—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Wedding Events ↔ relates to ↔ Substance Use Recovery

16 Wikipedia bridge articles confirmed in both vertical ledgers. 317 deterministic cross-vertical edges. 8,485 external source links harvested. Every edge provenance-stamped. Every claim auditable.

16 QID Bridge Articles
317 Cross Edges
8,485 External Sources
358 Wikipedia Articles
16 🌲 Evergreen
235 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Wedding Events
× Substance Use Recovery
QID Bridge Articles
16
confirmed Wikipedia overlap
Total Cross Edges
317
External Sources Harvested
8,485
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise metropolitan area
score: 1.0000  ·  type: exact_title_cross  ·  16 shared tokens
QID Bridge Titles (16)
Boise metropolitan areaTreasure ValleyBoise, IdahoContinuing educationBoise State UniversityIdaho State PoliceIdaho Department of Health and WelfareMergers and acquisitionsPrivate equityNonprofit organizationNampa, IdahoAda County, IdahoCanyon County, IdahoCaldwell, IdahoMeridian, IdahoProfessional certification
Shared Semantics (20 tokens)
idahoboisemetropolitanpopulationpubliccapitaladacanyonhomecollegebusinesslargestmeridiannampatreasurevalleylocalratheruniversitydepartment
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:13:29 UTC
Content Hash
fdc9707613c8706d
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
16 BRIDGES
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (16): "ada", "boise", "canyon", "combined", "counties", "home", "idaho", "largest", "meridian", "metropolitan", "nampa", "payette", "percent", "population", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise metropolitan area".
adaboisecanyoncombinedcountieshomeidaholargestmeridianmetropolitannampapayettepercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (15): "association", "boise", "historically", "idaho", "local", "lower", "metropolitan", "opportunities", "payette", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in wedding_events: "Treasure Valley". | EXACT TITLE in substance_use_recovery: "Treasure Valley".
associationboisehistoricallyidaholocallowermetropolitanopportunitiespayetteregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in wedding_events (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (15): "ada", "annual", "block", "boise", "capital", "counties", "employers", "home", "idaho", "major", "metropolitan", "population", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualblockboisecapitalcountiesemployershomeidahomajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (38): "academic", "activities", "age", "agencies", "beyond", "college", "continuing", "curriculum", "degree", "development", "different", "division", "economic", "education", "formal", "forms", "frequently", "general", "government", "institutional".... | EXACT TITLE in wedding_events: "Continuing education". | EXACT TITLE in substance_use_recovery: "Continuing education".
academicactivitiesageagenciesbeyondcollegecontinuingcurriculumdegreedevelopmentdifferentdivisioneconomiceducationformalformsfrequentlygeneralgovernmentinstitutionalintendedleastlifeoperationprofessionalprogramsprovisionratherrevenueschool+8
t programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
History In the United Kingdom, Oxford University's Department for Continuing Education was founded in 1878, and the Institute of Continuing Education of Cambridge University dates back to 1873. In the United States, the Chautauqua Institution, originally the Chautauqua Lake Sunday School Assembly, was founded in 1874 "as an educational experiment in out-of-school, vacation learning. It was successful and broadened almost immediately beyond courses for Sunday school teachers to include academic subjects, music, art and physical education." Harvard University traces its origins in continuing education to 1835 when John Lowell Jr. established the Lowell Institute with a mission to provide free public lectures in Boston. In 1909, then-Harvard President A. Lawrence Lowell, who was also a trustee of the Lowell Institute, expanded plans to offer Lowell Institute public courses directly with Harvard. In 1910, Lowell formally established the Havard Extension School, then referred to as the Commission on Extension Courses. The Harvard Extension School now operates under the Faculty of Arts and Sciences and is one of the 13 degree-granting schools that make up Harvard University. The School has remained in continuous operation since 1910. Cornell University was among higher education institutions that began offering university-based continuing education, primarily to teachers, through extension courses in the 1870s. As noted in the Cornell Era of February 16, 1877, the university offered a "Tour of the Great Lakes" program for "teachers and others" under the direction of Professor Theodore B. Comstock, head of Cornell's department of geology. The University of Wisconsin–Madison began its continuing education program in 1907. The New School for Social Research, founded in 1919, was initially devoted to adult education. In 1969, Empire State College, a unit of the State University of New York, was the first institution in the US to exclusively focus on providing higher education to adult learners. In 1976 the University of Florida created its own Division of Continuing Education and most courses were offered on evenings or weekends to accommodate the schedules of working students. The method of delivery of continuing education can include traditional types of classroom lectures and laboratories.
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (22): "activity", "among", "arts", "boise", "business", "classified", "college", "compete", "conference", "division", "education", "health", "idaho", "independent", "master", "program", "programs", "public", "reported", "research".... | EXACT TITLE in wedding_events: "Boise State University". | EXACT TITLE in substance_use_recovery: "Boise State University".
activityamongartsboisebusinessclassifiedcollegecompeteconferencedivisioneducationhealthidahoindependentmasterprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho State Police
Q5987459 EXACT TITLE 0.960
QID OVERLAP: Q5987459 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (13): "appropriate", "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "present", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
appropriatecreatedcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepresentpublicstatewide
s the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Other duties The Idaho State Police has two regional communications centers staffed with dispatchers who provide support to officers in the field. The Idaho State Police is tasked with the physical protection of the governor of the state as well as other dignitaries who may need protection. Rank structure See also List of law enforcement agencies in Idaho State police State patrol Highway patrol References External links Official ISP website
I
Q30253346 EXACT TITLE 0.800
QID OVERLAP: Q30253346 in wedding_events (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare".
departmenthealthidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (38): "acquisition", "activity", "business", "capital", "central", "combined", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "effects", "federal", "governed", "government", "law", "legal", "management"....
acquisitionactivitybusinesscapitalcentralcombinedconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteffectsfederalgovernedgovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershippositionpotentialregulatoryrequirerequires+8
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (26): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "financial", "financing", "general", "investment", "limited", "long-term", "management", "operational", "ownership", "private", "private-equity", "products"....
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancialfinancinggeneralinvestmentlimitedlong-termmanagementoperationalownershipprivateprivate-equityproductspublicratherrolespecializedstrategiesstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
N
Q163740 QID OVERLAP 0.800
QID OVERLAP: Q163740 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (21): "business", "community", "further", "local", "mission", "nonprofit", "operated", "operates", "operations", "organization", "person", "private", "program", "public", "rather", "revenue", "schools", "seeks", "social", "status"....
businesscommunityfurtherlocalmissionnonprofitoperatedoperatesoperationsorganizationpersonprivateprogrampublicratherrevenueschoolsseekssocialstatussubject
A nonprofit organization (NPO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Management Most nonprofits have staff that work for the organization, possibly using volunteers to perform the nonprofit's services under the direction of the paid staff. Nonprofits must be careful to balance the salaries paid to staff against the money paid to provide services to the nonprofit's beneficiaries. Organizations whose salary expenses are too high relative to their program expenses may face regulatory scrutiny. Some have the misconception that nonprofit organizations may not make a profit. Although the goal of nonprofits is not specifically to maximize profits, they still have to operate as a fiscally responsible business. They must manage their income (grants, donations, and income from services) and expenses so as to remain a fiscally viable entity. Nonprofits have the responsibility of focusing on being professional and financially responsible, replacing self-interest and profit motive with mission motive. Though nonprofits are managed differently from for-profit businesses, they have felt pressure to be more businesslike. To combat private and public business growth in the public service industry, some nonprofits have modeled their business management and mission, shifting their reason of existing to establish sustainability and growth. Setting effective missions is a key for the successful management of nonprofit organizations. There are three important conditions for effective mission: opportunity, competence, and commitment. One way of managing the sustainability of nonprofit organizations is to establish strong relations with donor groups. This requires a donor marketing strategy, something many nonprofits lack. Nonprofit organizations need to motivate staff, maintain and communicate a vision, set a strategic direction, manage change effectively, and provide a safe working environment for employees, volunteers, and visitors.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncollegehomeidahomeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "home", "idaho", "largest", "local", "metropolitan", "population", "private".
adaboisecapitaldistricthomeidaholargestlocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "largest", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidahometropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "population".
adaamongboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
P
Q16023913 QID OVERLAP 0.620
QID OVERLAP: Q16023913 in wedding_events (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (6): "certification", "educational", "job", "person", "professional", "public".
certificationeducationaljobpersonprofessionalpublic
Professional certification, trade certification, or professional designation, often called simply certification or qualification, is a designation earned by a person to assure qualification to perform a job or task.
A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
Delivering an assessment based on industry knowledge that is independent from training courses or course providers Granting a time-limited credential to anyone who meets the assessment standards The Institute for Credentialing Excellence (ICE) is a U.S.-based organization that sets standards for the accreditation of personnel certification and certificate programs based on the Standards for Educational and Psychological Testing, a joint publication of the American Educational Research Association (AERA), the American Psychological Association (APA), and the National Council on Measurement in Education (NCME).
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
301 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP301 edges
🌿 BRANCH235 edges
0.550
boisecenterdistrictexpansiongroupsidaholargestmeetingoperatingspace
SHARED TOKENS (10): "boise", "center", "district", "expansion", "groups", "idaho", "largest", "meeting", "operating", "space". | URL->A (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.500
alcoholbusinesscostenvironmentfinancialgrouphouseindependentlatermodeloperatingorganizationresidentsrulessystemtreatment
SHARED TOKENS (16): "alcohol", "business", "cost", "environment", "financial", "group", "house", "independent", "later", "model", "operating", "organization", "residents", "rules", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
agenciesappropriateauthoritybehaviordepartmentsdirectlyeligibilityemergencyemployedexperiencefunctiongovernedgovernmenthiringhousingindividualleastlegallicenseslocal
SHARED TOKENS (39): "agencies", "appropriate", "authority", "behavior", "departments", "directly", "eligibility", "emergency", "employed", "experience", "function", "governed", "government", "hiring", "housing", "individual", "least", "legal", "licenses", "local".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Idaho ↗ Q1221 EXACT TITLE
approximatelyaroundboisecapitalcontainsdistinctearlyidaholargestmethodsnationalofficialpeoplepopulationproductsrestrictedseparatesmallsuppliestechnology
SHARED TOKENS (23): "approximately", "around", "boise", "capital", "contains", "distinct", "early", "idaho", "largest", "methods", "national", "official", "people", "population", "products", "restricted", "separate", "small", "supplies", "technology".... | EXACT TITLE in wedding_events: "Idaho". | EXACT TITLE in substance_use_recovery: "Idaho".
0.500
Kitchen ↗ Q43164 EXACT TITLE
commercialcompletedesigndevelopededucationalfacilitiesfoodfoundfunctionshealthlawmarketmodernpreparationpublicpublic-healthrelatedrequirementsresidentialsmall
SHARED TOKENS (22): "commercial", "complete", "design", "developed", "educational", "facilities", "food", "found", "functions", "health", "law", "market", "modern", "preparation", "public", "public-health", "related", "requirements", "residential", "small".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
applycapacityconsenteffectemergencyfoundintendedlawlegalmedicalneedoperatepeopleprofessionalprofessionalsprotectionrequiresrightssystemsystems
SHARED TOKENS (21): "apply", "capacity", "consent", "effect", "emergency", "found", "intended", "law", "legal", "medical", "need", "operate", "people", "professional", "professionals", "protection", "requires", "rights", "system", "systems".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
applicationbuildingbusinessclientcommunicationcoordinatingcorporatedesigndevelopmentdifferentemergencyenvironmentformalfrequentlygroupsidentifyingindustryknowledgelogisticsmanagement
SHARED TOKENS (38): "application", "building", "business", "client", "communication", "coordinating", "corporate", "design", "development", "different", "emergency", "environment", "formal", "frequently", "groups", "identifying", "industry", "knowledge", "logistics", "management".... | EXACT TITLE in wedding_events: "Event management".
0.500
Food safety ↗ Q909821 EXACT TITLE
affectscannotcertificationconsumerconsumerscreatesdescribingdevelopeddisciplineenforcementfoodhandlinghealthindustrymanagementmarketorganizationpersonpoliciespotential
SHARED TOKENS (30): "affects", "cannot", "certification", "consumer", "consumers", "creates", "describing", "developed", "discipline", "enforcement", "food", "handling", "health", "industry", "management", "market", "organization", "person", "policies", "potential".... | EXACT TITLE in wedding_events: "Food safety".
0.500
Commissary ↗ Q5152616 EXACT TITLE
administrativebuildingcontextequivalentfinancialgovernmentnationalofficeofficialorganizationpolicestandardsuppliestermstitleuses
SHARED TOKENS (16): "administrative", "building", "context", "equivalent", "financial", "government", "national", "office", "official", "organization", "police", "standard", "supplies", "terms", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
analysisapplicationbehaviorcommunityconsequencescontroleducationaleffectfamilyframeworkhealthlargestmanagementmodelplanproceduresproduceprogramregulationsrules
SHARED TOKENS (23): "analysis", "application", "behavior", "community", "consequences", "control", "educational", "effect", "family", "framework", "health", "largest", "management", "model", "plan", "procedures", "produce", "program", "regulations", "rules".... | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbuiltcourtsdesignedearlyformalhistoryholdinglargestlatermodernpeoplepersonprimaryprivatepublicspace
SHARED TOKENS (19): "annual", "building", "buildings", "built", "courts", "designed", "early", "formal", "history", "holding", "largest", "later", "modern", "people", "person", "primary", "private", "public", "space". | EXACT TITLE in wedding_events: "Ballroom".
0.500
activityaffectedagainstalcoholamongcentralclassifiedcontainingcontainsdependencedistincteffectsgrouphealthincreasedindustryleadlegallong-termnews
SHARED TOKENS (28): "activity", "affected", "against", "alcohol", "among", "central", "classified", "containing", "contains", "dependence", "distinct", "effects", "group", "health", "increased", "industry", "lead", "legal", "long-term", "news".... | EXACT TITLE in wedding_events: "Alcoholic beverage".
0.500
activityaffectsalreadyamongapprovedchangesclassificationcontrolleddifferenteffecteffectsfullfurtherhealthhistoryimportantincreaselistmedicalorganization
SHARED TOKENS (27): "activity", "affects", "already", "among", "approved", "changes", "classification", "controlled", "different", "effect", "effects", "full", "further", "health", "history", "important", "increase", "list", "medical", "organization".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
categorycreatedevelopedeconomichumanindividualinformationlawlegallimitedlowermodernownershippeopleplaceprimaryrightssystemsthemthough
SHARED TOKENS (20): "category", "create", "developed", "economic", "human", "individual", "information", "law", "legal", "limited", "lower", "modern", "ownership", "people", "place", "primary", "rights", "systems", "them", "though". | EXACT TITLE in wedding_events: "Intellectual property".
0.500
appropriatebehaviorbeyondcomplianceenvironmentevidenceformformsgroupidentificationidentifiedinfluenceinformationleadmarketingneedneedsoutsidepeerpeople
SHARED TOKENS (29): "appropriate", "behavior", "beyond", "compliance", "environment", "evidence", "form", "forms", "group", "identification", "identified", "influence", "information", "lead", "marketing", "need", "needs", "outside", "peer", "people".... | EXACT TITLE in wedding_events: "Social influence".
0.500
ageamongcapturechangescombinescommunicationconditionsdatadesigneddifferentdigitalhealthhistoryincreasinginformationlong-termmeansmedicalmultipleneed
SHARED TOKENS (35): "age", "among", "capture", "changes", "combines", "communication", "conditions", "data", "designed", "different", "digital", "health", "history", "increasing", "information", "long-term", "means", "medical", "multiple", "need".... | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
administrationagenciesapplicationclassificationcomprehensivecontrolcontrolledcreatedcriteriadeterminedistributionenforcementestablishingfederalfoodlawmedicalnationalpolicypossession
SHARED TOKENS (29): "administration", "agencies", "application", "classification", "comprehensive", "control", "controlled", "created", "criteria", "determine", "distribution", "enforcement", "establishing", "federal", "food", "law", "medical", "national", "policy", "possession".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
againstageamongbroadercontextcontrolcreatedirectdocumentationearlyestablishedexperienceexperiencesfamilyfinancialformshealthhomelegallylife
SHARED TOKENS (37): "against", "age", "among", "broader", "context", "control", "create", "direct", "documentation", "early", "established", "experience", "experiences", "family", "financial", "forms", "health", "home", "legally", "life".... | EXACT TITLE in substance_use_recovery: "Domestic violence".
0.500
Social work ↗ Q205398 EXACT TITLE
academicadministrationagenciesartsbecomecommunitiescommunitydevelopeddevelopmentdirectlydisciplineeducationeffectsfamiliesfamilyfunctioninggovernmentgroupgroupshealth
SHARED TOKENS (42): "academic", "administration", "agencies", "arts", "become", "communities", "community", "developed", "development", "directly", "discipline", "education", "effects", "families", "family", "functioning", "government", "group", "groups", "health".... | EXACT TITLE in substance_use_recovery: "Social work".
0.500
activityamongcampusclassifiedfallsidahoisumeridianpercentprogramspublicresearchstudentstwinuniversity
SHARED TOKENS (15): "activity", "among", "campus", "classified", "falls", "idaho", "isu", "meridian", "percent", "programs", "public", "research", "students", "twin", "university". | EXACT TITLE in wedding_events: "Idaho State University". | EXACT TITLE in substance_use_recovery: "Idaho State University".
0.500
administrationcommunitycontrolledcoordinatingdepartmentdistributionenforcementestablishedfederalgovernmentinvolvinglawleadnationaloperationsprotectionratherreportsuses
SHARED TOKENS (19): "administration", "community", "controlled", "coordinating", "department", "distribution", "enforcement", "established", "federal", "government", "involving", "law", "lead", "national", "operations", "protection", "rather", "reports", "uses". | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
0.500
Marketing ↗ Q39809 EXACT TITLE
advertisingaffectedassociationbusinessconcerningconsumerscontractedcreatingdestinationdirectlyenvironmentfoodgovernmentindustrymanagementmarketmarketingmediamethodsplanning
SHARED TOKENS (29): "advertising", "affected", "association", "business", "concerning", "consumers", "contracted", "creating", "destination", "directly", "environment", "food", "government", "industry", "management", "market", "marketing", "media", "methods", "planning".... | EXACT TITLE in wedding_events: "Marketing". | EXACT TITLE in substance_use_recovery: "Marketing".
0.500
Methadone ↗ Q179996 EXACT TITLE
amongapproveddailydevelopedeffecteffectsfrequentlyfunctionhealthinvolvinglifelistlong-termmaintenancemanagementorganizationpeoplerapidriskssingle
SHARED TOKENS (22): "among", "approved", "daily", "developed", "effect", "effects", "frequently", "function", "health", "involving", "life", "list", "long-term", "maintenance", "management", "organization", "people", "rapid", "risks", "single".... | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Drug court ↗ Q5308883 EXACT TITLE
addresscombinedcommunitiescourtsdriversenforcementhealthlawlong-termmodelprocesspublicsocialspecializedtreatmentwork
SHARED TOKENS (16): "address", "combined", "communities", "courts", "drivers", "enforcement", "health", "law", "long-term", "model", "process", "public", "social", "specialized", "treatment", "work". | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
addressassociationbehaviorclientcombinedcombinesconditionsdesigneddevelopeddevelopmentformformshealthidentifiedindividuallimitedmaintenancemedicalnationalplace
SHARED TOKENS (29): "address", "association", "behavior", "client", "combined", "combines", "conditions", "designed", "developed", "development", "form", "forms", "health", "identified", "individual", "limited", "maintenance", "medical", "national", "place".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstconditionscontractestablishedexperiencesfinancialformhealthinsuranceinsurermanagementmeansownershippaymentpersonpolicypossessionprimaryprotectionrelationship
SHARED TOKENS (25): "against", "conditions", "contract", "established", "experiences", "financial", "form", "health", "insurance", "insurer", "management", "means", "ownership", "payment", "person", "policy", "possession", "primary", "protection", "relationship".... | EXACT TITLE in wedding_events: "Insurance". | EXACT TITLE in substance_use_recovery: "Insurance".
0.500
Rodeo ↗ Q207703 EXACT TITLE
associationcategoriesdecemberdesignedfederalgovernedgroupsindustrylaterlocalmodernnationalofficialorganizationpracticesprofessionalpublicregionregulationsrequired
SHARED TOKENS (27): "association", "categories", "december", "designed", "federal", "governed", "groups", "industry", "later", "local", "modern", "national", "official", "organization", "practices", "professional", "public", "region", "regulations", "required".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesalreadycollegecurrentdetermineemployersemploymentexperiencefuturegovernmentgroupsindustryinvestmentleadlimitedmedicalnetworkopportunitiesorganizationpaid
SHARED TOKENS (38): "agencies", "already", "college", "current", "determine", "employers", "employment", "experience", "future", "government", "groups", "industry", "investment", "lead", "limited", "medical", "network", "opportunities", "organization", "paid".... | EXACT TITLE in wedding_events: "Internship". | EXACT TITLE in substance_use_recovery: "Internship".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationsboardscommunicationconditionsconferencedatadefinesdigitaleducationevenfacilitiesfundinghealthhomeinformationlimitedlive
SHARED TOKENS (36): "access", "administration", "application", "applications", "boards", "communication", "conditions", "conference", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "home", "information", "limited", "live".... | EXACT TITLE in substance_use_recovery: "Telehealth".
0.500
Convention ↗ Q225862 EXACT TITLE
agreementboarddifferentfairformalgrouphumanindustrylawlegalmediameetingofficepeoplepractitionersstandard
SHARED TOKENS (16): "agreement", "board", "different", "fair", "formal", "group", "human", "industry", "law", "legal", "media", "meeting", "office", "people", "practitioners", "standard". | EXACT TITLE in wedding_events: "Convention".
0.500
demandeconomicemergencyformalformsgovernmenthomehousingincreasedinformallocalmarketsnationalownershiprentalresponsesocialsupply
SHARED TOKENS (18): "demand", "economic", "emergency", "formal", "forms", "government", "home", "housing", "increased", "informal", "local", "markets", "national", "ownership", "rental", "response", "social", "supply". | EXACT TITLE in substance_use_recovery: "Affordable housing".
0.500
agreementalcoholamongapproximatelyconcerningdesigneddevelopmentevaluationfamilygeneralgrouphealthincorporatedindividuallong-termmedicalpathwaypeoplepreventionprimary
SHARED TOKENS (30): "agreement", "alcohol", "among", "approximately", "concerning", "designed", "development", "evaluation", "family", "general", "group", "health", "incorporated", "individual", "long-term", "medical", "pathway", "people", "prevention", "primary".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
alcoholamongcentralcombinedconcerningconditionscontrolledcoredepartmentdependenceeffecteffectsenvironmentexposurefacilitiesfrequentlygovernmenthealthincreasedlist
SHARED TOKENS (41): "alcohol", "among", "central", "combined", "concerning", "conditions", "controlled", "core", "department", "dependence", "effect", "effects", "environment", "exposure", "facilities", "frequently", "government", "health", "increased", "list".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
Nursing ↗ Q121176 EXACT TITLE
certificationcredentialsdegreedemandeducationfamiliesfunctioninghealthhumanlargestlifeplanpracticepractitionerspresencepreventionprofessionalsprotectionproviderspublic
SHARED TOKENS (26): "certification", "credentials", "degree", "demand", "education", "families", "functioning", "health", "human", "largest", "life", "plan", "practice", "practitioners", "presence", "prevention", "professionals", "protection", "providers", "public".... | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
businesscentercontractingcontroleconomicevenfacilityfunctionslaterlegallimitedmanagementoperationalorganizationoutsidepracticepresenceprivateprocessprovider
SHARED TOKENS (27): "business", "center", "contracting", "control", "economic", "even", "facility", "functions", "later", "legal", "limited", "management", "operational", "organization", "outside", "practice", "presence", "private", "process", "provider".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
agenciesdepartmentemergencyfacilitieshistoricallyleastlifemedicalmodeloperatepersonnelpresentprimarypublicremainsresourcessearchsupportsystemstechnicians
SHARED TOKENS (26): "agencies", "department", "emergency", "facilities", "historically", "least", "life", "medical", "model", "operate", "personnel", "present", "primary", "public", "remains", "resources", "search", "support", "systems", "technicians".... | EXACT TITLE in wedding_events: "Emergency medical services". | EXACT TITLE in substance_use_recovery: "Emergency medical services".
0.500
consumerscontrolcreatesdisposaldistributionevenhealthinformationmanagementmedicalopportunitiespeopleremainsafescalesystemthemtreatingtreatment
SHARED TOKENS (19): "consumers", "control", "creates", "disposal", "distribution", "even", "health", "information", "management", "medical", "opportunities", "people", "remain", "safe", "scale", "system", "them", "treating", "treatment". | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
Signage ↗ Q1211272 EXACT TITLE
boardsbuildingscreateddesigndesigneddigitaldisplaysdistinctdocumentedformgroupinformationmeansoutsidesmaller
SHARED TOKENS (15): "boards", "buildings", "created", "design", "designed", "digital", "displays", "distinct", "documented", "form", "group", "information", "means", "outside", "smaller". | EXACT TITLE in wedding_events: "Signage".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesaffectapplicationchangesconditionscontrolcreatingdifferentdistributioneffectsevidencefuturehistoryhumanindustrylargestlayerleastlimitedlong-term
SHARED TOKENS (32): "activities", "affect", "application", "changes", "conditions", "control", "creating", "different", "distribution", "effects", "evidence", "future", "history", "human", "industry", "largest", "layer", "least", "limited", "long-term".... | EXACT TITLE in wedding_events: "Weather".
0.500
amongapproximatelyboisecampusclassifiedcompeteconferencedivisionestablishedfallsidaholateroperatesproductionprofessionalpublicresearchruralschoolsspending
SHARED TOKENS (24): "among", "approximately", "boise", "campus", "classified", "compete", "conference", "division", "established", "falls", "idaho", "later", "operates", "production", "professional", "public", "research", "rural", "schools", "spending".... | EXACT TITLE in wedding_events: "University of Idaho".
0.500
academicamongappropriatebecomecoordinationdepartmentsdirectlyearlyemergencygenerallimitedmedicalmodelmodelspracticepractitionersprimaryprogramsprovidersrequiring
SHARED TOKENS (26): "academic", "among", "appropriate", "become", "coordination", "departments", "directly", "early", "emergency", "general", "limited", "medical", "model", "models", "practice", "practitioners", "primary", "programs", "providers", "requiring".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscapturecommunicationcreatecreatingdevelopeddigitaldirectemployedexposureformlatermaterialmeansoperatespersonpracticeproduceproduced
SHARED TOKENS (27): "application", "business", "capture", "communication", "create", "creating", "developed", "digital", "direct", "employed", "exposure", "form", "later", "material", "means", "operates", "person", "practice", "produce", "produced".... | EXACT TITLE in wedding_events: "Photography".
0.500
accessbecomecenterdepartmentdepartmentsemergencyentryfacilityfoundimportantmeansmedicaloperatepresentprimaryrequirestaffingtreatmentvolume
SHARED TOKENS (19): "access", "become", "center", "department", "departments", "emergency", "entry", "facility", "found", "important", "means", "medical", "operate", "present", "primary", "require", "staffing", "treatment", "volume". | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
Waste management ↗ EXACT TITLE
activitiesactivityapproximatelycenterscombinedcommercialcontrolledcreateddevelopeddifferentdisposaleconomiceffectsenvironmentfinalfoodhealthhumanincreasinginvolving
SHARED TOKENS (43): "activities", "activity", "approximately", "centers", "combined", "commercial", "controlled", "created", "developed", "different", "disposal", "economic", "effects", "environment", "final", "food", "health", "human", "increasing", "involving".... | EXACT TITLE in wedding_events: "Waste management".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesagainstagenciesbuildingsbuiltgovernmenthumanlargestlawlivenationalpermitprotectedprotectionrestrictionsrulesshowsspacestructures
SHARED TOKENS (19): "activities", "against", "agencies", "buildings", "built", "government", "human", "largest", "law", "live", "national", "permit", "protected", "protection", "restrictions", "rules", "shows", "space", "structures". | EXACT TITLE in wedding_events: "Park". | EXACT TITLE in substance_use_recovery: "Park".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesbuildingbuildingsdeterminedevelopeddevelopmentdifferentformgovernmentguideland-uselocalplanningpolicyregulationsregulatoryresidentialrulesscaleshape
SHARED TOKENS (24): "activities", "building", "buildings", "determine", "developed", "development", "different", "form", "government", "guide", "land-use", "local", "planning", "policy", "regulations", "regulatory", "residential", "rules", "scale", "shape".... | EXACT TITLE in wedding_events: "Zoning". | EXACT TITLE in substance_use_recovery: "Zoning".
0.500
Floristry ↗ Q637125 EXACT TITLE
arrangementsartsbusinessconsumerscorporatecreatecreatingdesigndistributionhandlingimportantindustryknowledgemarketmaterialmaterialspeoplepermanentproductionproducts
SHARED TOKENS (32): "arrangements", "arts", "business", "consumers", "corporate", "create", "creating", "design", "distribution", "handling", "important", "industry", "knowledge", "market", "material", "materials", "people", "permanent", "production", "products".... | EXACT TITLE in wedding_events: "Floristry".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
alongsideamongapproveddetermineeffectsfamilyfederalformfurtherhealthincreasedinvolvingleadlistlocalmakesmanagementmedicalnationalorganization
SHARED TOKENS (26): "alongside", "among", "approved", "determine", "effects", "family", "federal", "form", "further", "health", "increased", "involving", "lead", "list", "local", "makes", "management", "medical", "national", "organization".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
applicationapplicationsbecomeclientcompletehouseidentifyingitselfleastlicensedlistpersonplaceproductsprofessionalshapetrainingtreatmentwhosework
SHARED TOKENS (20): "application", "applications", "become", "client", "complete", "house", "identifying", "itself", "least", "licensed", "list", "person", "place", "products", "professional", "shape", "training", "treatment", "whose", "work". | EXACT TITLE in wedding_events: "Nail technician".
0.500
accessamongcommunitiescommunitycomprehensivecontroldesigneddevelopeddevelopmentdifferentdistributioneducationevenhealthhumanimportantincreasingindicatorsinfrastructureknowledge
SHARED TOKENS (46): "access", "among", "communities", "community", "comprehensive", "control", "designed", "developed", "development", "different", "distribution", "education", "even", "health", "human", "important", "increasing", "indicators", "infrastructure", "knowledge".... | EXACT TITLE in wedding_events: "Public health".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomiceffectsenvironmentincreaseincreasedlimitedlocalmarketsorganizationoutsidepeoplepotentialpractices
SHARED TOKENS (27): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "effects", "environment", "increase", "increased", "limited", "local", "markets", "organization", "outside", "people", "potential", "practices".... | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
advertisingaffectedannualapproximatelybecomebusinesscomdecemberdirectoryexpandedfundinginformationlateroperatespracticepracticespublicpublishedpublishesrevenue
SHARED TOKENS (25): "advertising", "affected", "annual", "approximately", "become", "business", "com", "december", "directory", "expanded", "funding", "information", "later", "operates", "practice", "practices", "public", "published", "publishes", "revenue".... | EXACT TITLE in wedding_events: "Yelp".
0.500
administrationadministrativeanalysisappropriateconcerningconsequencescostcostsdegreedifferentdocumenteddutieseconomiceffectestablishedevaluationfairfallsfundinginformation
SHARED TOKENS (47): "administration", "administrative", "analysis", "appropriate", "concerning", "consequences", "cost", "costs", "degree", "different", "documented", "duties", "economic", "effect", "established", "evaluation", "fair", "falls", "funding", "information".... | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
activitiesaddressapplybusinessclientcompleteconstraintscontractorscreatedcriteriadesigneddevelopmentdistinctdocumentationestablishedfundinginfluenceinformationmanagementoperations
SHARED TOKENS (35): "activities", "address", "apply", "business", "client", "complete", "constraints", "contractors", "created", "criteria", "designed", "development", "distinct", "documentation", "established", "funding", "influence", "information", "management", "operations".... | EXACT TITLE in wedding_events: "Project management".
0.500
behaviorcentralchangescoredescriptiondevelopedeffectsexaminationexperienceinfluenceproblemprocedurespublishedratherrelationshiptreatment
SHARED TOKENS (16): "behavior", "central", "changes", "core", "description", "developed", "effects", "examination", "experience", "influence", "problem", "procedures", "published", "rather", "relationship", "treatment". | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
approximatelychangescountingdesignedemergencyexperiencefamilyformgovernmenthousehousinghumanidentifyinglegalliveneedspeoplepermanentplaceprimary
SHARED TOKENS (27): "approximately", "changes", "counting", "designed", "emergency", "experience", "family", "form", "government", "house", "housing", "human", "identifying", "legal", "live", "needs", "people", "permanent", "place", "primary".... | EXACT TITLE in substance_use_recovery: "Homelessness".
0.500
Pharmacy ↗ EXACT TITLE
becomeclassifiedcommunitydirecthealthinformationinstitutionallinksmodernofficeorientedpracticeprimaryproductsprofessionalprofessionalsrelatedsafesafetysetting
SHARED TOKENS (24): "become", "classified", "community", "direct", "health", "information", "institutional", "links", "modern", "office", "oriented", "practice", "primary", "products", "professional", "professionals", "related", "safe", "safety", "setting".... | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
Accounting ↗ Q4116214 EXACT TITLE
accountingactivitiesanalysisboardbusinesscostcouncildesigneddevelopedeconomicfinancialformsfunctionshistoryhumaninformationmajormanagementoperationsorganization
SHARED TOKENS (36): "accounting", "activities", "analysis", "board", "business", "cost", "council", "designed", "developed", "economic", "financial", "forms", "functions", "history", "human", "information", "major", "management", "operations", "organization".... | EXACT TITLE in wedding_events: "Accounting". | EXACT TITLE in substance_use_recovery: "Accounting".
0.500
clientdesigndestinationdifferentdocumentationindustryjoblargestmanagementplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (15): "client", "design", "destination", "different", "documentation", "industry", "job", "largest", "management", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesappropriatearoundclassifiedconsumercontinuingestablishedfairfinalgeneralindustrymarketmarketsopportunitiespresentproductsprofessionalspublicshowshows
SHARED TOKENS (22): "activities", "appropriate", "around", "classified", "consumer", "continuing", "established", "fair", "final", "general", "industry", "market", "markets", "opportunities", "present", "products", "professionals", "public", "show", "shows".... | EXACT TITLE in wedding_events: "Trade show".
0.500
connectioncontinuingcontroldisclosuredistincteducationemergencyexperienceformsknowledgemedicalpeerpeoplepersonpersonnelpositionpracticalrelationshiprelevantrequired
SHARED TOKENS (26): "connection", "continuing", "control", "disclosure", "distinct", "education", "emergency", "experience", "forms", "knowledge", "medical", "peer", "people", "person", "personnel", "position", "practical", "relationship", "relevant", "required".... | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessagendaannualbecomecostcostseconomiceligibilityestablishedexpandedfamiliesfederalfinancialfundinggeneralgovernmenthealthhomeinsurancelargest
SHARED TOKENS (46): "access", "agenda", "annual", "become", "cost", "costs", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "funding", "general", "government", "health", "home", "insurance", "largest".... | EXACT TITLE in substance_use_recovery: "Medicaid".
0.500
beyondbusinesschangescompletionconditionsdatademandeconomicemploymentextendsfallsfuturejobleastmaintenancemarketneedperformanceplanrelated
SHARED TOKENS (29): "beyond", "business", "changes", "completion", "conditions", "data", "demand", "economic", "employment", "extends", "falls", "future", "job", "least", "maintenance", "market", "need", "performance", "plan", "related".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
Logistics ↗ Q177777 EXACT TITLE
costsfacilityfoodinformationlogisticsmanagementmaterialmaterialsmodelneedsoperationalplanningproductionproductsprofessionalpublicrelatedresourcessupplytransportation
SHARED TOKENS (20): "costs", "facility", "food", "information", "logistics", "management", "material", "materials", "model", "needs", "operational", "planning", "production", "products", "professional", "public", "related", "resources", "supply", "transportation". | EXACT TITLE in wedding_events: "Logistics". | EXACT TITLE in substance_use_recovery: "Logistics".
0.500
affectagainstcontractcostcostscreateddesignedevenexpresslyfinancinggeneralgroupindividualinsurancelegalliabilitylimitsmodernpaymentpolicies
SHARED TOKENS (30): "affect", "against", "contract", "cost", "costs", "created", "designed", "even", "expressly", "financing", "general", "group", "individual", "insurance", "legal", "liability", "limits", "modern", "payment", "policies".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadministrativeamenitiesboardbuiltbusinesscenterconferencecostcourtsdepartmentdepartmentsdestinationdirectearlyenvironmentexecutivefacilitiesfacilityfood
SHARED TOKENS (49): "access", "administrative", "amenities", "board", "built", "business", "center", "conference", "cost", "courts", "department", "departments", "destination", "direct", "early", "environment", "executive", "facilities", "facility", "food".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstbehaviorconditionsdirectlydistinctencounterevenguideindividualinfluenceinformationlimitednetworkoutsidepeoplepersonpositionproblemprocesssocial
SHARED TOKENS (23): "against", "behavior", "conditions", "directly", "distinct", "encounter", "even", "guide", "individual", "influence", "information", "limited", "network", "outside", "people", "person", "position", "problem", "process", "social".... | EXACT TITLE in wedding_events: "Information cascade".
0.500
Probation ↗ Q13961 EXACT TITLE
alcoholbehaviorcommunityconditionscourtseducationalemployedfoundlawlimitedlivemeanspermitplacepossessionpotentialprogramremainrequiredrules
SHARED TOKENS (23): "alcohol", "behavior", "community", "conditions", "courts", "educational", "employed", "found", "law", "limited", "live", "means", "permit", "place", "possession", "potential", "program", "remain", "required", "rules".... | EXACT TITLE in substance_use_recovery: "Probation".
0.500
Psychology ↗ Q9418 EXACT TITLE
academicactivitybehaviorboundariesclassifieddevelopmentdisciplineeducationemployemployedexperiencesfamilyfunctioningfunctionsgroupgroupshealthhumanindividualknowledge
SHARED TOKENS (37): "academic", "activity", "behavior", "boundaries", "classified", "development", "discipline", "education", "employ", "employed", "experiences", "family", "functioning", "functions", "group", "groups", "health", "human", "individual", "knowledge".... | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
accessactivitiesactivityagainstalcoholchangesconsequencesdesigneddifferentdriverseducationenvironmentfacilitiesfoodhealthhumaninformationlegallegallylife
SHARED TOKENS (42): "access", "activities", "activity", "against", "alcohol", "changes", "consequences", "designed", "different", "drivers", "education", "environment", "facilities", "food", "health", "human", "information", "legal", "legally", "life".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
Festival ↗ Q132241 EXACT TITLE
amongcommunitiescommunityconnectioncreatingexperiencefairfamiliesfoodimportantlocalmeansnationalplacepracticeservesource
SHARED TOKENS (17): "among", "communities", "community", "connection", "creating", "experience", "fair", "families", "food", "important", "local", "means", "national", "place", "practice", "serve", "source". | EXACT TITLE in wedding_events: "Festival".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
amongapprovedcommunitydegreedifferentdispenseeducationeffectsgovernmenthealthindustryknowledgelegallicensingmanagementmastermechanismpotentialpracticepreparation
SHARED TOKENS (36): "among", "approved", "community", "degree", "different", "dispense", "education", "effects", "government", "health", "industry", "knowledge", "legal", "licensing", "management", "master", "mechanism", "potential", "practice", "preparation".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectedaffectsalcoholamongconsequencescontextcontrolledcostcostsdefinitionsdependencedevelopmentdirectlyeffectsenvironmentevidenceformsfoundfurthergroup
SHARED TOKENS (49): "affected", "affects", "alcohol", "among", "consequences", "context", "controlled", "cost", "costs", "definitions", "dependence", "development", "directly", "effects", "environment", "evidence", "forms", "found", "further", "group".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
alreadyconsumerscreateexperienceguideidentifiedincreaseindustryneedsorganizationpersonpersonnelpoliciesproductsprovisionqualitystandardsstrategiessubstantiallyuses
SHARED TOKENS (20): "already", "consumers", "create", "experience", "guide", "identified", "increase", "industry", "needs", "organization", "person", "personnel", "policies", "products", "provision", "quality", "standards", "strategies", "substantially", "uses". | EXACT TITLE in wedding_events: "Customer service".
0.500
agealcoholcategoriescategoryconsequencescriteriadependencedirectdirectlyhealthincreasedindividualoperatingpatternpeoplepercentrelatedrepeatedterms
SHARED TOKENS (19): "age", "alcohol", "categories", "category", "consequences", "criteria", "dependence", "direct", "directly", "health", "increased", "individual", "operating", "pattern", "people", "percent", "related", "repeated", "terms". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.500
Naltrexone ↗ Q409587 EXACT TITLE
alcoholamongapprovedeffectsfoundlistmedicalmodelpeopleproducedsafesoldthemthoughtreatment
SHARED TOKENS (15): "alcohol", "among", "approved", "effects", "found", "list", "medical", "model", "people", "produced", "safe", "sold", "them", "though", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.500
activeappropriatecomprehensivedailydependencyeducationalfacilitiesfacilityfamilygroupgroupshealthindividualoperatesparticipationprogramprogramsrequireresidentialscale
SHARED TOKENS (27): "active", "appropriate", "comprehensive", "daily", "dependency", "educational", "facilities", "facility", "family", "group", "groups", "health", "individual", "operates", "participation", "program", "programs", "require", "residential", "scale".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
academicadaboardboisecampuscanyoncollegecommunitycomprehensivecountiesdevelopmenteducationgovernedidahonampapopulationprimaryprogramspublicreported
SHARED TOKENS (27): "academic", "ada", "board", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "development", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in wedding_events: "College of Western Idaho".
0.500
accessadministrationaffectedalcoholapproximatelyaroundcannotdependdependenceeffectsexaminationincreasingindividualindustryleastpeoplepermanentpersonrisksafe
SHARED TOKENS (26): "access", "administration", "affected", "alcohol", "approximately", "around", "cannot", "depend", "dependence", "effects", "examination", "increasing", "individual", "industry", "least", "people", "permanent", "person", "risk", "safe".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.500
activityaddressagenciesauthorizationbusinessdepartmentsdeterminesgovernmentlicenselicenseslocalmultipleoperateoperatingpermitsrequiredrequiressingle
SHARED TOKENS (18): "activity", "address", "agencies", "authorization", "business", "departments", "determines", "government", "license", "licenses", "local", "multiple", "operate", "operating", "permits", "required", "requires", "single". | EXACT TITLE in wedding_events: "Business license".
0.480
activecommunitydepartmentsdevelopeddifferentfamiliesfundinghealthhousingintendedlivepeopleprofessionalwork
SHARED TOKENS (14): "active", "community", "departments", "developed", "different", "families", "funding", "health", "housing", "intended", "live", "people", "professional", "work". | EXACT TITLE in substance_use_recovery: "Supportive housing".
0.480
Catering ↗ Q777754 EXACT TITLE
businesscommercialfoodgroupindividualmanagementmodelpracticesprivaterisksafetyservesservingsetting
SHARED TOKENS (14): "business", "commercial", "food", "group", "individual", "management", "model", "practices", "private", "risk", "safety", "serves", "serving", "setting". | EXACT TITLE in wedding_events: "Catering".
0.480
Parking ↗ Q267917 EXACT TITLE
aroundavailabilitybuildingscentersdependencydesignfacilitieslocalparkingpercentrestrictionsrulessupportthough
SHARED TOKENS (14): "around", "availability", "buildings", "centers", "dependency", "design", "facilities", "local", "parking", "percent", "restrictions", "rules", "support", "though". | EXACT TITLE in wedding_events: "Parking". | EXACT TITLE in substance_use_recovery: "Parking".
0.480
authoritydocumentitselflegallicenselicensesmarriageorganizationpermitplacerecordrequirerequiredserve
SHARED TOKENS (14): "authority", "document", "itself", "legal", "license", "licenses", "marriage", "organization", "permit", "place", "record", "require", "required", "serve". | EXACT TITLE in wedding_events: "Marriage license".
0.480
becomecommercialdigitaldirectdistinctionhistoricallylivelocalmediamethodsnewsproductionrecordingwork
SHARED TOKENS (14): "become", "commercial", "digital", "direct", "distinction", "historically", "live", "local", "media", "methods", "news", "production", "recording", "work". | EXACT TITLE in wedding_events: "Videography".
0.480
Tent ↗ Q170544 EXACT TITLE
capablecategoriesexperienceincreasinglyintendedmaterialmultiplepeoplepersonsheltersmallsmallerstructuressupporting
SHARED TOKENS (14): "capable", "categories", "experience", "increasingly", "intended", "material", "multiple", "people", "person", "shelter", "small", "smaller", "structures", "supporting". | EXACT TITLE in wedding_events: "Tent". | EXACT TITLE in substance_use_recovery: "Tent".
0.460
Resort ↗ Q875157 EXACT TITLE
activitiescentralcommercialcontainingfoodfrequentlymeansneedsoperatedownedownershippeoplesingle
SHARED TOKENS (13): "activities", "central", "commercial", "containing", "food", "frequently", "means", "needs", "operated", "owned", "ownership", "people", "single". | EXACT TITLE in wedding_events: "Resort".
0.460
appropriatecommunitycoordinationcourtsgeneralhealthlawlegalmanagementmedicalplanssystemtreatment
SHARED TOKENS (13): "appropriate", "community", "coordination", "courts", "general", "health", "law", "legal", "management", "medical", "plans", "system", "treatment". | EXACT TITLE in substance_use_recovery: "Case management".
0.460
alreadybuildingbuildingscodesdepartmentdivisionintendedpracticespreventionresultssafetyschoolsstructures
SHARED TOKENS (13): "already", "building", "buildings", "codes", "department", "division", "intended", "practices", "prevention", "results", "safety", "schools", "structures". | EXACT TITLE in wedding_events: "Fire safety".
0.450
approximatelyboisecenteridahonampa
SHARED TOKENS (5): "approximately", "boise", "center", "idaho", "nampa". | URL->A (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.440
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialdistrictemploymentlowerofficepopulationpublicsmallsmaller
SHARED TOKENS (12): "business", "center", "central", "commercial", "district", "employment", "lower", "office", "population", "public", "small", "smaller". | EXACT TITLE in wedding_events: "Downtown".
0.440
Banquet ↗ Q626066 EXACT TITLE
amongbuildingbuiltdifferentevenfoodformformalmodernpeoplesocialthem
SHARED TOKENS (12): "among", "building", "built", "different", "even", "food", "form", "formal", "modern", "people", "social", "them". | EXACT TITLE in wedding_events: "Banquet".
0.440
controldefinitionsdifferenteducationformincreasinginformationlegallylicensemedicalpotentialrequiring
SHARED TOKENS (12): "control", "definitions", "different", "education", "form", "increasing", "information", "legally", "license", "medical", "potential", "requiring". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.420
agreementalcoholarrangementsdrivershomeinfluencepersonpracticalremainsselectionterms
SHARED TOKENS (11): "agreement", "alcohol", "arrangements", "drivers", "home", "influence", "person", "practical", "remains", "selection", "terms". | EXACT TITLE in wedding_events: "Designated driver".
0.420
Concert ↗ Q182832 EXACT TITLE
largestlivelogisticsperformanceprivateprofessionalrequireshowsinglesmallsupport
SHARED TOKENS (11): "largest", "live", "logistics", "performance", "private", "professional", "require", "show", "single", "small", "support". | EXACT TITLE in wedding_events: "Concert".
0.420
Officiant ↗ Q2015874 EXACT TITLE
employedfacilityhealthhumanlawlegallifemarriageservespecifiedwork
SHARED TOKENS (11): "employed", "facility", "health", "human", "law", "legal", "life", "marriage", "serve", "specified", "work". | EXACT TITLE in wedding_events: "Officiant".
0.420
communitydistinctformgrouppeoplepersonprogramsreceivingrequirementsschoolwork
SHARED TOKENS (11): "community", "distinct", "form", "group", "people", "person", "programs", "receiving", "requirements", "school", "work". | EXACT TITLE in substance_use_recovery: "Community service".
0.420
Orchard ↗ Q236371 EXACT TITLE
commercialfoodmaintenancemakesmodernpreferenceproductionscaleservesinglesmaller
SHARED TOKENS (11): "commercial", "food", "maintenance", "makes", "modern", "preference", "production", "scale", "serve", "single", "smaller". | EXACT TITLE in wedding_events: "Orchard".
0.400
adaboisecanyoncountiesidahometropolitanpayetteregiontreasurevalley
SHARED TOKENS (10): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "payette", "region", "treasure", "valley". | EXACT TITLE in wedding_events: "Southwestern Idaho".
0.400
Cosmetology ↗ EXACT TITLE
applicationcostlicenseoccupationalpermanentrequiredschoolspecialtystudytreatment
SHARED TOKENS (10): "application", "cost", "license", "occupational", "permanent", "required", "school", "specialty", "study", "treatment". | EXACT TITLE in wedding_events: "Cosmetology".
0.400
amongcannotdeterminefamilylawlegallegallymarriagerequirementsterms
SHARED TOKENS (10): "among", "cannot", "determine", "family", "law", "legal", "legally", "marriage", "requirements", "terms". | EXACT TITLE in wedding_events: "Marriage law".
0.400
Warehouse ↗ Q181623 EXACT TITLE
buildingbuildingsdesigneddirectlyfacilityfunctionmaterialsproductionstandardtransport
SHARED TOKENS (10): "building", "buildings", "designed", "directly", "facility", "function", "materials", "production", "standard", "transport". | EXACT TITLE in wedding_events: "Warehouse".
0.400
blockfederalgeneralgovernmentprogramsregionalrevenuesmallerspecifiedterms
SHARED TOKENS (10): "block", "federal", "general", "government", "programs", "regional", "revenue", "smaller", "specified", "terms". | EXACT TITLE in substance_use_recovery: "Block grant".
0.400
buildingcentercentersconferencedesignedgroupsleastmajormeetingshows
SHARED TOKENS (10): "building", "center", "centers", "conference", "designed", "groups", "least", "major", "meeting", "shows". | EXACT TITLE in wedding_events: "Convention center".
0.400
emergencyhousinglong-termpeoplepermanentpopulationresidenceresidentssheltersupport
SHARED TOKENS (10): "emergency", "housing", "long-term", "people", "permanent", "population", "residence", "residents", "shelter", "support". | EXACT TITLE in substance_use_recovery: "Transitional housing".
0.380
consumerscontractorsfinalgeneralindividualindustrylimitedrentalshort-term
SHARED TOKENS (9): "consumers", "contractors", "final", "general", "individual", "industry", "limited", "rental", "short-term". | EXACT TITLE in wedding_events: "Equipment rental".
0.380
agenciescapitalfinancialformsidentificationnonprofitprocesssourcesthough
SHARED TOKENS (9): "agencies", "capital", "financial", "forms", "identification", "nonprofit", "process", "sources", "though". | EXACT TITLE in wedding_events: "Fundraising".
0.360
Rose garden ↗ Q291177 EXACT TITLE
alongsidealreadyindividuallargestleastpresentpublicspecialized
SHARED TOKENS (8): "alongside", "already", "individual", "largest", "least", "present", "public", "specialized". | EXACT TITLE in wedding_events: "Rose garden".
0.360
Public records ↗ EXACT TITLE
agenciesdocumenteddocumentsgovernmentinformationpublicrecordstransactions
SHARED TOKENS (8): "agencies", "documented", "documents", "government", "information", "public", "records", "transactions". | EXACT TITLE in wedding_events: "Public records".
0.360
arrangementscompositioncreatedesignevidencefoundmarketingmaterial
SHARED TOKENS (8): "arrangements", "composition", "create", "design", "evidence", "found", "marketing", "material". | EXACT TITLE in wedding_events: "Floral design".
0.360
buildingsbuiltdevelopmentenvironmentmaintainspreserveproductsseeks
SHARED TOKENS (8): "buildings", "built", "development", "environment", "maintains", "preserve", "products", "seeks". | EXACT TITLE in wedding_events: "Historic preservation".
0.360
departmentdevelopmenteconomicidahoinsurancelabortechnologyworkforce
SHARED TOKENS (8): "department", "development", "economic", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in wedding_events: "Idaho Department of Labor".
0.340
capableevidencehumanlimitedlong-termpractitionerssupporting
SHARED TOKENS (7): "capable", "evidence", "human", "limited", "long-term", "practitioners", "supporting". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.340
businesscommercialestategroupmanagementprofessionalreal
SHARED TOKENS (7): "business", "commercial", "estate", "group", "management", "professional", "real". | EXACT TITLE in wedding_events: "Oak View Group".
0.340
Barn ↗ Q1303167 EXACT TITLE
activitiesbuildingbuildingshouserestrictedstructuresterms
SHARED TOKENS (7): "activities", "building", "buildings", "house", "restricted", "structures", "terms". | EXACT TITLE in wedding_events: "Barn".
0.340
Relapse ↗ Q2292472 EXACT TITLE
activitybehaviordependencedevelopedformmedicalmultiple
SHARED TOKENS (7): "activity", "behavior", "dependence", "developed", "form", "medical", "multiple". | EXACT TITLE in substance_use_recovery: "Relapse".
0.340
amongbuildingbuildingsbuiltcostsdesignedterms
SHARED TOKENS (7): "among", "building", "buildings", "built", "costs", "designed", "terms". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.320
functionsgovernmenthealthprofessionalsrecordingrecords
SHARED TOKENS (6): "functions", "government", "health", "professionals", "recording", "records". | EXACT TITLE in wedding_events: "Vital statistics".
0.320
Wedding ↗ Q49836 EXACT TITLE
authorityincorporatedmarriagepeoplepublicsocial
SHARED TOKENS (6): "authority", "incorporated", "marriage", "people", "public", "social". | EXACT TITLE in wedding_events: "Wedding".
0.320
Vineyard ↗ Q22715 EXACT TITLE
itselfplacepracticeproductionstudytable
SHARED TOKENS (6): "itself", "place", "practice", "production", "study", "table". | EXACT TITLE in wedding_events: "Vineyard".
0.320
Restaurant ↗ Q11707 EXACT TITLE
businessfamilyfoodmodelsservessingle
SHARED TOKENS (6): "business", "family", "food", "models", "serves", "single". | EXACT TITLE in wedding_events: "Restaurant".
0.300
amongdependenceexperiencefunctioningincreasedindividuallifelivelowermaintenanceongoingpeopleprogramsqualitysocialtreatment
SHARED TOKENS (16): "among", "dependence", "experience", "functioning", "increased", "individual", "life", "live", "lower", "maintenance", "ongoing", "people", "programs", "quality", "social", "treatment".
0.300
agreementaroundassociatecannotdirecteducationalhealthjobleastmedicalmodelplanspracticepresentprincipalproviderprovidersrequiredrequiringserve
SHARED TOKENS (26): "agreement", "around", "associate", "cannot", "direct", "educational", "health", "job", "least", "medical", "model", "plans", "practice", "present", "principal", "provider", "providers", "required", "requiring", "serve"....
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
agreementbeyondconsequencescontractcontractscontrolcontrolleddistinctdistinctioneffectemergencygeneralgoverningintendeditselflawlegallegallyliabilitymakes
SHARED TOKENS (34): "agreement", "beyond", "consequences", "contract", "contracts", "control", "controlled", "distinct", "distinction", "effect", "emergency", "general", "governing", "intended", "itself", "law", "legal", "legally", "liability", "makes"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
activitiesadmissionsbecomecontractingcontrolscostcostsearlyeconomicformsgrouphealthincreasedinsuranceintendedlifemaintenancemanagementmedicalorganization
SHARED TOKENS (29): "activities", "admissions", "become", "contracting", "controls", "cost", "costs", "early", "economic", "forms", "group", "health", "increased", "insurance", "intended", "life", "maintenance", "management", "medical", "organization"....
0.300
activeaddressadvertisingamongcurrentdatadigitaldominantgeneralgovernancemanagementmarketingmediaplatformspotentialpractitionersproductspublicrathersetting
SHARED TOKENS (23): "active", "address", "advertising", "among", "current", "data", "digital", "dominant", "general", "governance", "management", "marketing", "media", "platforms", "potential", "practitioners", "products", "public", "rather", "setting"....
0.300
degreedevelopeddisclosureemployersfacilityhealthincreaseinsurancemanagementmedicalmodernpeoplepracticeprivacyprovidersrecordssecuritysystemsterms
SHARED TOKENS (19): "degree", "developed", "disclosure", "employers", "facility", "health", "increase", "insurance", "management", "medical", "modern", "people", "practice", "privacy", "providers", "records", "security", "systems", "terms".
0.300
aroundconnectedfacilitieshumaninfrastructuremunicipalpersonprivacyrequiresinglesitessmallsystemtermstreatment
SHARED TOKENS (15): "around", "connected", "facilities", "human", "infrastructure", "municipal", "person", "privacy", "require", "single", "sites", "small", "system", "terms", "treatment".
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
amongapplicablebeyondcontroldistributioneducationalestablishingexclusivefairformformalgroupintendeditselflawlegallicenselimitedmeansmultiple
SHARED TOKENS (29): "among", "applicable", "beyond", "control", "distribution", "educational", "establishing", "exclusive", "fair", "form", "formal", "group", "intended", "itself", "law", "legal", "license", "limited", "means", "multiple"....
0.300
Heroin ↗ Q60168 KW CROSS HIGH
administrationamongapproximatelyaroundcontextcontrolledeffecteffectsformfunctionhistoryincreasedlicenselong-termpeoplepercentpossessproducedproductionrapid
SHARED TOKENS (24): "administration", "among", "approximately", "around", "context", "controlled", "effect", "effects", "form", "function", "history", "increased", "license", "long-term", "people", "percent", "possess", "produced", "production", "rapid"....
0.300
academicadministrationbusinesscenterscollegedegreedepartmentdestinationindustrymanagementmarketingmasterrelevantschoolstudysubjectuniversity
SHARED TOKENS (17): "academic", "administration", "business", "centers", "college", "degree", "department", "destination", "industry", "management", "marketing", "master", "relevant", "school", "study", "subject", "university".
0.300
activitiesapprovedaroundauthoritybecomeclientcontrolcontrolleddirecteducationeffectsevidenceexperiencefinancialformalfoundgeneralhealthinvestmentmeeting
SHARED TOKENS (42): "activities", "approved", "around", "authority", "become", "client", "control", "controlled", "direct", "education", "effects", "evidence", "experience", "financial", "formal", "found", "general", "health", "investment", "meeting"....
0.300
accessaffectagenciesbeyondcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationenvironmentevenfamiliesfamilyfuturegovernment
SHARED TOKENS (62): "access", "affect", "agencies", "beyond", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "environment", "even", "families", "family", "future", "government"....
0.300
becomeconsolidationconsumersdifferentdirectlyfinalmanagementmarketmarketplaceneedownedownershippositionproblemproduceproducedproductsratherrelatedsupplies
SHARED TOKENS (21): "become", "consolidation", "consumers", "different", "directly", "final", "management", "market", "marketplace", "need", "owned", "ownership", "position", "problem", "produce", "produced", "products", "rather", "related", "supplies"....
0.300
activitiesactivityadministrationadministrativeagenciesbuiltchangescontrolcourtscreateddivisioneconomiceducationenforcementenvironmentexecutiveexpandedfurthergoverninggovernment
SHARED TOKENS (36): "activities", "activity", "administration", "administrative", "agencies", "built", "changes", "control", "courts", "created", "division", "economic", "education", "enforcement", "environment", "executive", "expanded", "further", "governing", "government"....
0.300
academicacquisitionapplicationapplicationsbehaviorcommunicationcontextdatadesigndevelopmenthealthinformationmanagementmedicalmethodsresearchstudysystemstechnology
SHARED TOKENS (19): "academic", "acquisition", "application", "applications", "behavior", "communication", "context", "data", "design", "development", "health", "information", "management", "medical", "methods", "research", "study", "systems", "technology".
0.300
agealcoholapplyauthorizedcommunitycompliancedistributiondistrictdriverseffectfacilityfederalfinalfundinggovernmenthomeindividuallawleastlegal
SHARED TOKENS (45): "age", "alcohol", "apply", "authorized", "community", "compliance", "distribution", "district", "drivers", "effect", "facility", "federal", "final", "funding", "government", "home", "individual", "law", "least", "legal"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
administrationaffectamongapproximatelycentraldependencedevelopeddirectlyeffecteffectsfamilyfoundfrequentlygenerichealthincreaselaborlistlong-termmarketing
SHARED TOKENS (31): "administration", "affect", "among", "approximately", "central", "dependence", "developed", "directly", "effect", "effects", "family", "found", "frequently", "generic", "health", "increase", "labor", "list", "long-term", "marketing"....
0.300
becomesbehaviorconsequencesexpandedexperiencefinancialformframeworkidenticalidentifiedimplyindividualleadmodernpersonprocessratherrelatedrisksocial
SHARED TOKENS (22): "becomes", "behavior", "consequences", "expanded", "experience", "financial", "form", "framework", "identical", "identified", "imply", "individual", "lead", "modern", "person", "process", "rather", "related", "risk", "social"....
0.300
analysiscurrentdataevidenceexperienceguidehealthhumanindividualinformationleastmanagementmeanspracticepreventionpublicresearchtreatment
SHARED TOKENS (18): "analysis", "current", "data", "evidence", "experience", "guide", "health", "human", "individual", "information", "least", "management", "means", "practice", "prevention", "public", "research", "treatment".
0.300
applicableassociationauthoritybehaviorcentralchangescommunitiescommunitycomprehensiveconditionscostscreatingdependdependsdesigndevelopmenteconomicexposurefacilitiesfunction
SHARED TOKENS (46): "applicable", "association", "authority", "behavior", "central", "changes", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depend", "depends", "design", "development", "economic", "exposure", "facilities", "function"....
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
behaviorclientconditionscontrolleddesigneddifferentdriverseffecteffectsevaluatingfamiliesfamilyformsfoundgeneralgroupshealthincreaseindividualinvolving
SHARED TOKENS (45): "behavior", "client", "conditions", "controlled", "designed", "different", "drivers", "effect", "effects", "evaluating", "families", "family", "forms", "found", "general", "groups", "health", "increase", "individual", "involving"....
0.300
businesscomcommunicationconnectconnectsconsumerscreatesdemanddevelopeddevelopmentdigitaldirectdistincteconomicexplainingfoundgovernancegroupgroupshealth
SHARED TOKENS (50): "business", "com", "communication", "connect", "connects", "consumers", "creates", "demand", "developed", "development", "digital", "direct", "distinct", "economic", "explaining", "found", "governance", "group", "groups", "health"....
0.300
ageapplicantscannotchangesconditionscostseducationeffecteligibilityexpandedexpansionfederalfoundfundinghealthincreaseincreasedindividualinsuranceinsurers
SHARED TOKENS (49): "age", "applicants", "cannot", "changes", "conditions", "costs", "education", "effect", "eligibility", "expanded", "expansion", "federal", "found", "funding", "health", "increase", "increased", "individual", "insurance", "insurers"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthorityauthorizedbecomeconditionsemployedevenevidenceformsgovernmenthumanimplyitselflawnecessarilypeoplepersonplacepoliceposition
SHARED TOKENS (22): "against", "authority", "authorized", "become", "conditions", "employed", "even", "evidence", "forms", "government", "human", "imply", "itself", "law", "necessarily", "people", "person", "place", "police", "position"....
0.300
Juvenile court ↗ Q468501 KW CROSS HIGH
ageauthoritybehaviorcapacitychangesconcerningcontextcourtscreatedatadependencydevelopmentearlyfurthergeneralincreasinglylegalmodelmodernneeds
SHARED TOKENS (34): "age", "authority", "behavior", "capacity", "changes", "concerning", "context", "courts", "create", "data", "dependency", "development", "early", "further", "general", "increasingly", "legal", "model", "modern", "needs"....
0.300
activitiesaffectedapplicationcosteducationevenhealthhomeimportantincreaseindividualinformationmethodsorganizationoutsidepeoplepreventionprimaryproviderquality
SHARED TOKENS (25): "activities", "affected", "application", "cost", "education", "even", "health", "home", "important", "increase", "individual", "information", "methods", "organization", "outside", "people", "prevention", "primary", "provider", "quality"....
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activitycommercialconditionsconsumersdistributionemergencyfoodformhumanimportantlaterlifelogisticspeopleproduceproductsprotectionrathersecuritysolely
SHARED TOKENS (22): "activity", "commercial", "conditions", "consumers", "distribution", "emergency", "food", "form", "human", "important", "later", "life", "logistics", "people", "produce", "products", "protection", "rather", "security", "solely"....
0.300
addressassociationbehaviorcannotcodecontroldevelopedlifeliveprocessprogramprogramspublishedsponsorsupporting
SHARED TOKENS (15): "address", "association", "behavior", "cannot", "code", "control", "developed", "life", "live", "process", "program", "programs", "published", "sponsor", "supporting".
0.300
affectcommunitiesconnectcontroldistinctionecosystemevenfoodhealthhumanimportantinfluenceinterfaceland-uselimitslocalmanagementnationalplaceplan
SHARED TOKENS (33): "affect", "communities", "connect", "control", "distinction", "ecosystem", "even", "food", "health", "human", "important", "influence", "interface", "land-use", "limits", "local", "management", "national", "place", "plan"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
alcoholapplicationsapproximatelycapablechangesidentifiesincreasematerialsmechanismoperateoperatesoperationoperationsprocessproduceproductsrequiresresultssafeseparate
SHARED TOKENS (23): "alcohol", "applications", "approximately", "capable", "changes", "identifies", "increase", "materials", "mechanism", "operate", "operates", "operation", "operations", "process", "produce", "products", "requires", "results", "safe", "separate"....
0.300
aroundcontainscouncildifferentfrequentlyguideshistoryhomehousenonprofitorganizationpeoplepersonplacementrolesitesocialstandardssupportvalue
SHARED TOKENS (20): "around", "contains", "council", "different", "frequently", "guides", "history", "home", "house", "nonprofit", "organization", "people", "person", "placement", "role", "site", "social", "standards", "support", "value".
0.300
Food truck ↗ KW CROSS HIGH
amongbecomecommercialdailydevelopedeconomicfoodincreasinglyindustrymajoroperationpeopleregionalservespecialtythoughtransportworkers
SHARED TOKENS (18): "among", "become", "commercial", "daily", "developed", "economic", "food", "increasingly", "industry", "major", "operation", "people", "regional", "serve", "specialty", "though", "transport", "workers".
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
contextcontractcontractsdifferentexpresslyforminsuranceitselflawlimitedmedicaloperationprincipalrelationshiprelevantresponsibilitiesspecified
SHARED TOKENS (17): "context", "contract", "contracts", "different", "expressly", "form", "insurance", "itself", "law", "limited", "medical", "operation", "principal", "relationship", "relevant", "responsibilities", "specified".
0.300
applicablecodeconcerningdevelopmentdifferentenforcementexpandedfairfamiliesfamilyfederalfinancingfundinghousinglawmakesnationalpeopleprivateprograms
SHARED TOKENS (28): "applicable", "code", "concerning", "development", "different", "enforcement", "expanded", "fair", "families", "family", "federal", "financing", "funding", "housing", "law", "makes", "national", "people", "private", "programs"....
0.300
adaagainstbusinesschangescostscouncilemployersfinalhouseidentityimposeslaterlawnationalprotectionpublicrequirementsrequiresrights
SHARED TOKENS (19): "ada", "against", "business", "changes", "costs", "council", "employers", "final", "house", "identity", "imposes", "later", "law", "national", "protection", "public", "requirements", "requires", "rights".
0.300
administersadministrationadministrativecenterscertificationdepartmentfacilitiesfederalfinancinggovhealthhomehumaninsurancelong-termprocessprogramprogramsqualityreports
SHARED TOKENS (23): "administers", "administration", "administrative", "centers", "certification", "department", "facilities", "federal", "financing", "gov", "health", "home", "human", "insurance", "long-term", "process", "program", "programs", "quality", "reports"....
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscontroldepartmentdominantexperiencesfacilitiesholdingintendedlimitedmajormodernparkingpeoplepermitrequirerequiresreservedsourcesthemtransportation
SHARED TOKENS (20): "buildings", "control", "department", "dominant", "experiences", "facilities", "holding", "intended", "limited", "major", "modern", "parking", "people", "permit", "require", "requires", "reserved", "sources", "them", "transportation".
0.300
accessactivitiesadvertisingbehaviorconstraintsconsumerscontextcontrolledcurrentdatadocumentedevenformgovernmenthealthinformationlifelocalnavigationnetwork
SHARED TOKENS (34): "access", "activities", "advertising", "behavior", "constraints", "consumers", "context", "controlled", "current", "data", "documented", "even", "form", "government", "health", "information", "life", "local", "navigation", "network"....
0.300
accessaffectboardcostcostsdevelopedfinancinghealthinformationknowledgelifemedicalmethodsorganizationpeopleperformancepolicypractitionersqualityrelationship
SHARED TOKENS (29): "access", "affect", "board", "cost", "costs", "developed", "financing", "health", "information", "knowledge", "life", "medical", "methods", "organization", "people", "performance", "policy", "practitioners", "quality", "relationship"....
0.300
activeadvertisingaffectapplicationsbrandsconnectconsumerscostcreatecreateddevelopeddispenseentryexperiencesincreasinginfluenceinformationmedianewsparticipants
SHARED TOKENS (36): "active", "advertising", "affect", "applications", "brands", "connect", "consumers", "cost", "create", "created", "developed", "dispense", "entry", "experiences", "increasing", "influence", "information", "media", "news", "participants"....
0.300
associationcommunityidahonampaprofessional
SHARED TOKENS (5): "association", "community", "idaho", "nampa", "professional". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.300
businessdefinesdepartmentfacilityhealthhumanindividualinsurancelicensedmedicalorganizationpaidpersonprofessionalproviderproviderstreatment
SHARED TOKENS (17): "business", "defines", "department", "facility", "health", "human", "individual", "insurance", "licensed", "medical", "organization", "paid", "person", "professional", "provider", "providers", "treatment".
0.300
beyondcommunitydemonstratingdependencedependencydevelopeddevelopmentdifferenteffectsevenexplicitlyhealthlifemodelmodelspeoplepersonpoliciespotentialpractical
SHARED TOKENS (28): "beyond", "community", "demonstrating", "dependence", "dependency", "developed", "development", "different", "effects", "even", "explicitly", "health", "life", "model", "models", "people", "person", "policies", "potential", "practical"....
0.300
academicbecomebecomesbehaviorcompetecontextcostsdevelopeddevelopmentdiscoveryemployfinancialformshomeinformationmaintenancemajormediamultiplenews
SHARED TOKENS (38): "academic", "become", "becomes", "behavior", "compete", "context", "costs", "developed", "development", "discovery", "employ", "financial", "forms", "home", "information", "maintenance", "major", "media", "multiple", "news"....
0.300
administrationbusinesscapitalconsolidationcreatingdepartmentsdesigndevelopmentdocumentingearlyfurtherhumaninvolvinglabormanagementorganizationpeopleperformanceplanningpolicies
SHARED TOKENS (31): "administration", "business", "capital", "consolidation", "creating", "departments", "design", "development", "documenting", "early", "further", "human", "involving", "labor", "management", "organization", "people", "performance", "planning", "policies"....
0.300
accesscenterconditionscontrolleddailyfacilitiesfacilityhealthleastlimitedmakesoutsidepeoplepracticeprogramprogramsrelationshipsresidentialresidentsresources
SHARED TOKENS (27): "access", "center", "conditions", "controlled", "daily", "facilities", "facility", "health", "least", "limited", "makes", "outside", "people", "practice", "program", "programs", "relationships", "residential", "residents", "resources"....
0.300
aloneamongcontrolleddifferenteducationindividualintendedinvolvinglegallegallymedicalpersonprofessionalprogramprogramssystem
SHARED TOKENS (16): "alone", "among", "controlled", "different", "education", "individual", "intended", "involving", "legal", "legally", "medical", "person", "professional", "program", "programs", "system".
0.300
Oxycodone ↗ Q407535 KW CROSS HIGH
amongdependenceeffecteffectsequivalentfifteenformgenerichealthlaterlistorganizationproducedproductssoldtreatment
SHARED TOKENS (16): "among", "dependence", "effect", "effects", "equivalent", "fifteen", "form", "generic", "health", "later", "list", "organization", "produced", "products", "sold", "treatment".
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
createdigitaleffectsevenfunctionslaterleastmediapersonprivateprogramspublicrealrecordrecordingrecordssimultaneouslysmallsourcesspecialized
SHARED TOKENS (23): "create", "digital", "effects", "even", "functions", "later", "least", "media", "person", "private", "programs", "public", "real", "record", "recording", "records", "simultaneously", "small", "sources", "specialized"....
0.300
activealcoholcontrolcostdistinctexperiencefoundgoverninggrouplatermeetingneedongoingprimaryprogrampublicrequiredrestrictreview
SHARED TOKENS (19): "active", "alcohol", "control", "cost", "distinct", "experience", "found", "governing", "group", "later", "meeting", "need", "ongoing", "primary", "program", "public", "required", "restrict", "review".
0.300
accountingarrangementsbusinesscontractcontractscontroldesigndirectemployedentryfunctionsgovernmentindustryinvestmentlicensinglocallowermanagementmethodsoperating
SHARED TOKENS (32): "accounting", "arrangements", "business", "contract", "contracts", "control", "design", "direct", "employed", "entry", "functions", "government", "industry", "investment", "licensing", "local", "lower", "management", "methods", "operating"....
0.300
becomebuildingscenterscommunitiesconnectiondocumentseconomicfuturegroupindustryknowledgelegallocalmajornationalprotectionratherrelatedselectionterms
SHARED TOKENS (22): "become", "buildings", "centers", "communities", "connection", "documents", "economic", "future", "group", "industry", "knowledge", "legal", "local", "major", "national", "protection", "rather", "related", "selection", "terms"....
0.300
Family therapy ↗ Q870449 KW CROSS HIGH
behaviordevelopeddevelopmentdifferentdirectearlyfamiliesfamilyhumanindividualinfluenceinvolvinglong-termmarriageparticipationpeopleproblemrelatedrelationshipsschools
SHARED TOKENS (25): "behavior", "developed", "development", "different", "direct", "early", "families", "family", "human", "individual", "influence", "involving", "long-term", "marriage", "participation", "people", "problem", "related", "relationships", "schools"....
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaffectsaroundbehaviorchangescommunitycontextdifferentearlyfunctioningfunctionshealthincreaseindividualmajormedicalmethodspatternpeerpeople
SHARED TOKENS (29): "affect", "affects", "around", "behavior", "changes", "community", "context", "different", "early", "functioning", "functions", "health", "increase", "individual", "major", "medical", "methods", "pattern", "peer", "people"....
0.300
activitiesapplyauthorityauthorizedboardcapacityconditionsconsentdefinitionsevidencefactsformindividualinformationinstitutionalintendedlawlegallimitedmedical
SHARED TOKENS (41): "activities", "apply", "authority", "authorized", "board", "capacity", "conditions", "consent", "definitions", "evidence", "facts", "form", "individual", "information", "institutional", "intended", "law", "legal", "limited", "medical"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activitycannotearlyfacilitiesfacilityfamiliesfamilygrouphealthhomehouseleastlivemedicalmodelneedneedspeopleprogramsrelated
SHARED TOKENS (25): "activity", "cannot", "early", "facilities", "facility", "families", "family", "group", "health", "home", "house", "least", "live", "medical", "model", "need", "needs", "people", "programs", "related"....
0.300
Cocaine ↗ Q41576 KW CROSS HIGH
administrationaffectcentralcompetecontrolcostdependencedevelopmenteffectsexposuregroupshistoricallyincreasedleadleastlegallimitedlocalmarketmedical
SHARED TOKENS (34): "administration", "affect", "central", "compete", "control", "cost", "dependence", "development", "effects", "exposure", "groups", "historically", "increased", "lead", "least", "legal", "limited", "local", "market", "medical"....
0.300
accessactivecapacitycommunitycreateeducationenforcementgenerichealthhumanincreasedincreasinglypreventionproblemproducedproductsprotectionqualityregulationsregulatory
SHARED TOKENS (32): "access", "active", "capacity", "community", "create", "education", "enforcement", "generic", "health", "human", "increased", "increasingly", "prevention", "problem", "produced", "products", "protection", "quality", "regulations", "regulatory"....
0.300
alcoholconditionsconsequencesdependencedependencyfinancialgeneralgroupslegalmedicalparticipationpeoplepresentprocessprofessionalssocialtreatment
SHARED TOKENS (17): "alcohol", "conditions", "consequences", "dependence", "dependency", "financial", "general", "groups", "legal", "medical", "participation", "people", "present", "process", "professionals", "social", "treatment".
0.300
administrationagainstagenciesassociationauthorityauthorizedcommunitycompletecomprehensiveconsolidationcontrolcontrolledcreatesdatadepartmentdeterminesdistributionenforcementevaluationfederal
SHARED TOKENS (61): "administration", "against", "agencies", "association", "authority", "authorized", "community", "complete", "comprehensive", "consolidation", "control", "controlled", "creates", "data", "department", "determines", "distribution", "enforcement", "evaluation", "federal"....
0.300
activitiesaffectedcommunitydifferentemergencyfederallocalmanagementneedspreventionprofessionalrequiresresponserisksearchterms
SHARED TOKENS (16): "activities", "affected", "community", "different", "emergency", "federal", "local", "management", "needs", "prevention", "professional", "requires", "response", "risk", "search", "terms".
0.300
ageassociationcriteriacurrentdailydependencedifferenteffectsfamilyformsgrouphealthhistoryhomeimportantincreasedindividuallong-termmedicalmeeting
SHARED TOKENS (34): "age", "association", "criteria", "current", "daily", "dependence", "different", "effects", "family", "forms", "group", "health", "history", "home", "important", "increased", "individual", "long-term", "medical", "meeting"....
0.300
agreementamongassociationbusinesscentralcommunitycontractcostscoveringevidencegovernmenthealthindividualinsuranceinsurermedicalnationalorganizationpersonplans
SHARED TOKENS (29): "agreement", "among", "association", "business", "central", "community", "contract", "costs", "covering", "evidence", "government", "health", "individual", "insurance", "insurer", "medical", "national", "organization", "person", "plans"....
0.300
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongapprovedclassifiedcontrolleddevelopedeffectsequivalentformitselfmedicalproductionrequiresoldsupplywork
SHARED TOKENS (15): "among", "approved", "classified", "controlled", "developed", "effects", "equivalent", "form", "itself", "medical", "production", "require", "sold", "supply", "work".
0.300
activeaffectedagenciescapacityconsequencesdeterminedistributioneconomicemployedemploymententryfunctionimportantindicatorsindustrylawmarketorganizationpracticeproduction
SHARED TOKENS (30): "active", "affected", "agencies", "capacity", "consequences", "determine", "distribution", "economic", "employed", "employment", "entry", "function", "important", "indicators", "industry", "law", "market", "organization", "practice", "production"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisapplicationappropriateconditionsdatadescriptiondesigndistinctiondistributioneffectsexposurefunctiongeneralhealthhistoricallyhumanidentifyingknowledgemajor
SHARED TOKENS (38): "among", "analysis", "application", "appropriate", "conditions", "data", "description", "design", "distinction", "distribution", "effects", "exposure", "function", "general", "health", "historically", "human", "identifying", "knowledge", "major"....
0.300
activitiesaddressadvertisingbroaderbusinesscentralclientcommunicationcontrolledcorecreatedirectequivalentestablishexecutiveexposureformgovernmentindividualinfluence
SHARED TOKENS (50): "activities", "address", "advertising", "broader", "business", "central", "client", "communication", "controlled", "core", "create", "direct", "equivalent", "establish", "executive", "exposure", "form", "government", "individual", "influence"....
0.300
availabilityconsumerconsumersgeneralinformationmarketplacemarketplacesmultipleneedsoperatorprimaryprocessproductionproductsproviderssegmentselectionsinglesitetransactions
SHARED TOKENS (20): "availability", "consumer", "consumers", "general", "information", "marketplace", "marketplaces", "multiple", "needs", "operator", "primary", "process", "production", "products", "providers", "segment", "selection", "single", "site", "transactions".
0.300
groupslawpersonprivatework
SHARED TOKENS (5): "groups", "law", "person", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.300
administrativeauthorizedconcerningconsentemployersfamiliesfamilyfederalgrouphealthinformationinsurancelawlifelimitedmedicalnationalplanspoliciesprotected
SHARED TOKENS (30): "administrative", "authorized", "concerning", "consent", "employers", "families", "family", "federal", "group", "health", "information", "insurance", "law", "life", "limited", "medical", "national", "plans", "policies", "protected"....
0.300
applicationsaroundautomaticallycategorycombinedconsumercontainingcontrolscreateddigitalearlyexposurefinalformfunctionsfurtherhistoryincorporatedindustryinterface
SHARED TOKENS (43): "applications", "around", "automatically", "category", "combined", "consumer", "containing", "controls", "created", "digital", "early", "exposure", "final", "form", "functions", "further", "history", "incorporated", "industry", "interface"....
0.300
advertisingagenciesbecomecreatedigitalformfrequentlyincreaseincreasinglyindependentmarketingmediamultipleoperatingparticipantsplaceplatformspotentialpracticesproducts
SHARED TOKENS (29): "advertising", "agencies", "become", "create", "digital", "form", "frequently", "increase", "increasingly", "independent", "marketing", "media", "multiple", "operating", "participants", "place", "platforms", "potential", "practices", "products"....
0.300
Decoration ↗ Q1232942 EXACT TITLE
artshouseincreaseintendedperson
SHARED TOKENS (5): "arts", "house", "increase", "intended", "person". | EXACT TITLE in wedding_events: "Decoration".
0.300
agenciesarchitectureconditionscontroldesignestategeneralhumaninfrastructurelicenselicensedlicensesmanagementmasterplanningpossessprivateproduceprofessionalprovision
SHARED TOKENS (27): "agencies", "architecture", "conditions", "control", "design", "estate", "general", "human", "infrastructure", "license", "licensed", "licenses", "management", "master", "planning", "possess", "private", "produce", "professional", "provision"....
0.300
agenciesauthorizedboardscontrolleddatadispenseenforcementestablishedevidencehealthidentifyingincreasedlawlicensingmultiplepractitionersprogramprogramsprovidersreceiving
SHARED TOKENS (30): "agencies", "authorized", "boards", "controlled", "data", "dispense", "enforcement", "established", "evidence", "health", "identifying", "increased", "law", "licensing", "multiple", "practitioners", "program", "programs", "providers", "receiving"....
0.300
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciescommunityfoundhumanindustrylicensesproductionprofessionalremainrequiredschedulesthemwhosework
SHARED TOKENS (15): "access", "agencies", "community", "found", "human", "industry", "licenses", "production", "professional", "remain", "required", "schedules", "them", "whose", "work".
0.300
Vocational education ↗ KW CROSS HIGH
collegecommunitydesignedeconomiceducationeducationalformalformsfurthergeneralindividualinformalknowledgelifemethodspersonplacerelatedschoolschools
SHARED TOKENS (24): "college", "community", "designed", "economic", "education", "educational", "formal", "forms", "further", "general", "individual", "informal", "knowledge", "life", "methods", "person", "place", "related", "school", "schools"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecreateddifferentestatefacilityfullgovernmentlegallocaloperateownershippathpeopleprivaterealrestrictedrightsroutesstatus
SHARED TOKENS (22): "authority", "capable", "created", "different", "estate", "facility", "full", "government", "legal", "local", "operate", "ownership", "path", "people", "private", "real", "restricted", "rights", "routes", "status"....
0.300
addressingauthorizedconcerningconsentcreateddepartmenteducationexecutivefederalfundinggeneralgovernmenthealthhumanmattersmedicalmissionprimaryprivatepublic
SHARED TOKENS (23): "addressing", "authorized", "concerning", "consent", "created", "department", "education", "executive", "federal", "funding", "general", "government", "health", "human", "matters", "medical", "mission", "primary", "private", "public"....
0.300
accessactivitiesadministrationannouncedassociationcapacitycenterschangescontrolcooperationdepartmentdesignededucationalfederalfoodfoundinggovernmenthealthhumaninformation
SHARED TOKENS (39): "access", "activities", "administration", "announced", "association", "capacity", "centers", "changes", "control", "cooperation", "department", "designed", "educational", "federal", "food", "founding", "government", "health", "human", "information"....
0.300
boundariescertificationcompleteformalfoundjoblaborlicensemastermeasurableoutsidepeoplepermanentplacementpotentialpracticepractitionersprofessionalregulatedstudy
SHARED TOKENS (22): "boundaries", "certification", "complete", "formal", "found", "job", "labor", "license", "master", "measurable", "outside", "people", "permanent", "placement", "potential", "practice", "practitioners", "professional", "regulated", "study"....
0.300
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialdistincthomeindustryleastmakesplaceprocessproduceproducedproductionprotectionreservedscalesocialworkers
SHARED TOKENS (18): "built", "business", "commercial", "distinct", "home", "industry", "least", "makes", "place", "process", "produce", "produced", "production", "protection", "reserved", "scale", "social", "workers".
0.300
associatebuildingcourtsidahopresent
SHARED TOKENS (5): "associate", "building", "courts", "idaho", "present". | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicadvertisingaloneapplicationartsbeyondcommunicationconsolidationconsumercreatingdemanddesigndevelopmentdifferentdigitaldisciplinedistinctestablishedgroupshuman
SHARED TOKENS (39): "academic", "advertising", "alone", "application", "arts", "beyond", "communication", "consolidation", "consumer", "creating", "demand", "design", "development", "different", "digital", "discipline", "distinct", "established", "groups", "human"....
0.300
activeactivityamongavailabilitybeyondcentralchangesclassifiedcontrolleddependencedistributioneffectsformsfunctionhumanidenticalincreaseinvolvingleadliability
SHARED TOKENS (38): "active", "activity", "among", "availability", "beyond", "central", "changes", "classified", "controlled", "dependence", "distribution", "effects", "forms", "function", "human", "identical", "increase", "involving", "lead", "liability"....
0.300
addresscomprehensivecontroldifferentestablishedfurthergovernmentlegallimitslocalmunicipalnationalplacepoliceprivatepublicregulationregulationsresidentsrestrictions
SHARED TOKENS (24): "address", "comprehensive", "control", "different", "established", "further", "government", "legal", "limits", "local", "municipal", "national", "place", "police", "private", "public", "regulation", "regulations", "residents", "restrictions"....
0.300
applicationsartscontrolcorporatedifferentdisciplineeffectslivemodernoperatepeopleperformancepersonnelproductionshowstechnicianswork
SHARED TOKENS (17): "applications", "arts", "control", "corporate", "different", "discipline", "effects", "live", "modern", "operate", "people", "performance", "personnel", "production", "shows", "technicians", "work".
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
affectedbecomedevelopedhealthidentificationidentifyinginformationlaterlegallylimitslocalnationalpeoplepossessionprogramspublicresultsrisksrolesafe
SHARED TOKENS (26): "affected", "become", "developed", "health", "identification", "identifying", "information", "later", "legally", "limits", "local", "national", "people", "possession", "programs", "public", "results", "risks", "role", "safe"....
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
addressaffectagainstcommunitycomprehensivecostdifferenteducationemergencyemploymentevidencefamilyformgovernmenthousehousingindependentindividuallifemodel
SHARED TOKENS (44): "address", "affect", "against", "community", "comprehensive", "cost", "different", "education", "emergency", "employment", "evidence", "family", "form", "government", "house", "housing", "independent", "individual", "life", "model"....
0.300
ageapproximatelyauthorizationautomaticallybeyondconsentgenerallawleastlegalmarriagemedicalpersonrequirerightsstatutethough
SHARED TOKENS (17): "age", "approximately", "authorization", "automatically", "beyond", "consent", "general", "law", "least", "legal", "marriage", "medical", "person", "require", "rights", "statute", "though".
0.300
applyconsequencesfederalgovernmenthealthindividualknowledgemissionnationalpublicresearchsocialstudysupplywhose
SHARED TOKENS (15): "apply", "consequences", "federal", "government", "health", "individual", "knowledge", "mission", "national", "public", "research", "social", "study", "supply", "whose".
0.300
addressbuildingsconnectedcontrolleddistinctiondistinguisheffectsimportantindustryintendedlivemakesmarketsmultipleprofessionalpublicsinglesmallsourcessupport
SHARED TOKENS (26): "address", "buildings", "connected", "controlled", "distinction", "distinguish", "effects", "important", "industry", "intended", "live", "makes", "markets", "multiple", "professional", "public", "single", "small", "sources", "support"....
0.300
advertisingbusinesscommercialconditionsdutiesgeneralimposesinsuranceinsurersliabilitymarketmedicaloperationspoliciespolicyprofessionalpublicrisksseparateterms
SHARED TOKENS (21): "advertising", "business", "commercial", "conditions", "duties", "general", "imposes", "insurance", "insurers", "liability", "market", "medical", "operations", "policies", "policy", "professional", "public", "risks", "separate", "terms"....
0.300
applicableapplyauthoritydemanddistrictgeneralgovernedidaholocalnationaloverviewpaidproductsrequireresidentsrulessalesoldstatewidesubject
SHARED TOKENS (22): "applicable", "apply", "authority", "demand", "district", "general", "governed", "idaho", "local", "national", "overview", "paid", "products", "require", "residents", "rules", "sale", "sold", "statewide", "subject"....
0.300
acquireannouncedapprovedcentercreateitselflaternetworkoperatesoperatingplansprincipalreportingroutessystemtransportationunionwestern
SHARED TOKENS (18): "acquire", "announced", "approved", "center", "create", "itself", "later", "network", "operates", "operating", "plans", "principal", "reporting", "routes", "system", "transportation", "union", "western".
0.300
administrationcentraldevelopeddevelopmentdifferenteducationalequivalentfallsfamilyhealthhumanidahoincreaseknowledgemastermedicalmethodsmodelmodelsneed
SHARED TOKENS (33): "administration", "central", "developed", "development", "different", "educational", "equivalent", "falls", "family", "health", "human", "idaho", "increase", "knowledge", "master", "medical", "methods", "model", "models", "need"....
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adaboisecentercombinedcommercialdepartmentfacilityfallsfunctionsgeneralidahoincreasenationaloperatedoperatesprotectionrequiringrightssupportuses
SHARED TOKENS (21): "ada", "boise", "center", "combined", "commercial", "department", "facility", "falls", "functions", "general", "idaho", "increase", "national", "operated", "operates", "protection", "requiring", "rights", "support", "uses"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesbusinesscategoriescodecommercialconsumercreatedistrictemploymentestablishingfairfinancialfinancingfoodformationframeworkfurthergeneralgoverninginsurance
SHARED TOKENS (41): "activities", "business", "categories", "code", "commercial", "consumer", "create", "district", "employment", "establishing", "fair", "financial", "financing", "food", "formation", "framework", "further", "general", "governing", "insurance"....
0.300
alcoholbuiltcommunitydevelopedestablishedgroupsmedicalmethodsmodelorganizationparticipantspeerpeoplepersonprofessionalprofessionalssupporttraining
SHARED TOKENS (18): "alcohol", "built", "community", "developed", "established", "groups", "medical", "methods", "model", "organization", "participants", "peer", "people", "person", "professional", "professionals", "support", "training".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
applyappropriateapprovedauthoritybecomesbuildingbuildingscodecodescompliancecontrolcouncildepartmentsdesigndistricteffectsestatefacilitygeneralhealth
SHARED TOKENS (44): "apply", "appropriate", "approved", "authority", "becomes", "building", "buildings", "code", "codes", "compliance", "control", "council", "departments", "design", "district", "effects", "estate", "facility", "general", "health"....
0.300
activitiesbroaderbusinesscategoriesdependencedevelopmentenvironmentfallsfrequentlyincreasedinvolvinglinkslocalpeopleratherreservedrestrictedrulessafetysingle
SHARED TOKENS (22): "activities", "broader", "business", "categories", "dependence", "development", "environment", "falls", "frequently", "increased", "involving", "links", "local", "people", "rather", "reserved", "restricted", "rules", "safety", "single"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementbrandedbusinesscapitalcompeteconditionscorporatedirecteconomiceffectexpansionexplicitlyfinancialindividualinvestmentlegalliabilitylicenseslicensingmarket
SHARED TOKENS (34): "agreement", "branded", "business", "capital", "compete", "conditions", "corporate", "direct", "economic", "effect", "expansion", "explicitly", "financial", "individual", "investment", "legal", "liability", "licenses", "licensing", "market"....
0.300
administrationannouncedauthorizedauthorizesavailabilitycommunitycomprehensiveeducationfederalfundinghealthincreaseintendedlawmajornetworkspreventionprocessprogramsprovisions
SHARED TOKENS (22): "administration", "announced", "authorized", "authorizes", "availability", "community", "comprehensive", "education", "federal", "funding", "health", "increase", "intended", "law", "major", "networks", "prevention", "process", "programs", "provisions"....
0.300
Ridesharing company ↗ KW CROSS HIGH
cannotcontractorsdemanddriversindependentinsurancelegallylicensinglocalmodeloperateoperationsregulationsrequiredrequirementssubjectsupplythem
SHARED TOKENS (18): "cannot", "contractors", "demand", "drivers", "independent", "insurance", "legally", "licensing", "local", "model", "operate", "operations", "regulations", "required", "requirements", "subject", "supply", "them".
0.300
addressapplicationsbuildingbuildingscommercialcommunicationdistributionemergencyfacilitieshumaninstitutionallivemeansmultiplepublicrelatedrequiresschoolschoolssmall
SHARED TOKENS (25): "address", "applications", "building", "buildings", "commercial", "communication", "distribution", "emergency", "facilities", "human", "institutional", "live", "means", "multiple", "public", "related", "requires", "school", "schools", "small"....
0.300
administrationaffectalcoholconditionsdependencedevelopeddifferentevenformgroupincreasedlegalmedicalpersonratherrolethemupon
SHARED TOKENS (18): "administration", "affect", "alcohol", "conditions", "dependence", "developed", "different", "even", "form", "group", "increased", "legal", "medical", "person", "rather", "role", "them", "upon".
0.300
behaviorcontroldemanddisciplineeffectsevaluationfederalfoodfundinghealthinvolvingknowledgelegalmedicalpeopleprivatepublicrelatedresearchtreatment
SHARED TOKENS (20): "behavior", "control", "demand", "discipline", "effects", "evaluation", "federal", "food", "funding", "health", "involving", "knowledge", "legal", "medical", "people", "private", "public", "related", "research", "treatment".
0.300
administrationauthorityconsentcontrolcurrentdepartmentdirectlyfederalfoodhealthhumanmedicalprimaryproductspublicregulatedregulationsrelatedreportssafety
SHARED TOKENS (22): "administration", "authority", "consent", "control", "current", "department", "directly", "federal", "food", "health", "human", "medical", "primary", "products", "public", "regulated", "regulations", "related", "reports", "safety"....
0.300
Support group ↗ Q3117735 KW CROSS HIGH
communityestablishingevaluatingexperiencesformgroupinformationnetworkspeoplepublicrelevantsocialstrategiessupportwork
SHARED TOKENS (15): "community", "establishing", "evaluating", "experiences", "form", "group", "information", "networks", "people", "public", "relevant", "social", "strategies", "support", "work".
0.300
Data sharing ↗ Q5227350 KW CROSS HIGH
absenceacademicaccessagenciesagreementalonecodecommunicationcommunitycriteriadatadevelopmentestablishedfoundfullfundingfurthergoverninghistoryidentified
SHARED TOKENS (47): "absence", "academic", "access", "agencies", "agreement", "alone", "code", "communication", "community", "criteria", "data", "development", "established", "found", "full", "funding", "further", "governing", "history", "identified"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesdestinationdistributionfoodfunctioninglogisticsmanagementpreserveproduceproductionproductsqualityrequiressafetysupplyuses
SHARED TOKENS (16): "activities", "destination", "distribution", "food", "functioning", "logistics", "management", "preserve", "produce", "production", "products", "quality", "requires", "safety", "supply", "uses".
0.300
addressageamongauthorizationbecomeconsentcontextdifferentearlyeconomicemployersentryfallsformalfoundfullfunctionsgeneralincreasedindividual
SHARED TOKENS (43): "address", "age", "among", "authorization", "become", "consent", "context", "different", "early", "economic", "employers", "entry", "falls", "formal", "found", "full", "functions", "general", "increased", "individual"....
0.300
acquireactivitieschangescommunicationcommunitiescommunityconferencedesignededucationexperiencesformgroupshealthindividualinfluenceinformationinvolvingknowledgelifenational
SHARED TOKENS (31): "acquire", "activities", "changes", "communication", "communities", "community", "conference", "designed", "education", "experiences", "form", "groups", "health", "individual", "influence", "information", "involving", "knowledge", "life", "national"....
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
absenceassociationbehaviorclassificationcommunityconditionscontrolemploymentexaminationhealthhistoryindividualindustryinfluencemattersmedicalnationaloccupationalorganizationprevention
SHARED TOKENS (31): "absence", "association", "behavior", "classification", "community", "conditions", "control", "employment", "examination", "health", "history", "individual", "industry", "influence", "matters", "medical", "national", "occupational", "organization", "prevention"....
🫐 BERRY66 edges
0.280
formslicenseofficialpermit
SHARED TOKENS (4): "forms", "license", "official", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.280
Baker ↗ Q160131 EXACT TITLE
personplaceproductssource
SHARED TOKENS (4): "person", "place", "products", "source". | EXACT TITLE in wedding_events: "Baker".
0.280
communitiesconflictfederalhistorylargestlawmedicalongoingpdfpreventionsinglesupporttexttreatment
SHARED TOKENS (14): "communities", "conflict", "federal", "history", "largest", "law", "medical", "ongoing", "pdf", "prevention", "single", "support", "text", "treatment".
0.280
activitiesalcoholcommunitiescommunitydependencedifferentgroupincreasinglylong-termpathpracticalreputationresidentialtreatment
SHARED TOKENS (14): "activities", "alcohol", "communities", "community", "dependence", "different", "group", "increasingly", "long-term", "path", "practical", "reputation", "residential", "treatment".
0.280
Use tax ↗ Q17155766 EXACT TITLE
equivalentpaidsoldsubject
SHARED TOKENS (4): "equivalent", "paid", "sold", "subject". | EXACT TITLE in wedding_events: "Use tax".
0.280
Beer garden ↗ Q857909 EXACT TITLE
capitalfoodlocalremain
SHARED TOKENS (4): "capital", "food", "local", "remain". | EXACT TITLE in wedding_events: "Beer garden".
0.280
affectedapplicableapproximatelyassociatedirectlyeconomiceffectsevenexposurefoodleastrepeatedrequiringresponse
SHARED TOKENS (14): "affected", "applicable", "approximately", "associate", "directly", "economic", "effects", "even", "exposure", "food", "least", "repeated", "requiring", "response".
0.280
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahowestern
SHARED TOKENS (4): "approximately", "boise", "idaho", "western". | EXACT TITLE in wedding_events: "Boise River".
0.280
Quinceañera ↗ EXACT TITLE
agedifferentfoodpractices
SHARED TOKENS (4): "age", "different", "food", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.270
currentexecutivegovernmentidahoofficeposition
SHARED TOKENS (6): "current", "executive", "government", "idaho", "office", "position". | URL->A (1): https://sos.idaho.gov/.
0.260
becomedesigneddistinctfamilyinfluenceinformationmarketingprimaryprocessreferralreferralsstrategiessubsequent
SHARED TOKENS (13): "become", "designed", "distinct", "family", "influence", "information", "marketing", "primary", "process", "referral", "referrals", "strategies", "subsequent".
0.260
administrationannouncedavailabilitybuildingcostdepartmentdirectlyhealthhumanoutsidequalityreportstreatment
SHARED TOKENS (13): "administration", "announced", "availability", "building", "cost", "department", "directly", "health", "human", "outside", "quality", "reports", "treatment".
0.260
concerningconsolidationcontroldifferentdocumentationinsurancejoblogisticsmanagementmaterialspeopleplanningtransport
SHARED TOKENS (13): "concerning", "consolidation", "control", "different", "documentation", "insurance", "job", "logistics", "management", "materials", "people", "planning", "transport".
0.260
alcoholalonecategorydependencygroupincreaseditselfneedspeoplepersonprimaryrestrictedsingle
SHARED TOKENS (13): "alcohol", "alone", "category", "dependency", "group", "increased", "itself", "needs", "people", "person", "primary", "restricted", "single".
0.260
aroundcompletionevenfamiliesfamilyfoodformmarriageratherreceivingseparatesocialwhose
SHARED TOKENS (13): "around", "completion", "even", "families", "family", "food", "form", "marriage", "rather", "receiving", "separate", "social", "whose".
0.260
Photo booth ↗ Q494312 EXACT TITLE
containsdigitalmodern
SHARED TOKENS (3): "contains", "digital", "modern". | EXACT TITLE in wedding_events: "Photo booth".
0.260
activitiesbusinessdefinesdefinitionsenvironmentgovernmenthomelimitedorganizationoutsidepaidpeopleprimary
SHARED TOKENS (13): "activities", "business", "defines", "definitions", "environment", "government", "home", "limited", "organization", "outside", "paid", "people", "primary".
0.260
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesscommercialdataindustrylargestmanagementmarketingplatformsproductssegmentsupplysystems
SHARED TOKENS (13): "activities", "business", "commercial", "data", "industry", "largest", "management", "marketing", "platforms", "products", "segment", "supply", "systems".
0.260
Fairground ↗ Q5430425 EXACT TITLE
fairpermanentspace
SHARED TOKENS (3): "fair", "permanent", "space". | EXACT TITLE in wedding_events: "Fairground".
0.240
Interior design ↗ KW CROSS HIGH
artsbuildingdesigndevelopmentenvironmentmanagementpeopleplanningplansresearchsitespace
SHARED TOKENS (12): "arts", "building", "design", "development", "environment", "management", "people", "planning", "plans", "research", "site", "space".
0.240
availabilitybehaviordifferentenforcementformfutureintendedlawoperationsprogramsystemsystems
SHARED TOKENS (12): "availability", "behavior", "different", "enforcement", "form", "future", "intended", "law", "operations", "program", "system", "systems".
0.240
familylawliveorganizationoutsidepaymentperformanceplacepublicpubliclyrightsthough
SHARED TOKENS (12): "family", "law", "live", "organization", "outside", "payment", "performance", "place", "public", "publicly", "rights", "though".
0.240
Marquee ↗ Q1621931 KW CROSS HIGH
buildingchannelcoveringhtmlmakesnetworkpageregionalsinglesmallstructuretext
SHARED TOKENS (12): "building", "channel", "covering", "html", "makes", "network", "page", "regional", "single", "small", "structure", "text".
0.220
documentsestategovernmentmaintainsofficeownershippositionpublicrealrecordsrights
SHARED TOKENS (11): "documents", "estate", "government", "maintains", "office", "ownership", "position", "public", "real", "records", "rights".
0.220
becomedescribesdevelopeditselfmajormodelnonprofitorganizationpeopleproblemuses
SHARED TOKENS (11): "become", "describes", "developed", "itself", "major", "model", "nonprofit", "organization", "people", "problem", "uses".
0.220
conditionseducationemergencyenforcementenvironmentknowledgemethodspracticespreventionresponsethem
SHARED TOKENS (11): "conditions", "education", "emergency", "enforcement", "environment", "knowledge", "methods", "practices", "prevention", "response", "them".
0.220
coordinationhealthmedicalneedsplanspracticepreventionproviderregisteredtrainingtreatment
SHARED TOKENS (11): "coordination", "health", "medical", "needs", "plans", "practice", "prevention", "provider", "registered", "training", "treatment".
0.220
Review site ↗ Q1340449 KW CROSS HIGH
channelcomearlyemploylaterpeopleproductsprofessionalreviewsitesites
SHARED TOKENS (11): "channel", "com", "early", "employ", "later", "people", "products", "professional", "review", "site", "sites".
0.210
performance
SHARED TOKENS (1): "performance". | EXACT TITLE in wedding_events: "Dance floor".
0.200
differentfairimportantlargestpracticespublicshowshowstermswork
SHARED TOKENS (10): "different", "fair", "important", "largest", "practices", "public", "show", "shows", "terms", "work".
0.200
Parole ↗ Q5357120 KW CROSS HIGH
complianceconditionsearlyformoutsidepeopleplaceratherservingsystem
SHARED TOKENS (10): "compliance", "conditions", "early", "form", "outside", "people", "place", "rather", "serving", "system".
0.200
Calligraphy ↗ Q12681 KW CROSS HIGH
designdocumentsformindividualmodernpracticerelatedtextthoughwestern
SHARED TOKENS (10): "design", "documents", "form", "individual", "modern", "practice", "related", "text", "though", "western".
0.200
EXACT TITLE in substance_use_recovery: "Rehabilitation".
0.200
conditionsenvironmentfacilitieshousehousingpeopleprogramprogramssafeserve
SHARED TOKENS (10): "conditions", "environment", "facilities", "house", "housing", "people", "program", "programs", "safe", "serve".
0.200
immediatepersonal
EXACT TITLE in substance_use_recovery: "Crisis intervention".
0.200
Train station ↗ Q55488 KW CROSS HIGH
boardbuildingconnectionselevatedfacilityleastplatformrapidsystemstransport
SHARED TOKENS (10): "board", "building", "connections", "elevated", "facility", "least", "platform", "rapid", "systems", "transport".
0.180
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesigneddestinationgroupspeopleroutesstudentstransportuniversity
SHARED TOKENS (9): "applications", "designed", "destination", "groups", "people", "routes", "students", "transport", "university".
0.180
agreementintendedlicensedlicensinglimitedrightsseparateuseswork
SHARED TOKENS (9): "agreement", "intended", "licensed", "licensing", "limited", "rights", "separate", "uses", "work".
0.180
activitychangesdependenceexposureforminvolvingongoingrequiringupon
SHARED TOKENS (9): "activity", "changes", "dependence", "exposure", "form", "involving", "ongoing", "requiring", "upon".
0.180
brandslifemarketplacesoperatesplanningplatformsportfolioresourcestechnology
SHARED TOKENS (9): "brands", "life", "marketplaces", "operates", "planning", "platforms", "portfolio", "resources", "technology".
0.180
Hairstyle ↗ Q327496 KW CROSS HIGH
frequentlyhomehumaninfluencemethodsoutsidepracticalshapethough
SHARED TOKENS (9): "frequently", "home", "human", "influence", "methods", "outside", "practical", "shape", "though".
0.180
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingcommunitieseconomicgovernmenthousinginfrastructureprivateprocesspublic
SHARED TOKENS (9): "addressing", "communities", "economic", "government", "housing", "infrastructure", "private", "process", "public".
0.180
accuracyconsumersevaluationexperienceformproductsprofessionalreviewsites
SHARED TOKENS (9): "accuracy", "consumers", "evaluation", "experience", "form", "products", "professional", "review", "sites".
0.180
boisefallshomeidahomajormetropolitanroutesservestwin
SHARED TOKENS (9): "boise", "falls", "home", "idaho", "major", "metropolitan", "routes", "serves", "twin".
0.160
Crowd control ↗ Q1872073 KW CROSS HIGH
controlinvolvingmanagementpeoplepolicepracticepublicsecurity
SHARED TOKENS (8): "control", "involving", "management", "people", "police", "practice", "public", "security".
0.140
Recidivism ↗ Q1420643 KW CROSS HIGH
behaviorconsequencesfrequentlyindividualmodelpersonrecurring
SHARED TOKENS (7): "behavior", "consequences", "frequently", "individual", "model", "person", "recurring".
0.140
Wedding cake ↗ Q558133 KW CROSS HIGH
builtcostevenmodernrealsinglewestern
SHARED TOKENS (7): "built", "cost", "even", "modern", "real", "single", "western".
0.140
categoryestatefoodindustrylodgingplanningreal
SHARED TOKENS (7): "category", "estate", "food", "industry", "lodging", "planning", "real".
0.140
placepolicepreventionrightsstatedsystemsystems
SHARED TOKENS (7): "place", "police", "prevention", "rights", "stated", "system", "systems".
0.140
Cannabis ↗ Q79817 KW CROSS HIGH
familyhistoryprincipalproduceproductssingleterms
SHARED TOKENS (7): "family", "history", "principal", "produce", "products", "single", "terms".
0.140
agealcoholdegreedependenceemploymentindividualpattern
SHARED TOKENS (7): "age", "alcohol", "degree", "dependence", "employment", "individual", "pattern".
0.140
alcoholcontroleffectinfluencemultipleoperatingterms
SHARED TOKENS (7): "alcohol", "control", "effect", "influence", "multiple", "operating", "terms".
0.120
Mobile catering ↗ KW CROSS HIGH
businesscorporateemergencyfoodmodernpeople
SHARED TOKENS (6): "business", "corporate", "emergency", "food", "modern", "people".
0.120
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpercentpopulation
SHARED TOKENS (6): "ada", "boise", "idaho", "metropolitan", "percent", "population".
0.120
boisebuildingbuiltidahonationalunion
SHARED TOKENS (6): "boise", "building", "built", "idaho", "national", "union".
0.120
analysisdetermineestablishexaminationknowledgerequire
SHARED TOKENS (6): "analysis", "determine", "establish", "examination", "knowledge", "require".
0.120
applicableauthorizesdistrictpermituseszoning
SHARED TOKENS (6): "applicable", "authorizes", "district", "permit", "uses", "zoning".
0.120
alcoholcombineddependenceindividualmedicalupon
SHARED TOKENS (6): "alcohol", "combined", "dependence", "individual", "medical", "upon".
0.120
architectureartsbuildingsfoundratherrelationship
SHARED TOKENS (6): "architecture", "arts", "buildings", "found", "rather", "relationship".
0.120
Equestrianism ↗ KW CROSS HIGH
activitiesdescriptionpracticaltransportationwelfarework
SHARED TOKENS (6): "activities", "description", "practical", "transportation", "welfare", "work".
0.120
activitiesdifferentdocumentlaterofficialspecialty
SHARED TOKENS (6): "activities", "different", "document", "later", "official", "specialty".
0.120
activitiesemployedmeetingoperationalproductionstrategic
SHARED TOKENS (6): "activities", "employed", "meeting", "operational", "production", "strategic".
0.100
comprehensivemodernrequiresrequiringwhose
SHARED TOKENS (5): "comprehensive", "modern", "requires", "requiring", "whose".
0.100
effectselevatedleadrapidreduced
SHARED TOKENS (5): "effects", "elevated", "lead", "rapid", "reduced".
0.100
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessmakesplaceproduction
SHARED TOKENS (5): "building", "business", "makes", "place", "production".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
◈ Frequently Asked Questions
Wedding Events × Substance Use Recovery — Treasure Valley
HAIKU · HIGH GATE
How do wedding venues in Nampa and Meridian support guests in substance use recovery?
Many Treasure Valley wedding venues now offer alcohol-free beverage options and designate nonalcoholic celebration spaces to accommodate guests managing recovery through Idaho Department of Health and Welfare guidelines. Wedding planners across Ada County and Canyon County increasingly coordinate with local nonprofit organizations that specialize in substance use recovery to ensure inclusive celebrations.
What continuing education do Boise wedding professionals receive about recovery-centered event planning?
Boise State University has partnered with Treasure Valley wedding industry groups to develop continuing education modules addressing substance use recovery awareness and inclusive event design. These programs ensure wedding vendors across the Boise metropolitan area understand how to create supportive environments for guests in recovery.
Which Treasure Valley nonprofits connect wedding planning services with substance use recovery programs?
Several nonprofit organizations operating in Ada County and Canyon County now coordinate between wedding venues and recovery support services to help individuals maintain their sobriety during major life events. The Idaho Department of Health and Welfare maintains referral networks connecting these wedding service providers with evidence-based recovery resources throughout the Boise metropolitan area.
How do Caldwell and Boise wedding industry standards address substance use recovery considerations?
Wedding industry standards across the Treasure Valley increasingly incorporate guidance from the Idaho Department of Health and Welfare regarding recovery-inclusive event hosting. Wedding professionals in Caldwell, Boise, and surrounding Treasure Valley communities now regularly consult recovery nonprofit organizations when designing ceremonies and receptions.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Wedding Events × Substance Use Recovery 16 QID bridges 317 edges 8,485 ext links 2026-07-18 00:13:29 UTC 67d812733e000008
Wedding Events corridor ↗ Substance Use Recovery corridor ↗ Substance Use Recovery × Wedding Events ↗ boisestandard.org/standard ↗
Parent Corridors
Wedding Events × All Other Verticals