", "members", "religious", "rights", "sexual".
0.140
associationhealthcarehomeorganizationprofessionalqualityspecialty
SHARED TOKENS (7): "association", "healthcare", "home", "organization", "professional", "quality", "specialty".
0.140
demandformmedicalneedsnetworkpublictechnology
SHARED TOKENS (7): "demand", "form", "medical", "needs", "network", "public", "technology".
0.140
agriculturalamericanlegalrightrightssystemwater
SHARED TOKENS (7): "agricultural", "american", "legal", "right", "rights", "system", "water".
0.140
Injunction ↗ Q6495575 KW CROSS HIGH
civilcourtcourtscriminalformlegalspecial
SHARED TOKENS (7): "civil", "court", "courts", "criminal", "form", "legal", "special".
0.140
amongexplicitlyformgroupleadmaritalmarket
SHARED TOKENS (7): "among", "explicitly", "form", "group", "lead", "marital", "market".
0.140
additionalcontinuingeducationmedicalpracticeprofessionaltraining
SHARED TOKENS (7): "additional", "continuing", "education", "medical", "practice", "professional", "training".
0.140
chaptercodefederalformgovernssectiontitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "governs", "section", "title".
0.120
amonglandpropertyrightssystemwater
SHARED TOKENS (6): "among", "land", "property", "rights", "system", "water".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboisefastest-growingidahopopulation
SHARED TOKENS (6): "ada", "additional", "boise", "fastest-growing", "idaho", "population".
0.120
Summons ↗ Q708245 KW CROSS HIGH
administrativecourtformjudiciallegalproceedings
SHARED TOKENS (6): "administrative", "court", "form", "judicial", "legal", "proceedings".
0.120
Wrongful dismissal ↗ KW CROSS HIGH
employmentjurisdictionlegalpublicrightstermination
SHARED TOKENS (6): "employment", "jurisdiction", "legal", "public", "rights", "termination".
0.120
Parole ↗ Q5357120 KW CROSS HIGH
additionalassociatedformoutsideservingsystem
SHARED TOKENS (6): "additional", "associated", "form", "outside", "serving", "system".
0.120
Legal ethics ↗ Q3655952 KW CROSS HIGH
developmentitselflegalmemberspracticeprofessional
SHARED TOKENS (6): "development", "itself", "legal", "members", "practice", "professional".
0.120
Deposition ↗ Q1174534 KW CROSS HIGH
authoritycourtoutsidepowerremovaluniversity
SHARED TOKENS (6): "authority", "court", "outside", "power", "removal", "university".
0.120
formpersonalproductspropertypublicresponsible
SHARED TOKENS (6): "form", "personal", "products", "property", "public", "responsible".
0.120
entitylegalownedownersseparatework
SHARED TOKENS (6): "entity", "legal", "owned", "owners", "separate", "work".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
authorityemploymentpayrightswage
SHARED TOKENS (5): "authority", "employment", "pay", "rights", "wage".
0.100
accesscontactcourtmattersrights
SHARED TOKENS (5): "access", "contact", "court", "matters", "rights".
0.100
codecollectioncourtdebtsection
SHARED TOKENS (5): "code", "collection", "court", "debt", "section".
0.100
civillegalpaidresultingwork
SHARED TOKENS (5): "civil", "legal", "paid", "resulting", "work".
0.100
Legal clinic ↗ Q1351667 KW CROSS HIGH
aidexperiencelegalprogramwork
SHARED TOKENS (5): "aid", "experience", "legal", "program", "work".
◈ Frequently Asked Questions
Legal × Senior Services — Treasure Valley
HAIKU · HIGH GATE
How do advance healthcare directives relate to senior services planning in Boise?
Advance healthcare directives are legal documents that allow seniors in Boise to designate healthcare preferences before incapacity, which senior service providers in the Treasure Valley use to ensure compliance with clients' wishes. Legal counsel familiar with Idaho law helps seniors execute these directives to coordinate with medical decisions made by senior services agencies operating in Ada County.
What probate issues commonly arise for seniors in the Treasure Valley?
Idaho probate law requires that estates of deceased seniors in Nampa, Boise, and surrounding Treasure Valley areas pass through the Idaho Supreme Court system or alternative processes, making legal guidance critical for senior services providers managing end-of-life planning. Senior services organizations often refer clients to attorneys who specialize in Idaho probate to prevent disputes among family members and preserve assets.
How does the Americans with Disabilities Act affect senior services legal obligations in Ada County?
Senior services providers operating in Boise and Ada County must comply with the Americans with Disabilities Act of 1990 by ensuring physical accessibility and reasonable accommodations for disabled seniors. Legal requirements under the ADA influence facility design, staffing protocols, and service delivery that senior services organizations in the Treasure Valley must implement or face litigation.
Why do seniors in the Treasure Valley need legal protection against identity theft?
Idaho seniors are vulnerable to identity theft, which requires legal remedies through Idaho criminal statutes and civil recovery processes available through Boise-area attorneys. Senior services agencies in the Treasure Valley educate clients about fraud prevention and coordinate with legal professionals to restore stolen identities and recover damages.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Legal × Senior Services 23 QID bridges 303 edges 8,721 ext links 2026-07-17 21:49:38 UTC 5fa25378084ceb4c
Legal corridor ↗ Senior Services corridor ↗ Senior Services × Legal ↗ boisestandard.org/standard ↗
Parent Corridors
Legal × All Other Verticals