—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Wedding Events ↔ relates to ↔ Veterinary Animal Services

28 Wikipedia bridge articles confirmed in both vertical ledgers. 321 deterministic cross-vertical edges. 8,631 external source links harvested. Every edge provenance-stamped. Every claim auditable.

28 QID Bridge Articles
321 Cross Edges
8,631 External Sources
377 Wikipedia Articles
29 🌲 Evergreen
231 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Wedding Events
× Veterinary Animal Services
QID Bridge Articles
28
confirmed Wikipedia overlap
Total Cross Edges
321
External Sources Harvested
8,631
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Food safety
score: 1.0000  ·  type: exact_title_cross  ·  35 shared tokens
QID Bridge Titles (20)
Food safetyTreasure ValleyRodeoInternshipBoise, IdahoUniversity of IdahoEmergency managementZoningBoise State UniversityCollege of Western IdahoBusiness licenseIdaho State UniversityIdaho State PoliceAdministrative lawLand-use planningNampa, IdahoApprenticeshipBuilding codeFranchisingPrivate equity
Shared Semantics (20 tokens)
idahoboisepublicpopulationlocalmetropolitanprofessionaladaregulationscollegegovernmentuniversitycapitalresearchhealthorganizationwesternprogramsrulesstudents
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:13:53 UTC
Content Hash
8079411fd4833bbc
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
28 BRIDGES
Food safety
Q909821 EXACT TITLE 1.000
QID OVERLAP: Q909821 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (35): "affects", "avoid", "cannot", "certification", "chain", "consumer", "creates", "describing", "developed", "discipline", "enforcement", "food", "growth", "handling", "hazards", "health", "industry", "inspection", "management", "market".... | EXACT TITLE in wedding_events: "Food safety". | EXACT TITLE in veterinary_animal_services: "Food safety".
affectsavoidcannotcertificationchainconsumercreatesdescribingdevelopeddisciplineenforcementfoodgrowthhandlinghazardshealthindustryinspectionmanagementmarketnutritionorganizationpersonphysicalpoliciespotentialpracticespreparationrelatedresulting+5
he concern is safe delivery and preparation of the food for the consumer. Food safety, nutrition and food security are closely related. Unhealthy food creates a cycle of disease and malnutrition that affects infants and adults as well. Food can transmit pathogens, which can result in the illness or death of the person or other animals. The main types of pathogens are bacteria, viruses, parasites, and fungus. The World Health Organization estimated that foodborne pathogens cause 600 million cases of diseases and 420,000 deaths per year. Food can also serve as a growth and reproductive medium for pathogens. In developed countries, there are intricate standards for food preparation, whereas in lesser developed countries there are fewer standards and less enforcement of those standards.
Agriculture and animal husbandry practices Food manufacturing practices Food additives Novel foods Genetically modified foods Food label Food contamination Chemical Contamination Chemical contamination in food happens when harmful chemicals make the food unsafe to eat. This occurs when chemicals enter food or are present at unsafe levels. This can happen at any of the four stages of production. Some of the most common chemical contaminants consist of pesticides, industrial chemicals, heavy metals, and chemicals that migrate from packaging materials. How Contamination Enters Food One of the two main reasons for chemical contamination occurring is through agricultural production and from environmental exposure. During agricultural production pesticides, fertilizers, and chemicals are used on crops. Farmers use those to protect the crops, but they can leave residues that can stay on or inside food. During environmental exposure, the plant is exposed to pollution, contaminated soil, and contaminated water. When these chemicals enter the plants, it can be absorbed naturally from polluted air, contaminated soil, or water sources. Animals can also absorb these substances through feed and environmental contact, which can even enter products such as meat and milk. Contamination is unintentional and could build up over time. Overall, contamination can come from multiple sources before food even reaches consumers. Processing and Packaging Contamination doesn't just originate from farms, it can still happen in the processing and the packaging stages. During processing, food is handled with machinery and industrial chemicals. Chemicals used during this process can contaminate the food. Chemicals from packaging itself can move into the food when using materials such as plastics, coatings, and adhesives, especially when it is hot or has been in storage for a long period of time. This is known as chemical migration, which also tends to happen with fatty foods, as they are able to absorb it more. This raises concerns about food safety. Health Effects Chemical contamination can have a big effect on human health. In the short term, people can get poisoning, nausea, and illnesses. In the long term, people can get chronic diseases and long term exposure risks. In many cases, people get effects such as endocrine disruption, which affects hormone function. Another one is neurological effects, which impacts your brain and nervous system. As effects are not the same on everyone, they all depend on the type of chemical, the amount consumed, and how long they've been exposed to it. Overall, this shows the importance of monitoring food safety. Prevention There are many ways chemical contamination in food can be reduced through the proper safety measures. First, this includes making sure that everything is going through the correct government regulations, which consists of laws enforced to have the correct safety standards, limit on chemicals such as pesticides, and an overall monitoring to make sure these regulations are being followed the correct way. Another is agricultural improvements, which can include using safer pesticides, possibly safer farming practices, and eliminating chemical overuse as much as possible. Packaging improvements can also be a great impact. This includes using safer materials and reducing chemical migration. Better technology can also help packaging production as a whole. Lastly, organization, making sure that public health agencies and global organizations help monitor and assess risks to overall improve food safety everywhere.
A number of US states have their own meat inspection programs that substitute for USDA inspection for meats that are sold only in-state. Certain state programs have been criticized for undue leniency to bad practices. Contrastingly, there are some state-level programs that supplement Federal inspections rather than replacing them. These programs generally operate with the goal of increasing consumer confidence in their state's produce, play a role in investigating outbreaks of food-borne disease bacteria such as in the 2006 outbreak of pathogenic Escherichia coli O157:H7 and in promoting better food processing practices to eliminate food-borne threats. Additionally, several states which are major producers of fresh fruits and vegetables (including California, Arizona and Florida) have their own state programs to test produce for pesticide residues. The food system represents one of the most significant components of the U.S. economy. It affects the social and economic well-being of nearly all Americans and plays a significant role in the well-being of the global community. The U.S. food and fiber system accounted for 18 percent of employment 4 percent of imported goods, and 11 percent of exports in 2011. The relative economic contribution of each various step of the U.S. food supply chain has changed significantly over the past 100 years. Generally speaking, the economic importance of the farm production subsector has steadily diminished relative to the shares of the other components of the food supply chain. Restaurants and other retail food establishments fall under state law and are regulated by state or local health departments. Typically these regulations require official inspections of specific design features, best food-handling practices, and certification of food handlers. In some places a letter grade or numerical score must be prominently posted following each inspection. In some localities, inspection deficiencies and remedial action are posted on the Internet. In addition, states may maintain and enforce their own model of the FDA Food Code.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (17): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "name", "opportunities", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in wedding_events: "Treasure Valley". | EXACT TITLE in veterinary_animal_services: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitannameopportunitiesregionresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Rodeo
Q207703 EXACT TITLE 1.000
QID OVERLAP: Q207703 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (34): "animal", "association", "categories", "certain", "competitive", "designed", "equipment", "event", "events", "federal", "governed", "horse", "industry", "later", "livestock", "local", "national", "north", "official", "organization".... | EXACT TITLE in wedding_events: "Rodeo". | EXACT TITLE in veterinary_animal_services: "Rodeo".
animalassociationcategoriescertaincompetitivedesignedequipmenteventeventsfederalgovernedhorseindustrylaterlivestocklocalnationalnorthofficialorganizationpracticesprofessionalpublicregionregulationsrequiredrequirementsrestrictionsrodeoschool+4
ng through fall, while the modern professional rodeo circuit runs longer, and concludes with the PRCA National Finals Rodeo (NFR) in Las Vegas, held every December. Rodeo has provoked opposition from animal rights and some animal welfare advocates, who argue that various competitions constitute animal cruelty. The rodeo industry has made progress in improving the welfare of rodeo animals, with specific requirements for veterinary care and other regulations that protect rodeo animals. However, some local and state governments in North America have banned or restricted rodeos, certain rodeo events, or types of equipment.
PRCA National Finals Rodeo (NFR) in Las Vegas, held every December. Rodeo has provoked opposition from animal rights and some animal welfare advocates, who argue that various competitions constitute animal cruelty. The rodeo industry has made progress in improving the welfare of rodeo animals, with specific requirements for veterinary care and other regulations that protect rodeo animals. However, some local and state governments in North America have banned or restricted rodeos, certain rodeo events, or types of equipment.
ions constitute animal cruelty. The rodeo industry has made progress in improving the welfare of rodeo animals, with specific requirements for veterinary care and other regulations that protect rodeo animals. However, some local and state governments in North America have banned or restricted rodeos, certain rodeo events, or types of equipment.
I
Q6500754 EXACT TITLE 1.000
QID OVERLAP: Q6500754 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (45): "agencies", "allowing", "businesses", "career", "careers", "college", "current", "determine", "employers", "employment", "event", "experience", "field", "government", "industry", "internships", "large", "learning", "limited", "medical".... | EXACT TITLE in wedding_events: "Internship". | EXACT TITLE in veterinary_animal_services: "Internship".
agenciesallowingbusinessescareercareerscollegecurrentdetermineemployersemploymenteventexperiencefieldgovernmentindustryinternshipslargelearninglimitedmedicalnetworkopportunitiesorganizationpaidparticularperiodpersonpracticeprofessionalprograms+15
by an organization for a limited period of time. Once confined to medical graduates, internship is used to practice for a wide range of placements in businesses, non-profit organizations, government agencies and political parties. They are typically undertaken by students and graduates looking to gain relevant skills and experience in a particular field. Employers benefit from these placements because they often recruit employees from their best interns, who have known capabilities, thus saving time and money in the long run. Internships are usually arranged by third-party organizations that recruit interns on behalf of industry groups. Rules vary from country to country about when interns should be regarded as employees. The system can be open to exploitation by unscrupulous employers. Internships for professional careers are similar in some ways. Similar to internships, apprenticeships transition students from vocational school into the workforce. The lack of standardization and oversight leaves the term "internship" open to broad interpretation. Interns may be high school students, college and university students, or post-graduate adults. These positions may be paid or unpaid and are temporary. Many large corporations, particularly investment banks, have "insights" programs that serve as a pre-internship event numbering a day to a week, either in person or virtually. Typically, an internship consists of an exchange of services for experience between the intern and the organization. Internships are used to determine whether the intern still has an interest in that field after real-life experience. In addition, an internship can be used to build a professional network that can assist with letters of recommendation or lead to future employment opportunities. The benefit of bringing an intern into full-time employment is that they are already familiar with the company, therefore requiring little to no training.
Insights: Many large corporations, particularly investment banks, have "insights" programs that serve as a pre-internship event numbering a day to a week, either in person or virtually. Paid internships are common in professional fields including medicine, architecture, science, engineering, law, business (especially accounting and finance), technology, and advertising. Work experience internships usually occur during the second or third year of schooling. This type of internship is to expand an intern's knowledge both in their school studies and also at the company. The intern is expected to bring ideas and knowledge from school into the company. Work research, virtual research (graduation) or dissertation: This is mostly done by students who are in their final year of school. With this kind of internship, a student does research for a particular company. The company can have something that they feel they need to improve, or the student can choose a topic in the company themselves. The results of the research study will be put in a report and often will have to be presented. Unpaid internships are typically through non-profit charities and think tanks which often have unpaid or volunteer positions. State law and state enforcement agencies may impose requirements on unpaid internship programs under Minimum Wage Act. A program must meet criteria to be properly classified as an unpaid internship. Part of this requirement is proving that the intern is the primary beneficiary of the relationship. Unpaid interns perform work that is not routine and work that company doesn't depend upon. Partially-paid internships is when students are paid in the form of a stipend. Stipends are typically a fixed amount of money that is paid out on a regular basis. Usually, interns that are paid with stipends are paid on a set schedule associated with the organization. Virtual Internship are internships that are done remotely on email, phone, and web communication. This offers flexibility as physical presence isn't required. It still provides the capacity to gain job experience without the conventional requirement of being physically present in an office. Virtual interns generally have the opportunity to work at their own pace. International Internships are internships done in a country other than the one that the country of residence. These internships can either be in person or done remotely.
is that they are already familiar with the company, therefore requiring little to no training. Internships provide current college students with the ability to participate in a field of their choice, allowing them to receive hands-on learning about a particular future career and preparing them for full-time work following graduation. Types Internships exist in a wide variety of industries and settings. An internship can be paid, unpaid, or partially paid (in the form of a stipend). Internships may be part-time or full-time and are usually flexible with students' schedules. A typical internship lasts between one and four months, but can be shorter or longer, depending on the organization involved.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "capital", "employers", "home", "idaho", "level", "major", "metropolitan", "north", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho". | EXACT TITLE in veterinary_animal_services: "Boise, Idaho".
adaboisecapitalemployershomeidaholevelmajormetropolitannorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (24): "among", "approximately", "boise", "campus", "compete", "division", "established", "extension", "falls", "idaho", "later", "opened", "operates", "production", "professional", "public", "represented", "research", "rural", "statewide".... | EXACT TITLE in wedding_events: "University of Idaho". | EXACT TITLE in veterinary_animal_services: "University of Idaho".
amongapproximatelyboisecampuscompetedivisionestablishedextensionfallsidaholateropenedoperatesproductionprofessionalpublicrepresentedresearchruralstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Emergency management
Q1460420 EXACT TITLE 1.000
QID OVERLAP: Q1460420 in wedding_events (tier:branch) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (17): "activities", "affected", "community", "different", "emergency", "events", "federal", "hazards", "local", "management", "needs", "prevention", "professional", "requires", "response", "risk", "search". | EXACT TITLE in veterinary_animal_services: "Emergency management".
activitiesaffectedcommunitydifferentemergencyeventsfederalhazardslocalmanagementneedspreventionprofessionalrequiresresponserisksearch
y occur. Emergency management focuses on destructive events that overwhelm a community's ability to handle on its own, such as hurricanes, pandemics, and terrorism. Professional emergency management activities include search and rescue, providing for the basic needs of affected individuals, and issuing evacuation alerts. The management of disasters requires collaboration between individuals, households, non-governmental organizations, and local, provincial, and federal governments. Although many different terminologies exist globally, the activities of emergency management can be generally categorized into preparedness, response, mitigation, and recovery, although other terms such as disaster risk reduction and prevention are also common.
sters requires collaboration between individuals, households, non-governmental organizations, and local, provincial, and federal governments. Although many different terminologies exist globally, the activities of emergency management can be generally categorized into preparedness, response, mitigation, and recovery, although other terms such as disaster risk reduction and prevention are also common.
Employer responsibilities When an emergency situation occurs, employers may be expected to protect workers from all harm resulting from any potential hazard, including physical, chemical, and biological exposure. An employer should provide pre-emergency training and build an emergency action plan (EAP). Employers should train their employees annually before an emergency action plan is implemented to inform employees of their responsibilities and/or plan of action during emergency situations. The training program should include the types of emergencies that may occur, the appropriate response, evacuation procedure, warning/reporting procedure, and shutdown procedures. Training requirements are different depending on the size of workplace and workforce, processes used, materials handled, available resources and who will be in charge during an emergency. After the emergency action plan is completed, the employer and employees should review the plan carefully and post it in a public area that is accessible to everyone. Phases and personal activities Emergency management consists of five phases: prevention, mitigation, preparedness, response and recovery. Prevention Preventive measures are taken at the domestic and international levels and are designed to provide permanent protection from disasters. The risk of loss of life and injury can be mitigated with good evacuation plans, environmental planning, and design standards.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (30): "activities", "allowing", "building", "certain", "combine", "determine", "developed", "development", "different", "form", "government", "growth", "land", "land-use", "local", "particular", "planning", "policy", "procedure", "property".... | EXACT TITLE in wedding_events: "Zoning". | EXACT TITLE in veterinary_animal_services: "Zoning".
activitiesallowingbuildingcertaincombinedeterminedevelopeddevelopmentdifferentformgovernmentgrowthlandland-uselocalparticularplanningpolicyprocedurepropertyregulationsregulatoryresidentialrulesscaleshapesizesystemsuseszoning
s", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
History The origins of zoning districts can be traced back to antiquity. The ancient walled city was the predecessor for classifying and regulating land, based on use. Outside the city walls were the undesirable functions, which were usually based on noise and smell. The space between the walls is where unsanitary and dangerous activities occurred such as butchering, waste disposal, and brick-firing. Within the walls were civic and religious places, and where the majority of people lived. Beyond distinguishing between urban and non-urban land, most ancient cities further classified land types and uses inside their walls. This was practiced in many regions of the world – for example, in China during the Zhou Dynasty (1046 – 256 BC), in India during the Vedic Era (1500 – 500 BC), and in the military camps that spread throughout the Roman Empire (31 BC – 476 AD). Throughout the Age of Enlightenment and Industrial Revolution, cultural and socio-economic shifts led to the rapid increase in the enforcement and invention of urban regulations. The shifts were informed by a new scientific rationality, the advent of mass production and complex manufacturing, and the subsequent onset of urbanisation. Industry leaving the home reshaped modern cities. The definition of home was tied to the definition of economy, which caused a much greater mixing of uses within the residential quarters of cities. Separation between uses is a feature of many planned cities designed before the advent of zoning. A notable example is Adelaide in South Australia, whose city centre, along with the suburb of North Adelaide, is surrounded on all sides by a park, the Adelaide Park Lands. The park was designed by Colonel William Light in 1836 in order to physically separate the city centre from its suburbs. Low density residential areas surround the park, providing a pleasant walk between work in the city within and the family homes outside. Sir Ebenezer Howard, founder of the garden city movement, cited Adelaide as an example of how green open space could be used to prevent cities from expanding beyond their boundaries and coalescing. His design for an ideal city, published in his 1902 book Garden Cities of To-morrow, envisaged separate concentric rings of public buildings, parks, retail space, residential areas and industrial areas, all surrounded by open space and farmland. All retail activity was to be conducted within a single glass-roofed building, an early concept for the modern shopping centre inspired by the Crystal Palace. However, these planned or ideal cities were static designs embodied in a single masterplan. What was lacking was a regulatory mechanism to allow the city to develop over time, setting guidelines to developers and private citizens over what could be built where.
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (19): "activity", "among", "boise", "business", "college", "compete", "division", "education", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "university", "west". | EXACT TITLE in wedding_events: "Boise State University". | EXACT TITLE in veterinary_animal_services: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationhealthidahoindependentprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (33): "academic", "ada", "board", "boise", "campus", "canyon", "career", "college", "community", "comprehensive", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "north", "population", "primary".... | EXACT TITLE in wedding_events: "College of Western Idaho". | EXACT TITLE in veterinary_animal_services: "College of Western Idaho".
academicadaboardboisecampuscanyoncareercollegecommunitycomprehensivecwidevelopmenteducationgovernedidaholargenampanorthpopulationprimaryprogramspublicreportedresidentsservedsouthweststudentsthroughouttransfertreasure+3
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
B
Q5001891 EXACT TITLE 1.000
QID OVERLAP: Q5001891 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:branch). | SHARED TOKENS (21): "activity", "address", "agencies", "authorization", "business", "conduct", "departments", "determines", "government", "jurisdiction", "license", "licenses", "local", "multiple", "municipalities", "operate", "operating", "permits", "physical", "required".... | EXACT TITLE in wedding_events: "Business license".
activityaddressagenciesauthorizationbusinessconductdepartmentsdeterminesgovernmentjurisdictionlicenselicenseslocalmultiplemunicipalitiesoperateoperatingpermitsphysicalrequiredrequires
tween countries, states, and local municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
al municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
Business licenses are permits issued by government agencies that allow individuals or companies to conduct business within the government's geographical jurisdiction. It is the authorization to start a business issued by the local government. A single jurisdiction often requires multiple licenses that are issued by multiple government departments and agencies. Business licenses vary between countries, states, and local municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
Idaho State University
Q1656608 EXACT TITLE 0.980
QID OVERLAP: Q1656608 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (14): "activity", "among", "campus", "falls", "idaho", "isu", "meridian", "percent", "programs", "public", "research", "students", "twin", "university". | EXACT TITLE in wedding_events: "Idaho State University". | EXACT TITLE in veterinary_animal_services: "Idaho State University".
activityamongcampusfallsidahoisumeridianpercentprogramspublicresearchstudentstwinuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
Idaho State Police
Q5987459 EXACT TITLE 0.980
QID OVERLAP: Q5987459 in wedding_events (tier:evergreen) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (14): "appropriate", "bureau", "created", "creating", "department", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "police", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police".
appropriatebureaucreatedcreatingdepartmentenforcementidaholawlegislaturemunicipalorganizationpolicepublicstatewide
s the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
ress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
Other divisions The Alcohol Beverage Control division ensures all establishments which sell or produce alcohol are properly licensed and conform to the law. The Idaho State Liquor Dispensary maintains a monopoly on the sale of all alcoholic beverages that exceed 16% alcohol by volume.
A
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (34): "activities", "activity", "administration", "administrative", "agencies", "changes", "control", "created", "division", "economic", "education", "enforcement", "environment", "governing", "government", "human", "increase", "influence", "itself", "law"....
activitiesactivityadministrationadministrativeagencieschangescontrolcreateddivisioneconomiceducationenforcementenvironmentgoverninggovernmenthumanincreaseinfluenceitselflawlegalmodelopenedpublicregulationsreviewrulessocialspecializedstructure+4
Administrative law is a division of law governing the activities of executive branch agencies of government. Administrative law includes executive branch rulemaking (executive branch rules are generally referred to as "regulations"), adjudication, and the enforcement of laws.
Scope of administrative law German legal scholarship does not have an agreed-upon definition for public administration. In one sense, administration – more precisely, everything that is subject to administrative law – is conceptualized as being all state activity of a certain type (material definition of public administration). This approach leads to disputes about whether to treat acts of public authority as acts of administration (and therefore executive) even when they are performed by component parts of the state (that is to say, the government) that the law formally classifies as a legislative or a judicial body: For instance, the parliament may impose a fine on one of its members for misbehavior, or a presiding judge may direct a disruptive member of the public to be removed from the viewing gallery. The opposite approach – the formalist definition of public administration – begins its examination by considering all those public authorities intended (judging by their lawful charter, organizational context, internal structure, and performed tasks) to do the work of public administration, and equates their functioning with public administration. There is some danger of circular reasoning, since the formal categorization of the organizational unit may, in turn, derive from some material conception of its function. Some functions that might, in the material view, be seen as not of the executive type, and thus not as belonging to the field of administration (such as the creation of rules with the force of law, which are usually thought of as legislative), would then be held to the standards of administrative law, and not another field of law. This discussion is of seen as being of particular importance when considering the role of administrative law in maintaining the division of government powers. For this purpose, a traditional approach tries negatively to define administration by subtracting those operations of the state which cannot be called administration, namely law-making and adjudication. Using this negative definition, though, requires law-making and adjudication to be defined first, and leaves some activities that are a poor fit for the term "administration", such as the cabinet government's political leadership decisions, within the bounds of the definition. Positive definitions abound, but none has won out over the others, or been entirely convincing to scholars of German administrative law. Nevertheless, certain features may be seen as being characteristic of administration: According to Maurer and Waldhoff, administration is social engineering (exerting influence on the non-state, societal domain) (1), oriented towards some conception of the (ever-changing) public interest (2), that consists of taking action in the present, with a view to engineering the future (3), and that comprises concrete measures to regulate individual cases and to realize particular plans (4). Scholarly treatises of German administrative law are almost always split into two parts: doctrines and rules that can be found across-the-board (allgemeines Verwaltungsrecht); and doctrines and rules that exist only in certain parts of administrative law (German: besonderes Verwaltungsrecht, lit. 'special administrative law') – e.g.
Judicial application The law governing the adjudication of questions of administrative law before the courts of general administrative jurisdiction (German: Verwaltungsgerichte) is the Code on Administrative Courts (German: Verwaltungsgerichtsordnung, abbreviated VwGO), which was enacted in 1960. Though the VwGO was not conceived as a full codification of court process for the courts of general administrative jurisdiction, and VwGO § 173 directs these courts to apply Germany's Code of Civil Procedure wherever the VwGO lacks special rules, proceedings before the courts of general administrative jurisdiction are mostly distinct from civil proceedings before the courts of general jurisdiction. The VwGO also does not apply to the courts of special administrative jurisdiction over tax disputes (German: Finanzgerichte) or over social benefits disputes (German: Sozialgerichte). Italy In Italy, administrative law is known as Diritto amministrativo, a branch of public law whose rules govern the organization of the public administration and the activities of the pursuit of the public interest of the public administration and the relationship between this and the citizens. Its genesis is related to the principle of division of powers of the State.
Land-use planning
Q60738778 QID OVERLAP 0.800
QID OVERLAP: Q60738778 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (49): "applicable", "association", "authority", "behavior", "changes", "cities", "communities", "community", "comprehensive", "conditions", "conservation", "costs", "creating", "depend", "depends", "design", "development", "disposition", "districts", "economic"....
applicableassociationauthoritybehaviorchangescitiescommunitiescommunitycomprehensiveconditionsconservationcostscreatingdependdependsdesigndevelopmentdispositiondistrictseconomicexposurefacilitiesfunctiongoalhealthhumanjurisdictionslandland-usemeans+19
ul, efficient, and attractive environments for present and future generations. Land-use planning in England and Wales is founded on the Town and Country Planning Act 1947, with comparable legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
sposition of land, resources, facilities and services with a view to securing the physical, economic and social efficiency, health and well-being of urban and rural communities. The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
The future of land use planning Due to the increasing discussions in the issues of climate change and global warming, the future of land use planning will be dominated by environmental sustainability themes more than economic convenience. Also, due to the fact that the world is quickly urbanizing, and this massive population growth is mostly occurring in cities in the Global South, some of the assumptions we have formed about land use planning must be reimagined, as common theory and practice is no longer always relevant to those cities that are currently practicing land use planning. See also Academic journals Journal of Transport and Landuse Environment and Planning Journal of land use and Environmental Law Journal of the American Planning Association Planning Theory References Bibliography Barnet, J. (2004). Codifying New Urbanism: How to Reform Municipal Land Development Regulations, Chicago, IL. Southwestern NC Planning and Economic Development Commission, Community Foundation of WNC, & the Lawrence Group Architects of NC, Inc. (2009). Region A Toolbox, A Pilot of the Mountain Landscapes Initiative, Sylva, NC. Walters, David. (2007). Designing Community, Charrettes, Master plans and Form-based Codes, Oxford, UK. Young, Anthony. (1993).
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "name", "nampa", "population", "principal", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannamenampapopulationprincipaluniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Apprenticeship
Q20773771 QID OVERLAP 0.800
QID OVERLAP: Q20773771 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (22): "certification", "complete", "field", "formal", "labor", "level", "license", "on-the-job", "outside", "people", "period", "placement", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "trade"....
certificationcompletefieldformallaborlevellicenseon-the-joboutsidepeopleperiodplacementpotentialpracticepractitionersprofessionalregulatedstudysystemtradetrainingworking
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Length Apprenticeships with a length of 2 years are for persons with weaker school results. The certificate awarded after successfully completing a 2-year apprenticeship is called "Attestation de formation professionnelle" (AFP) in French, "Eidgenössisches Berufsattest" (EBA) in German and "Certificato federale di formazione pratica" (CFP) in Italian. It could be translated as "Attestation of professional formation". Apprenticeship with a length of 3 or 4 years are the most common ones. The certificate awarded after successfully completing a 3 or 4-year apprenticeship is called "Certificat Fédéral de Capacité" (CFC) in French, "Eidgenössisches Fähigkeitszeugnis" (EFZ) in German and "Attestato federale di capacità" (AFC) in Italian. It could be translated as "Federal Certificate of Proficiency". Some crafts, such as electrician, are educated in lengths of 3 and 4 years. In this case, an Electrician with 4 years apprenticeship gets more theoretical background than one with 3 years apprenticeship. Some languages have different names for a craft depending on the length of the apprenticeship; this can be lost in translation. Each of the over 300 nationwide defined vocational profiles has defined framework – conditions as length of education, theoretical and practical learning goals and certification conditions. Age of the apprentices Typically an apprenticeship can commence for individuals once they are aged 15 or 18 after finishing general education. Some apprenticeships have a recommend or required age of 18.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (44): "apply", "appropriate", "authority", "building", "charges", "code", "codes", "compliance", "control", "departments", "design", "district", "electrical", "estate", "facility", "general", "health", "insurance", "intended", "jurisdiction"....
applyappropriateauthoritybuildingchargescodecodescompliancecontroldepartmentsdesigndistrictelectricalestatefacilitygeneralhealthinsuranceintendedjurisdictionlawlevellocalmaterialsmodelnationaloccupancyparticularplanningprivate+14
gdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments. Building Control regularisation charges apply in case work is undertaken which should have had been inspected at the time of the work if this was not done. Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Standards for structure, placement, size, usage, wall assemblies, fenestration size/locations, egress rules, size/location of rooms, foundations, floor assemblies, roof structures/assemblies, energy efficiency, stairs and halls, mechanical, electrical, plumbing, site drainage & storage, appliance, lighting, fixtures standards, occupancy rules, and swimming pool regulations Rules regarding parking and traffic impact Fire code rules to minimize the risk of a fire and to ensure safe evacuation in the event of such an emergency Requirements for earthquake (seismic code), hurricane, flood, and tsunami resistance, especially in disaster prone areas or for very large buildings where a failure would be catastrophic Requirements for specific building uses (for example, storage of flammable substances, or housing a large number of people) Energy provisions and consumption Grandfather clauses: Unless the building is being renovated, the building code usually does not apply to existing buildings. Specifications on components Allowable installation methodologies Minimum and maximum room ceiling heights, exit sizes and location Qualification of individuals or corporations doing the work For high structures, anti-collision markers for the benefit of aircraft Building codes are generally separate from zoning ordinances, but exterior restrictions (such as setbacks) may fall into either category. Designers use building code standards out of substantial reference books during design. Building departments review plans submitted to them before construction, issue permits [or not] and inspectors verify compliance to these standards at the site during construction.
n many countries require engineers to consider the effects of soil liquefaction in the design of new buildings. The building code becomes law of a particular jurisdiction when formally enacted by the appropriate governmental or private authority. Building codes are generally intended to be applied by architects, engineers, interior designers, constructors and regulators but are also used for various purposes by safety inspectors, environmental scientists, real estate developers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
Franchising
Q171947 QID OVERLAP 0.800
QID OVERLAP: Q171947 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (37): "agreement", "brand", "business", "capital", "certain", "chain", "compete", "comply", "conditions", "corporate", "direct", "economic", "expansion", "explicitly", "financial", "growth", "individual", "large", "legal", "liability"....
agreementbrandbusinesscapitalcertainchaincompetecomplyconditionscorporatedirecteconomicexpansionexplicitlyfinancialgrowthindividuallargelegalliabilitylicenseslicensingmarketmeansmodelobligationsownedpracticeproceduresproducts+7
and other rights to sell its branded products and services to a franchisee. In return, the franchisee pays certain fees and agrees to comply with certain obligations, typically set out in a franchise agreement. For the franchisor, use of a franchise system is an alternative business growth strategy, compared to expansion through corporate owned outlets or "chain stores". Adopting a franchise system is a business growth strategy that minimizes the franchisor's capital investment and liability risk. Franchising is rarely an equal partnership, especially in the typical arrangement where the franchisee is an individual, unincorporated partnership or small privately-held corporation, as this ensures the franchisor has substantial legal and/or economic advantages over the franchisee. The usual exception to this rule is when the prospective franchisee is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
sing. History The boom in franchising did not take place until after World War II. Nevertheless, the rudiments of modern franchising date back to the Middle Ages when landowners made franchise-like agreements with tax collectors, who retained a percentage of the money they collected and turned the rest over. The practice ended around 1562, but spread into other endeavors. For example, in 17th-century England, franchisees were granted the right to sponsor markets and fairs or operate ferries. There was little growth in franchising, though, until the mid-19th century, when it appeared in the United States for the first time. One of the first successful American franchising operations was started by an enterprising druggist named John S. Pemberton. In 1886, he concocted a beverage comprising sugar, molasses, spices, and cocaine. Pemberton licensed selected people to bottle and sell the drink, which was an early version of what is now known as Coca-Cola. His was one of the earliest and most successful franchising operations in the United States. The Singer Company implemented a franchising plan in the 1850s to distribute its sewing machines. The operation failed, though, because the company did not earn much money even though the machines sold well. The dealers, who had exclusive rights to their territories, absorbed most of the profits because of deep discounts. Some failed to push Singer products, so competitors were able to outsell the company. Under the existing contract, Singer could neither withdraw rights granted to franchisees nor send in its own salaried representatives. So, the company started repurchasing the rights it had sold. The experiment proved to be a failure. That may have been one of the first times a franchisor failed, but it was by no means the last. Colonel Harland Sanders did not initially succeed in his early efforts at franchising KFC. Still, the Singer venture did not put an end to franchising. Other companies attempted franchising in one form or another after the Singer experience. For example, several decades later, General Motors established a somewhat successful franchising operation in order to raise capital. Perhaps the father of modern franchising, though, is Louis K. Liggett. In 1902, Liggett invited a group of druggists to join a "drug cooperative". As he explained to them, they could increase profits by paying less for their purchases, especially if they set up their own manufacturing company. His idea was to market private-label products. About 40 druggists pooled $4,000 of their own money and adopted the name Rexall. Sales soared, and Rexall became a franchisor. The chain's success set a pattern for other franchisors to follow. Although many business owners did affiliate with cooperative ventures of one type or another, there was little growth in franchising until the early 20th century, and in whatever form franchising existed, it looked nothing like what it is today. As the United States shifted from an agricultural to an industrial economy, manufacturers licensed individuals to sell automobiles, trucks, gasoline, beverages, and a variety of other products. The franchisees did little more than selling the products, though. The sharing of responsibility associated with contemporary franchising arrangement did not exist to a great extent. Consequently, franchising was not a growth industry in the United States. It was not until the 1960s and 1970s that people began to take a close look at the attractiveness of franchising. The concept intrigued people with entrepreneurial spirit.
The United States is a leader in franchising, a position it has held since the 1930s, when it used the approach for fast-food restaurants, food inns and, slightly later, motels at the time of the Great Depression. As of 2005, there were 909,253 established franchised businesses, generating $880.9 billion of output and accounting for 8.1 percent of all private, non-farm jobs. This amounts to 11 million jobs, and 4.4 percent of all private-sector output. Mid-sized franchises like restaurants, gasoline stations and trucking stations involve substantial investment and require all the attention of a businessperson. There are also large franchises like hotels, spas and hospitals, which are discussed further under technological alliances. "No poaching" agreements are prevalent within franchises, thus limiting the ability of employers at one franchise establishment to hire employees at an affiliated franchise.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (29): "business", "capital", "category", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "general", "instead", "limited", "long-term", "management", "operational", "otherwise", "ownership"....
businesscapitalcategorychangescontroldevelopmentexpansionfinancefinancialfinancingfirmsfundgeneralinsteadlimitedlong-termmanagementoperationalotherwiseownershippartnershipsprivateproductspublicratherrolespecializedstrategyworking
l restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
Strategies The strategies private-equity firms may use are as follows, leveraged buyout being the most common. Leveraged buyout Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in wedding_events (tier:branch) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "population", "private".
adaboisecapitaldistricthomeidahojurisdictionlargestlocalmetropolitanpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidahometropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "cities", "idaho", "meridian", "population".
adaamongboisecapitalcitiesidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in wedding_events (tier:branch) and veterinary_animal_services (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "largest", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
P
Q16023913 QID OVERLAP 0.640
QID OVERLAP: Q16023913 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (7): "certification", "educational", "perform", "person", "professional", "public", "trade".
certificationeducationalperformpersonprofessionalpublictrade
Professional certification, trade certification, or professional designation, often called simply certification or qualification, is a designation earned by a person to assure qualification to perform a job or task.
A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
Delivering an assessment based on industry knowledge that is independent from training courses or course providers Granting a time-limited credential to anyone who meets the assessment standards The Institute for Credentialing Excellence (ICE) is a U.S.-based organization that sets standards for the accreditation of personnel certification and certificate programs based on the Standards for Educational and Psychological Testing, a joint publication of the American Educational Research Association (AERA), the American Psychological Association (APA), and the National Council on Measurement in Education (NCME).
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Local ordinance
Q843713 QID OVERLAP 0.580
QID OVERLAP: Q843713 in wedding_events (tier:branch) and veterinary_animal_services (tier:branch). | SHARED TOKENS (4): "government", "law", "local", "ordinance".
governmentlawlocalordinance
A local ordinance is a law issued by a local government such as a municipality, county, parish, prefecture, or the like. Hong Kong In Hong Kong, all laws enacted by the territory's Legislative Council remain to be known as Ordinances (Chinese: 條例; Jyutping: tiu4lai6) after the transfer of the territory's sovereignty to China in 1997.
Japan In Japan, ordinances (条例, jōrei) may be passed by any prefecture or municipality under authority granted by Article 94 of the Constitution. There must generally be a statutory basis for an ordinance, the ordinance must be in compliance with any overlapping statutes (although it may impose a stricter standard or penalty), and the ordinance must be related to the affairs of the local government in question. Ordinances must generally be approved by a local assembly and promulgated by the mayor or governor of the local government in question, who may demand a second vote but may not veto the ordinance. Under the Local Autonomy Law, an ordinance may impose a penalty of up to two years imprisonment and/or 1 million yen in fines, although any penalty under an ordinance must be prescribed in accordance with the Code of Criminal Procedure.
Germany The German Constitution grants the federated states certain exclusive rights including police and public order powers. The 16 state governments delegate many of their responsibilities and powers to local authorities. Local authorities have powers to pass local ordinances (Satzungen) e.g. to determine the use of land, planning questions, public order, emergency and transport issues etc. The ordinance must follow a public disclosure and consultation procedure and then approved by the local assembly as well as the elected representative of the executive (e.g. the mayor). The state authorities or stakeholders, including citizens who can show that they have a sufficiently strong interest to establish standing, may object to the final implementation. If the conflict cannot be resolved, the courts may be asked to rule on whether or not the ordinance is valid or if may strike if it violates state law or the state constitution. Indonesia Japan In Japan, ordinances (条例, jōrei) may be passed by any prefecture or municipality under authority granted by Article 94 of the Constitution. There must generally be a statutory basis for an ordinance, the ordinance must be in compliance with any overlapping statutes (although it may impose a stricter standard or penalty), and the ordinance must be related to the affairs of the local government in question. Ordinances must generally be approved by a local assembly and promulgated by the mayor or governor of the local government in question, who may demand a second vote but may not veto the ordinance. Under the Local Autonomy Law, an ordinance may impose a penalty of up to two years imprisonment and/or 1 million yen in fines, although any penalty under an ordinance must be prescribed in accordance with the Code of Criminal Procedure.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
293 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP293 edges
🌲 EVERGREEN2 edges
0.650
animalassociationcontinuingeducationfoodframeworkhumaninformationmedicalopportunitiesorganizationpersonalproductsprofessionalprogramsrepresentsresearchresourcessupports
SHARED TOKENS (19): "animal", "association", "continuing", "education", "food", "framework", "human", "information", "medical", "opportunities", "organization", "personal", "products", "professional", "programs", "represents", "research", "resources", "supports". | URL->B (1): http://avma.org/. | EXACT TITLE in veterinary_animal_services: "American Veterinary Medical Association".
0.650
administrationagricultureanimalcenterdepartmentdevicesdistributionfeedfoodhumanmeatproductsregulatessafetywork
SHARED TOKENS (15): "administration", "agriculture", "animal", "center", "department", "devices", "distribution", "feed", "food", "human", "meat", "products", "regulates", "safety", "work". | URL->B (1): https://www.fda.gov/animal-veterinary. | EXACT TITLE in veterinary_animal_services: "Center for Veterinary Medicine".
🌿 BRANCH230 edges
0.550
agenciesagricultureanimaldepartmentfederalhealthinspectionnationalorganizationwelfare
SHARED TOKENS (10): "agencies", "agriculture", "animal", "department", "federal", "health", "inspection", "national", "organization", "welfare". | URL->B (1): http://www.aphis.usda.gov/. | EXACT TITLE in veterinary_animal_services: "Animal and Plant Health Inspection Service".
0.550
accommodateboisecenterdistricteventexpansionidaholargestoperatingspace
SHARED TOKENS (10): "accommodate", "boise", "center", "district", "event", "expansion", "idaho", "largest", "operating", "space". | URL->A (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.500
agenciesappropriateauthoritybehaviorbusinessesdepartmentsdirectlyeligibilityemergencyequipmentexperiencefunctiongovernedgovernmenthazardshousingindividualjurisdictionlegallicenses
SHARED TOKENS (38): "agencies", "appropriate", "authority", "behavior", "businesses", "departments", "directly", "eligibility", "emergency", "equipment", "experience", "function", "governed", "government", "hazards", "housing", "individual", "jurisdiction", "legal", "licenses".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyaroundassociatedboisecapitalcontainsdistinctgeographicidahoincorporatesinsteadlandlargestlinkednationalnorthofficialpeople
SHARED TOKENS (32): "agricultural", "agriculture", "approximately", "around", "associated", "boise", "capital", "contains", "distinct", "geographic", "idaho", "incorporates", "instead", "land", "largest", "linked", "national", "north", "official", "people".... | EXACT TITLE in wedding_events: "Idaho". | EXACT TITLE in veterinary_animal_services: "Idaho".
0.500
agricultureanimalbecomecollegecompletecurriculumdegreedepartmentdepartmentsdistincteducationentryfieldinsteadlevelmedicalnorthoutsiderequireschool
SHARED TOKENS (25): "agriculture", "animal", "become", "college", "complete", "curriculum", "degree", "department", "departments", "distinct", "education", "entry", "field", "instead", "level", "medical", "north", "outside", "require", "school".... | EXACT TITLE in veterinary_animal_services: "Veterinary education".
0.500
Kitchen ↗ Q43164 EXACT TITLE
commercialcompletedesigndevelopededucationalequipmentfacilitiesfoodfunctionshealthlargelawmarketofficialspreparationpublicpublic-healthrelatedrequirementsresidential
SHARED TOKENS (24): "commercial", "complete", "design", "developed", "educational", "equipment", "facilities", "food", "functions", "health", "large", "law", "market", "officials", "preparation", "public", "public-health", "related", "requirements", "residential".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addcontrolledcreatecreatesdependdirecteconomicequipmenteventgrowthhealthheathumanlandland-uselevelmanagementphysicalpotentialpractices
SHARED TOKENS (29): "add", "controlled", "create", "creates", "depend", "direct", "economic", "equipment", "event", "growth", "health", "heat", "human", "land", "land-use", "level", "management", "physical", "potential", "practices".... | EXACT TITLE in wedding_events: "Wildfire". | EXACT TITLE in veterinary_animal_services: "Wildfire".
0.500
applicationbrandbuildingbusinesscareerclientcommunicationcorporatedesigndevelopmentdifferentemergencyenvironmenteventeventsformalidentifyingindustryknowledgemanagement
SHARED TOKENS (39): "application", "brand", "building", "business", "career", "client", "communication", "corporate", "design", "development", "different", "emergency", "environment", "event", "events", "formal", "identifying", "industry", "knowledge", "management".... | EXACT TITLE in wedding_events: "Event management".
0.500
affectedaffectsanimalbecomeconditionscontractdistinctdocumentedequipmentevidencefamilyfeedinsidelimitslivestockmultiplenearrestrictionssmalltrade
SHARED TOKENS (21): "affected", "affects", "animal", "become", "conditions", "contract", "distinct", "documented", "equipment", "evidence", "family", "feed", "inside", "limits", "livestock", "multiple", "near", "restrictions", "small", "trade".... | EXACT TITLE in veterinary_animal_services: "Foot-and-mouth disease".
0.500
adaboisecanyoncitieshomeidaholargestmeridianmetropolitannampapercentpopulationtreasurevalleywider
SHARED TOKENS (15): "ada", "boise", "canyon", "cities", "home", "idaho", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley", "wider". | EXACT TITLE in wedding_events: "Boise metropolitan area".
0.500
affectanimalapplicationsconditionscontroldifferentfoodhealthhumanlivestockmanagementmedicalpreventionprofessionalresearchsafetysciencespecializedsupplytechnicians
SHARED TOKENS (26): "affect", "animal", "applications", "conditions", "control", "different", "food", "health", "human", "livestock", "management", "medical", "prevention", "professional", "research", "safety", "science", "specialized", "supply", "technicians".... | EXACT TITLE in veterinary_animal_services: "Veterinary medicine".
0.500
Commissary ↗ Q5152616 EXACT TITLE
administrativeassociatedbuildingextensionfinancialgovernmentjurisdictionnationalofficeofficialofficialsorganizationpolicesuppliestitleuses
SHARED TOKENS (16): "administrative", "associated", "building", "extension", "financial", "government", "jurisdiction", "national", "office", "official", "officials", "organization", "police", "supplies", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
Ballroom ↗ Q805353 EXACT TITLE
buildingbusinessesdesignedeventeventsformalhistoryinsidelargelargestlaterlevelpeoplepersonprimaryprivatepublicroomssoundspace
SHARED TOKENS (22): "building", "businesses", "designed", "event", "events", "formal", "history", "inside", "large", "largest", "later", "level", "people", "person", "primary", "private", "public", "rooms", "sound", "space".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
academicamonganimalcentersdisciplinedistincthumanimportantinstitutionalmechanismmedicalmodelsresearchrolestudyuses
SHARED TOKENS (16): "academic", "among", "animal", "centers", "discipline", "distinct", "human", "important", "institutional", "mechanism", "medical", "models", "research", "role", "study", "uses". | EXACT TITLE in veterinary_animal_services: "Comparative medicine".
0.500
Flood ↗ Q8068 EXACT TITLE
accessagriculturalagricultureavoidbusinessescapacitychangescitiesconditionscontrolscourseenvironmenteventsexceedsfloodhealthhumanincreaseindustryinfluence
SHARED TOKENS (46): "access", "agricultural", "agriculture", "avoid", "businesses", "capacity", "changes", "cities", "conditions", "controls", "course", "environment", "events", "exceeds", "flood", "health", "human", "increase", "industry", "influence".... | EXACT TITLE in wedding_events: "Flood". | EXACT TITLE in veterinary_animal_services: "Flood".
0.500
businessescategorycertaincreatedevelopedeconomichumanindividualinformationlandlawlegallimitedownershippeopleperiodplacepriceprimaryproperty
SHARED TOKENS (24): "businesses", "category", "certain", "create", "developed", "economic", "human", "individual", "information", "land", "law", "legal", "limited", "ownership", "people", "period", "place", "price", "primary", "property".... | EXACT TITLE in wedding_events: "Intellectual property".
0.500
alterappropriatebehaviorbeyondcomplianceenvironmentevidenceformformsgroupidentificationidentifiedinfluenceinformationmarketingneedneedsoutsidepeopleprivate
SHARED TOKENS (29): "alter", "appropriate", "behavior", "beyond", "compliance", "environment", "evidence", "form", "forms", "group", "identification", "identified", "influence", "information", "marketing", "need", "needs", "outside", "people", "private".... | EXACT TITLE in wedding_events: "Social influence".
0.500
ageallowsamongchangescommunicationconditionsdatadatedesigneddifferentdigitalhealthhistoryimprovementsincreasinginformationlargelong-termmeansmedical
SHARED TOKENS (38): "age", "allows", "among", "changes", "communication", "conditions", "data", "date", "designed", "different", "digital", "health", "history", "improvements", "increasing", "information", "large", "long-term", "means", "medical".... | EXACT TITLE in veterinary_animal_services: "Electronic health record".
0.500
approximatelyboardcampuscollegecommunitycomprehensiveidaholakenearnorthpublicrivershowstatusstudentsundergraduatewestern
SHARED TOKENS (17): "approximately", "board", "campus", "college", "community", "comprehensive", "idaho", "lake", "near", "north", "public", "river", "show", "status", "students", "undergraduate", "western". | EXACT TITLE in veterinary_animal_services: "North Idaho College".
0.500
affectsamonganimalassociatedbeginsdifferentexposureformshandlinghistoricallylargenodepeoplereportedriskruralthemtreatment
SHARED TOKENS (18): "affects", "among", "animal", "associated", "begins", "different", "exposure", "forms", "handling", "historically", "large", "node", "people", "reported", "risk", "rural", "them", "treatment". | EXACT TITLE in veterinary_animal_services: "Plague (disease)".
0.500
Poultry ↗ Q178559 EXACT TITLE
animalaroundcommercialcontainingdifferentfamilyfoodgrowthinvolvinglatermarketmeatpeopleplacepracticeprocessproductsrisksmallsource
SHARED TOKENS (23): "animal", "around", "commercial", "containing", "different", "family", "food", "growth", "involving", "later", "market", "meat", "people", "place", "practice", "process", "products", "risk", "small", "source".... | EXACT TITLE in veterinary_animal_services: "Poultry".
0.500
administrationbureaucommunitycontrolleddepartmentdistributionenforcementestablishedfederalgovernmentinvestigationinvolvingjurisdictionlawnationaloperationsratherreportsuses
SHARED TOKENS (19): "administration", "bureau", "community", "controlled", "department", "distribution", "enforcement", "established", "federal", "government", "investigation", "involving", "jurisdiction", "law", "national", "operations", "rather", "reports", "uses". | EXACT TITLE in veterinary_animal_services: "Drug Enforcement Administration".
0.500
Quarantine ↗ Q182899 EXACT TITLE
applicationaroundauthoritybroaderconnectiondifferentdistinctenforcementgovernedgovernmenthealthhistoryintendedlawmedicalpeoplepopulationpowerpracticepublic
SHARED TOKENS (23): "application", "around", "authority", "broader", "connection", "different", "distinct", "enforcement", "governed", "government", "health", "history", "intended", "law", "medical", "people", "population", "power", "practice", "public".... | EXACT TITLE in veterinary_animal_services: "Quarantine".
0.500
Ranch ↗ Q509028 EXACT TITLE
addedadditionalbureaucontrolfarmfederalfeedlandlargelimitedlivestockmanagementoperateoperationsownedpeoplepracticeprivatepropertysize
SHARED TOKENS (26): "added", "additional", "bureau", "control", "farm", "federal", "feed", "land", "large", "limited", "livestock", "management", "operate", "operations", "owned", "people", "practice", "private", "property", "size".... | EXACT TITLE in wedding_events: "Ranch". | EXACT TITLE in veterinary_animal_services: "Ranch".
0.500
Marketing ↗ Q39809 EXACT TITLE
affectedagriculturalassociationbusinessbusinessesconcerningcontractedcreatingdirectlyenvironmentfirmsfoodgovernmentindustrymanagementmarketmarketingmediaplanningprice
SHARED TOKENS (32): "affected", "agricultural", "association", "business", "businesses", "concerning", "contracted", "creating", "directly", "environment", "firms", "food", "government", "industry", "management", "market", "marketing", "media", "planning", "price".... | EXACT TITLE in wedding_events: "Marketing". | EXACT TITLE in veterinary_animal_services: "Marketing".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstcertainconditionscontractestablishedeventfeefinancialformhealthinsurancelargemanagementmeansownershippaymentpersonpolicypossessionprimary
SHARED TOKENS (26): "against", "certain", "conditions", "contract", "established", "event", "fee", "financial", "form", "health", "insurance", "large", "management", "means", "ownership", "payment", "person", "policy", "possession", "primary".... | EXACT TITLE in wedding_events: "Insurance". | EXACT TITLE in veterinary_animal_services: "Insurance".
0.500
Anthrax ↗ Q129104 EXACT TITLE
againstanimalbecomecentercenterscontractedcontrolcoursedependdevelopeddevelopmentdirectlyelsewhereevenexposureformgrouphumanlivestocknorth
SHARED TOKENS (35): "against", "animal", "become", "center", "centers", "contracted", "control", "course", "depend", "developed", "development", "directly", "elsewhere", "even", "exposure", "form", "group", "human", "livestock", "north".... | EXACT TITLE in veterinary_animal_services: "Anthrax".
0.500
applicationsassociatedbeyonddatadevelopmententitieseventsgraphhistoricallyincreasinglyknowledgelearninglinkedmodelnetworksoperatereasoningrelationshipsresearchscience
SHARED TOKENS (26): "applications", "associated", "beyond", "data", "development", "entities", "events", "graph", "historically", "increasingly", "knowledge", "learning", "linked", "model", "networks", "operate", "reasoning", "relationships", "research", "science".... | EXACT TITLE in wedding_events: "Knowledge graph". | EXACT TITLE in veterinary_animal_services: "Knowledge graph".
0.500
Livestock ↗ Q103459 EXACT TITLE
agriculturalagricultureanimalcommercialcommunitieseconomicenvironmentgeneralhealthhumanlaborlivestockmajormeatparticularpracticesproduceproductspublicrole
SHARED TOKENS (23): "agricultural", "agriculture", "animal", "commercial", "communities", "economic", "environment", "general", "health", "human", "labor", "livestock", "major", "meat", "particular", "practices", "produce", "products", "public", "role".... | EXACT TITLE in wedding_events: "Livestock". | EXACT TITLE in veterinary_animal_services: "Livestock".
0.500
agriculturalagricultureamonganimalaroundcannotchangesdevelopedfarmfeedhistoryhorselandlivestockmajormanagementmeatnutritionpartsplace
SHARED TOKENS (26): "agricultural", "agriculture", "among", "animal", "around", "cannot", "changes", "developed", "farm", "feed", "history", "horse", "land", "livestock", "major", "management", "meat", "nutrition", "parts", "place".... | EXACT TITLE in veterinary_animal_services: "Animal husbandry".
0.500
Biology ↗ Q420 EXACT TITLE
agricultureamongapplicationsappliesdiscoverydistributionfunctiongrowthlifemultipleorganizationpopulationrelationshipsscienceselectionsharedstructurestudy
SHARED TOKENS (18): "agriculture", "among", "applications", "applies", "discovery", "distribution", "function", "growth", "life", "multiple", "organization", "population", "relationships", "science", "selection", "shared", "structure", "study". | EXACT TITLE in veterinary_animal_services: "Biology".
0.500
Convention ↗ Q225862 EXACT TITLE
agreementanimalboardcertainconductdifferentexhibitionfieldformalgrouphumanindustrylargelawlegalmediaofficeparticularpeoplepractitioners
SHARED TOKENS (22): "agreement", "animal", "board", "certain", "conduct", "different", "exhibition", "field", "formal", "group", "human", "industry", "large", "law", "legal", "media", "office", "particular", "people", "practitioners".... | EXACT TITLE in wedding_events: "Convention". | EXACT TITLE in veterinary_animal_services: "Convention".
0.500
affectsbehaviorbusinesscertificationcompensationconsumercreatescustomereconomicentryevidenceformgeneralgovernmentgrowthhealthindividualinspectionslawlicense
SHARED TOKENS (46): "affects", "behavior", "business", "certification", "compensation", "consumer", "creates", "customer", "economic", "entry", "evidence", "form", "general", "government", "growth", "health", "individual", "inspections", "law", "license".... | EXACT TITLE in wedding_events: "Occupational licensing".
0.500
Rabies ↗ Q39222 EXACT TITLE
ageamonganimalaroundassociatedcontractingcontrolcostcostsdependsdirectdistancedocumentedevidenceexposuregrouphistoricallyhistoryhumanmedical
SHARED TOKENS (41): "age", "among", "animal", "around", "associated", "contracting", "control", "cost", "costs", "depends", "direct", "distance", "documented", "evidence", "exposure", "group", "historically", "history", "human", "medical".... | EXACT TITLE in veterinary_animal_services: "Rabies".
0.500
Feedlot ↗ Q1400937 EXACT TITLE
addedaffectagriculturalanimalapprovalaroundauthoritycertaincompleteconcentratedcontrolleddifferentdistanceenvironmentfarmfeedfoodgovernmentidentificationincrease
SHARED TOKENS (47): "added", "affect", "agricultural", "animal", "approval", "around", "authority", "certain", "complete", "concentrated", "controlled", "different", "distance", "environment", "farm", "feed", "food", "government", "identification", "increase".... | EXACT TITLE in veterinary_animal_services: "Feedlot".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbusinessescitiesdesigneddirectlyfacilityfunctionlargematerialsmovingpartsproductiontransport
SHARED TOKENS (15): "agriculture", "associated", "building", "businesses", "cities", "designed", "directly", "facility", "function", "large", "materials", "moving", "parts", "production", "transport". | EXACT TITLE in wedding_events: "Warehouse".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
businesscentercontractingcontroleconomicevenfacilityfunctionslaterlegallimitedmanagementoperationalorganizationotherwiseoutsidepracticeprivateprocessprocessing
SHARED TOKENS (26): "business", "center", "contracting", "control", "economic", "even", "facility", "functions", "later", "legal", "limited", "management", "operational", "organization", "otherwise", "outside", "practice", "private", "process", "processing".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
Cat ↗ Q146 EXACT TITLE
aroundcommunicationcontroldeclinedevelopedeventsfamilyhousehumanincreasingnearoccurspopulationrequiringsmallsocialworking
SHARED TOKENS (17): "around", "communication", "control", "decline", "developed", "events", "family", "house", "human", "increasing", "near", "occurs", "population", "requiring", "small", "social", "working". | EXACT TITLE in wedding_events: "Cat". | EXACT TITLE in veterinary_animal_services: "Cat".
0.500
Signage ↗ Q1211272 EXACT TITLE
createddesigndesigneddigitaldistinctdocumentedformgroupinformationinsidemeansnameneweroutsideparticularsizesmallerstreet
SHARED TOKENS (18): "created", "design", "designed", "digital", "distinct", "documented", "form", "group", "information", "inside", "means", "name", "newer", "outside", "particular", "size", "smaller", "street". | EXACT TITLE in wedding_events: "Signage".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesaffectagricultureannuallyapplicationchangesconditionscontrolcreatingdifferentdistributionevidencehistoryhumanindustrylargelargestlayerlimitedlong-term
SHARED TOKENS (31): "activities", "affect", "agriculture", "annually", "application", "changes", "conditions", "control", "creating", "different", "distribution", "evidence", "history", "human", "industry", "large", "largest", "layer", "limited", "long-term".... | EXACT TITLE in wedding_events: "Weather".
0.500
Horse ↗ Q726 EXACT TITLE
activitiesageagricultureallowinganimalapproximatelyaroundbehaviorcategoriescontrolcreatingdevelopeddevelopmentdifferentequipmentfamilyfullgeneralhistoricallyhorse
SHARED TOKENS (37): "activities", "age", "agriculture", "allowing", "animal", "approximately", "around", "behavior", "categories", "control", "creating", "developed", "development", "different", "equipment", "family", "full", "general", "historically", "horse".... | EXACT TITLE in wedding_events: "Horse". | EXACT TITLE in veterinary_animal_services: "Horse".
0.500
accommodateanimalcertificationevenfunctionotherwisepeopleperformpoliciespublicregionregulationsstandardssupporttrainingworking
SHARED TOKENS (16): "accommodate", "animal", "certification", "even", "function", "otherwise", "people", "perform", "policies", "public", "region", "regulations", "standards", "support", "training", "working". | EXACT TITLE in veterinary_animal_services: "Service animal".
0.500
addressingaffectedbuildingcontinuingdirectlyemergencyfoodfullgovernmenthealthimmediateinfrastructurelimitedmanagementneedspeopleresourcesresponsesafetysearch
SHARED TOKENS (24): "addressing", "affected", "building", "continuing", "directly", "emergency", "food", "full", "government", "health", "immediate", "infrastructure", "limited", "management", "needs", "people", "resources", "response", "safety", "search".... | EXACT TITLE in veterinary_animal_services: "Disaster response".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbusinesscommunicationcreatecreatingdevelopeddigitaldirectelectricalexposureforminsidelatermeansoperatespersonpracticeprocessingproduceproduction
SHARED TOKENS (25): "application", "business", "communication", "create", "creating", "developed", "digital", "direct", "electrical", "exposure", "form", "inside", "later", "means", "operates", "person", "practice", "processing", "produce", "production".... | EXACT TITLE in wedding_events: "Photography".
0.500
buildingcodesconductdepartmentdivisioneventhazardsinspectionsintendedoccurspracticespreventionresultssafetystructures
SHARED TOKENS (15): "building", "codes", "conduct", "department", "division", "event", "hazards", "inspections", "intended", "occurs", "practices", "prevention", "results", "safety", "structures". | EXACT TITLE in wedding_events: "Fire safety".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventfoodfull-servicegroupindividualmanagementmodelpracticesprivaterisksafetyservedservesservingspacesstaff
SHARED TOKENS (18): "business", "commercial", "event", "food", "full-service", "group", "individual", "management", "model", "practices", "private", "risk", "safety", "served", "serves", "serving", "spaces", "staff". | EXACT TITLE in wedding_events: "Catering".
0.500
Waste management ↗ EXACT TITLE
activitiesactivityadditionalapproximatelycenterscitiescommercialcontrolledcreateddevelopeddifferentdisposaleconomicenvironmentfoodhealthheathumanincreasinginvolving
SHARED TOKENS (43): "activities", "activity", "additional", "approximately", "centers", "cities", "commercial", "controlled", "created", "developed", "different", "disposal", "economic", "environment", "food", "health", "heat", "human", "increasing", "involving".... | EXACT TITLE in wedding_events: "Waste management".
0.500
Parking ↗ Q267917 EXACT TITLE
aroundcentersdesignfacilitieslandlocalnorthparkingpercentpricerestrictionsroadrulesspacessupportthough
SHARED TOKENS (16): "around", "centers", "design", "facilities", "land", "local", "north", "parking", "percent", "price", "restrictions", "road", "rules", "spaces", "support", "though". | EXACT TITLE in wedding_events: "Parking". | EXACT TITLE in veterinary_animal_services: "Parking".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesagainstagenciescitiesgovernmenthumaninsidelandlargelargestlawnationalpermitrestrictionsrulesshowsspacespacesstructureswater
SHARED TOKENS (20): "activities", "against", "agencies", "cities", "government", "human", "inside", "land", "large", "largest", "law", "national", "permit", "restrictions", "rules", "shows", "space", "spaces", "structures", "water". | EXACT TITLE in wedding_events: "Park". | EXACT TITLE in veterinary_animal_services: "Park".
0.500
Floristry ↗ Q637125 EXACT TITLE
arrangementsbusinesscorporatecreatecreatingdesigndistributioneventeventsgardengeographichandlingimportantindustryknowledgelargelevelmarketmaterialsonline
SHARED TOKENS (36): "arrangements", "business", "corporate", "create", "creating", "design", "distribution", "event", "events", "garden", "geographic", "handling", "important", "industry", "knowledge", "large", "level", "market", "materials", "online".... | EXACT TITLE in wedding_events: "Floristry".
0.500
applicationapplicationsbecomeclientcompletecourseequipmenthouseidentifyingitselflicensedlistnailperformpersonplaceproductsprofessionalsanitationshape
SHARED TOKENS (24): "application", "applications", "become", "client", "complete", "course", "equipment", "house", "identifying", "itself", "licensed", "list", "nail", "perform", "person", "place", "products", "professional", "sanitation", "shape".... | EXACT TITLE in wedding_events: "Nail technician".
0.500
accessaccessibilityamongcertaincommunitiescommunitycomplexcomprehensivecontroldesigneddevelopeddevelopmentdifferentdistributioneducationevenfieldhealthhumanimportant
SHARED TOKENS (55): "access", "accessibility", "among", "certain", "communities", "community", "complex", "comprehensive", "control", "designed", "developed", "development", "different", "distribution", "education", "even", "field", "health", "human", "important".... | EXACT TITLE in wedding_events: "Public health". | EXACT TITLE in veterinary_animal_services: "Public health".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomicenvironmentgrowthincreaselimitedlocalmarketsorganizationoutsidepeoplepotentialpracticesprograms
SHARED TOKENS (24): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "environment", "growth", "increase", "limited", "local", "markets", "organization", "outside", "people", "potential", "practices", "programs".... | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
affectedapproximatelybecomebusinessbusinessescomcompetingdirectoryinformationlatermobileonlineoperatespracticepracticespublicpublishedrevenuereviewreviews
SHARED TOKENS (25): "affected", "approximately", "become", "business", "businesses", "com", "competing", "directory", "information", "later", "mobile", "online", "operates", "practice", "practices", "public", "published", "revenue", "review", "reviews".... | EXACT TITLE in wedding_events: "Yelp". | EXACT TITLE in veterinary_animal_services: "Yelp".
0.500
Housing ↗ Q1247867 EXACT TITLE
accessaddressaffectsamongbecomedemanddepartmentdevelopeddirectdirectlydistincteconomiceducationeligibleemergencyemploymentfoodgoalgovernmenthealth
SHARED TOKENS (55): "access", "address", "affects", "among", "become", "demand", "department", "developed", "direct", "directly", "distinct", "economic", "education", "eligible", "emergency", "employment", "food", "goal", "government", "health".... | EXACT TITLE in wedding_events: "Housing". | EXACT TITLE in veterinary_animal_services: "Housing".
0.500
Vaccination ↗ Q192995 EXACT TITLE
administrationadviceagainstageamongcannotcenterscompensationcontroldistinctevenevidencegeographichealthlargelistsmajormedicalnationalorganization
SHARED TOKENS (36): "administration", "advice", "against", "age", "among", "cannot", "centers", "compensation", "control", "distinct", "even", "evidence", "geographic", "health", "large", "lists", "major", "medical", "national", "organization".... | EXACT TITLE in veterinary_animal_services: "Vaccination".
0.500
activitiesaddedaddressapplybusinessclientcompletecreateddesigneddevelopmentdistinctdocumentationestablishedinfluenceinformationmanagementoperationspracticeprimaryprocess
SHARED TOKENS (30): "activities", "added", "address", "apply", "business", "client", "complete", "created", "designed", "development", "distinct", "documentation", "established", "influence", "information", "management", "operations", "practice", "primary", "process".... | EXACT TITLE in wedding_events: "Project management".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomecommunitydirecthealthinformationinstitutionalinvestigationjurisdictionslinksofficepracticeprimarypriorproductsprofessionalprofessionalsrelatedsafetysciencesupplies
SHARED TOKENS (23): "become", "community", "direct", "health", "information", "institutional", "investigation", "jurisdictions", "links", "office", "practice", "primary", "prior", "products", "professional", "professionals", "related", "safety", "science", "supplies".... | EXACT TITLE in veterinary_animal_services: "Pharmacy".
0.500
Accounting ↗ Q4116214 EXACT TITLE
activitiesanalysisboardbusinessbusinessescostdesigneddevelopedeconomicentitiesfinancialfirmsformsfunctionshistoryhumaninformationmajormanagementoperations
SHARED TOKENS (36): "activities", "analysis", "board", "business", "businesses", "cost", "designed", "developed", "economic", "entities", "financial", "firms", "forms", "functions", "history", "human", "information", "major", "management", "operations".... | EXACT TITLE in wedding_events: "Accounting".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesappropriatearoundconsumercontinuingestablishedeventeventsexhibitiongeneralindustrylatestmarketmarketsonlineopportunitiesproductsprofessionalspublicshow
SHARED TOKENS (24): "activities", "appropriate", "around", "consumer", "continuing", "established", "event", "events", "exhibition", "general", "industry", "latest", "market", "markets", "online", "opportunities", "products", "professionals", "public", "show".... | EXACT TITLE in wedding_events: "Trade show".
0.500
Pet ↗ Q39201 EXACT TITLE
animalgrouphomehousinghumanlargestlivestockownerownerspeoplepersonphysicalpropertyrathersmallersocialstudyworking
SHARED TOKENS (18): "animal", "group", "home", "housing", "human", "largest", "livestock", "owner", "owners", "people", "person", "physical", "property", "rather", "smaller", "social", "study", "working". | EXACT TITLE in wedding_events: "Pet". | EXACT TITLE in veterinary_animal_services: "Pet".
0.500
beyondbusinesscertainchangescompletionconditionsdatademandeconomicemploymentextendsfallsinventorymarketneedperformanceperiodplanrelatedrequire
SHARED TOKENS (28): "beyond", "business", "certain", "changes", "completion", "conditions", "data", "demand", "economic", "employment", "extends", "falls", "inventory", "market", "need", "performance", "period", "plan", "related", "require".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
authoritydocumentitselfjurisdictionslegallicenselicensesorganizationotherwiseperiodpermitplaceprocedurerecordrequirerequired
SHARED TOKENS (16): "authority", "document", "itself", "jurisdictions", "legal", "license", "licenses", "organization", "otherwise", "period", "permit", "place", "procedure", "record", "require", "required". | EXACT TITLE in wedding_events: "Marriage license".
0.500
academicactivitiesageagenciesbeyondcareercollegecontinuingcurriculumdegreedevelopmentdifferentdivisioneconomiceducationextensionfeedformalformsgeneral
SHARED TOKENS (45): "academic", "activities", "age", "agencies", "beyond", "career", "college", "continuing", "curriculum", "degree", "development", "different", "division", "economic", "education", "extension", "feed", "formal", "forms", "general".... | EXACT TITLE in wedding_events: "Continuing education". | EXACT TITLE in veterinary_animal_services: "Continuing education".
0.500
Logistics ↗ Q177777 EXACT TITLE
chaincostsequipmentfacilityfieldfoodinformationmanagementmaterialsmodelmovingneedsoperationalpartsphysicalplanningproductionproductsprofessionalpublic
SHARED TOKENS (26): "chain", "costs", "equipment", "facility", "field", "food", "information", "management", "materials", "model", "moving", "needs", "operational", "parts", "physical", "planning", "production", "products", "professional", "public".... | EXACT TITLE in wedding_events: "Logistics".
0.500
affectagainstcompensationcontractcostcostscreateddesignedevenexpresslyfinancingfundgeneralgroupindividualinsurancelegalliabilitylimitsnuisance
SHARED TOKENS (30): "affect", "against", "compensation", "contract", "cost", "costs", "created", "designed", "even", "expressly", "financing", "fund", "general", "group", "individual", "insurance", "legal", "liability", "limits", "nuisance".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativeboardbusinesscentercostdepartmentdepartmentsdirectenvironmentequipmenteventfacilitiesfacilityfoodformfull-servicefunctiongeneral
SHARED TOKENS (55): "access", "additional", "administrative", "board", "business", "center", "cost", "department", "departments", "direct", "environment", "equipment", "event", "facilities", "facility", "food", "form", "full-service", "function", "general".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstbehaviorconditionsdecisiondirectlydistinctevenindividualinfluenceinformationlimitednetworkoutsideparticularpeoplepersonprocessproofsocialspace
SHARED TOKENS (22): "against", "behavior", "conditions", "decision", "directly", "distinct", "even", "individual", "influence", "information", "limited", "network", "outside", "particular", "people", "person", "process", "proof", "social", "space".... | EXACT TITLE in wedding_events: "Information cascade".
0.500
Sheep ↗ EXACT TITLE
ageagriculturalagricultureamonganimalapplyaroundassociatedcenterdescribinggeographicgrouphistoryhumanimportantlargelargestlifelivestockmajor
SHARED TOKENS (31): "age", "agricultural", "agriculture", "among", "animal", "apply", "around", "associated", "center", "describing", "geographic", "group", "history", "human", "important", "large", "largest", "life", "livestock", "major".... | EXACT TITLE in veterinary_animal_services: "Sheep".
0.500
Dog ↗ Q144 EXACT TITLE
agricultureapproximatelyaroundassociationbehaviorcommunicationdevelopeddevelopmentenvironmentformhousehumaninfluencemovementspeopleperformphysicalpolicepopulationpossess
SHARED TOKENS (27): "agriculture", "approximately", "around", "association", "behavior", "communication", "developed", "development", "environment", "form", "house", "human", "influence", "movements", "people", "perform", "physical", "police", "population", "possess".... | EXACT TITLE in veterinary_animal_services: "Dog".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesageagenciescanyoncommercialcontrolcreateddevelopedfallsfloodhistoryhumanidahoimportantlakelargelargestlimitedmajornational
SHARED TOKENS (35): "activities", "age", "agencies", "canyon", "commercial", "control", "created", "developed", "falls", "flood", "history", "human", "idaho", "important", "lake", "large", "largest", "limited", "major", "national".... | EXACT TITLE in wedding_events: "Snake River".
0.500
centerscommunicationcontrolhealthincreaseinformationknowledgeorganizationpracticepreventionpublicreportreportingroletechnology
SHARED TOKENS (15): "centers", "communication", "control", "health", "increase", "information", "knowledge", "organization", "practice", "prevention", "public", "report", "reporting", "role", "technology". | EXACT TITLE in veterinary_animal_services: "Disease surveillance".
0.500
One Health ↗ Q7092706 EXACT TITLE
addressaddressingagricultureamonganimalavoidcommunitiescomprehensivedevelopeddevelopmentenvironmentevidencefoodgrouphealthhumanincreasingindependentintegratedlevel
SHARED TOKENS (41): "address", "addressing", "agriculture", "among", "animal", "avoid", "communities", "comprehensive", "developed", "development", "environment", "evidence", "food", "group", "health", "human", "increasing", "independent", "integrated", "level".... | EXACT TITLE in veterinary_animal_services: "One Health".
0.500
additionalapproximatelyassociateboardboisecertificatescollegecommunitycomprehensivefallsgovernedidaholargenorthprogramspublicregionsciencestudentstwin
SHARED TOKENS (23): "additional", "approximately", "associate", "board", "boise", "certificates", "college", "community", "comprehensive", "falls", "governed", "idaho", "large", "north", "programs", "public", "region", "science", "students", "twin".... | EXACT TITLE in veterinary_animal_services: "College of Southern Idaho".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectioncreatingeventexperiencefoodimportantintegratedlocalmeansnationalplacepracticesource
SHARED TOKENS (18): "agriculture", "among", "associated", "communities", "community", "connection", "creating", "event", "experience", "food", "important", "integrated", "local", "means", "national", "place", "practice", "source". | EXACT TITLE in wedding_events: "Festival".
0.500
agriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyfederalfoodgovernmentlargestlivestocknationalneedsnutritionproductionprogramprogramsreports
SHARED TOKENS (25): "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "federal", "food", "government", "largest", "livestock", "national", "needs", "nutrition", "production", "program", "programs", "reports".... | EXACT TITLE in veterinary_animal_services: "United States Department of Agriculture".
0.500
activitiesaffectanimalbehaviorevenfoodformalformshistoryhumanlifequalityresearchsciencestandardsstudythereforetreatusesview
SHARED TOKENS (21): "activities", "affect", "animal", "behavior", "even", "food", "formal", "forms", "history", "human", "life", "quality", "research", "science", "standards", "study", "therefore", "treat", "uses", "view".... | EXACT TITLE in veterinary_animal_services: "Animal welfare".
0.500
advicecreatecustomerexperienceidentifiedincreaseindustryneedsorganizationparticularpersonpersonnelpoliciesproductsqualitystandardsuses
SHARED TOKENS (17): "advice", "create", "customer", "experience", "identified", "increase", "industry", "needs", "organization", "particular", "person", "personnel", "policies", "products", "quality", "standards", "uses". | EXACT TITLE in wedding_events: "Customer service".
0.500
Raccoon ↗ Q121439 EXACT TITLE
againstanimalbehaviorcannotcitiesdistinguishenvironmentevidencefamilyhomelargestlifelistnorthpotentialrelatedshowsocialsurroundingthem
SHARED TOKENS (21): "against", "animal", "behavior", "cannot", "cities", "distinguish", "environment", "evidence", "family", "home", "largest", "life", "list", "north", "potential", "related", "show", "social", "surrounding", "them".... | EXACT TITLE in veterinary_animal_services: "Raccoon".
0.500
Tent ↗ Q170544 EXACT TITLE
attachedcategoriescitiesexperienceincreasinglyintendedlargelinkedmultiplenearpeoplepersonsheltersizesmallsmallerstructuressupportingtemporarytype
SHARED TOKENS (20): "attached", "categories", "cities", "experience", "increasingly", "intended", "large", "linked", "multiple", "near", "people", "person", "shelter", "size", "small", "smaller", "structures", "supporting", "temporary", "type". | EXACT TITLE in wedding_events: "Tent". | EXACT TITLE in veterinary_animal_services: "Tent".
0.500
businesscommunityentitiesexpensesfinancegeneratelocalnonprofitoperatedoperatesoperationsorganizationownerspersonprivateprogrampublicratherreceiverevenue
SHARED TOKENS (22): "business", "community", "entities", "expenses", "finance", "generate", "local", "nonprofit", "operated", "operates", "operations", "organization", "owners", "person", "private", "program", "public", "rather", "receive", "revenue".... | EXACT TITLE in veterinary_animal_services: "Nonprofit organization".
0.500
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingconcentratedcoursedifferenteveneventsfoodformformallargepeoplesocialthem
SHARED TOKENS (15): "additional", "among", "building", "concentrated", "course", "different", "even", "events", "food", "form", "formal", "large", "people", "social", "them". | EXACT TITLE in wedding_events: "Banquet".
0.500
administrationadviceanimalassociatedauthorityconsentcontrolcurrentdepartmentdevicesdirectlyfederalfeedfieldfoodhealthhumanmedicalprimaryproducts
SHARED TOKENS (28): "administration", "advice", "animal", "associated", "authority", "consent", "control", "current", "department", "devices", "directly", "federal", "feed", "field", "food", "health", "human", "medical", "primary", "products".... | EXACT TITLE in veterinary_animal_services: "Food and Drug Administration".
0.490
approximatelyboisecentercomplexidahonampawest
SHARED TOKENS (7): "approximately", "boise", "center", "complex", "idaho", "nampa", "west". | URL->A (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.480
Mink ↗ Q17700 EXACT TITLE
animalcontroldeclineestablishedfamilymedicalnorthpreserveproductsrelatedthoughtreattreatmentwelfare
SHARED TOKENS (14): "animal", "control", "decline", "established", "family", "medical", "north", "preserve", "products", "related", "though", "treat", "treatment", "welfare". | EXACT TITLE in veterinary_animal_services: "Mink".
0.480
Resort ↗ Q875157 EXACT TITLE
activitiescommercialcontainingfoodmeansneedsnorthoperatedownedownershippeoplepremisesresorttype
SHARED TOKENS (14): "activities", "commercial", "containing", "food", "means", "needs", "north", "operated", "owned", "ownership", "people", "premises", "resort", "type". | EXACT TITLE in wedding_events: "Resort". | EXACT TITLE in veterinary_animal_services: "Resort".
0.480
Concert ↗ Q182832 EXACT TITLE
equipmenteventindoorlargelargestoutdoorperformperformanceprivateprofessionalrequireshowsmallsupport
SHARED TOKENS (14): "equipment", "event", "indoor", "large", "largest", "outdoor", "perform", "performance", "private", "professional", "require", "show", "small", "support". | EXACT TITLE in wedding_events: "Concert".
0.480
Zoo ↗ Q43501 EXACT TITLE
animalannuallybehaviorconditionsconservationexhibitionfacilitygardenhousingopenedpeoplepublicstudywelfare
SHARED TOKENS (14): "animal", "annually", "behavior", "conditions", "conservation", "exhibition", "facility", "garden", "housing", "opened", "people", "public", "study", "welfare". | EXACT TITLE in veterinary_animal_services: "Zoo".
0.480
clientdesigndifferentdocumentationeventindustrylargestmanagementplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (14): "client", "design", "different", "documentation", "event", "industry", "largest", "management", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.480
becomecommercialdigitaldirectdistinctionfieldhistoricallylocalmediamovingnewsproductionstoragework
SHARED TOKENS (14): "become", "commercial", "digital", "direct", "distinction", "field", "historically", "local", "media", "moving", "news", "production", "storage", "work". | EXACT TITLE in wedding_events: "Videography".
0.460
Downtown ↗ Q1050303 EXACT TITLE
businesscentercommercialconcentrateddistrictemploymentgeographicnorthofficepopulationpublicsmallsmaller
SHARED TOKENS (13): "business", "center", "commercial", "concentrated", "district", "employment", "geographic", "north", "office", "population", "public", "small", "smaller". | EXACT TITLE in wedding_events: "Downtown".
0.460
agenciesbusinessescapitalfinancialformsfundraisingidentificationnonprofitonlineprocesssolicitationsourcesthough
SHARED TOKENS (13): "agencies", "businesses", "capital", "financial", "forms", "fundraising", "identification", "nonprofit", "online", "process", "solicitation", "sources", "though". | EXACT TITLE in wedding_events: "Fundraising". | EXACT TITLE in veterinary_animal_services: "Fundraising".
0.460
affectaffectedaffectsamonganimalbecomeclassificationlimitedlinkedpotentialprimaryproductionunderlying
SHARED TOKENS (13): "affect", "affected", "affects", "among", "animal", "become", "classification", "limited", "linked", "potential", "primary", "production", "underlying". | EXACT TITLE in veterinary_animal_services: "Avian influenza".
0.450
administrationanimalbehaviorcertaincontrolfieldhomemajorownerpeopleperformedproceduresprocessrequiringsizestaffwider
SHARED TOKENS (17): "administration", "animal", "behavior", "certain", "control", "field", "home", "major", "owner", "people", "performed", "procedures", "process", "requiring", "size", "staff", "wider". | URL->B (1): http://www.navta.net/.
0.440
accommodatebuildingcentercentersdesignedexhibitionlargemajorresortroomsshowstrade
SHARED TOKENS (12): "accommodate", "building", "center", "centers", "designed", "exhibition", "large", "major", "resort", "rooms", "shows", "trade". | EXACT TITLE in wedding_events: "Convention center".
0.440
animalconditionsconservationcontrolhealthmanagementmedicalnutritionpracticespreventionprofessionalrole
SHARED TOKENS (12): "animal", "conditions", "conservation", "control", "health", "management", "medical", "nutrition", "practices", "prevention", "professional", "role". | EXACT TITLE in veterinary_animal_services: "Veterinarian".
0.440
Tularemia ↗ Q153861 EXACT TITLE
affectedarounddirectlyformoccurspeoplepreventionreportedresultssitetreatmentwater
SHARED TOKENS (12): "affected", "around", "directly", "form", "occurs", "people", "prevention", "reported", "results", "site", "treatment", "water". | EXACT TITLE in veterinary_animal_services: "Tularemia".
0.440
academicassumedauthoritycredentialcredentialsdocumentdocumentsidentificationindividualpeoplepublicationrelevant
SHARED TOKENS (12): "academic", "assumed", "authority", "credential", "credentials", "document", "documents", "identification", "individual", "people", "publication", "relevant". | EXACT TITLE in wedding_events: "Credential". | EXACT TITLE in veterinary_animal_services: "Credential".
0.440
Orchard ↗ Q236371 EXACT TITLE
commercialconcentratedfoodgardenlargemaintainedmakesnearproductionscalesmallerwater
SHARED TOKENS (12): "commercial", "concentrated", "food", "garden", "large", "maintained", "makes", "near", "production", "scale", "smaller", "water". | EXACT TITLE in wedding_events: "Orchard".
0.420
Biosecurity ↗ Q803874 EXACT TITLE
agriculturedesigneddifferentfoodhumanlivestockoutsidepeoplepopulationriskwelfare
SHARED TOKENS (11): "agriculture", "designed", "different", "food", "human", "livestock", "outside", "people", "population", "risk", "welfare". | EXACT TITLE in veterinary_animal_services: "Biosecurity".
0.420
Cattle ↗ Q830 EXACT TITLE
eventfarmlargelivestockmeatpartsproductsseparatesmallthemwestern
SHARED TOKENS (11): "event", "farm", "large", "livestock", "meat", "parts", "products", "separate", "small", "them", "western". | EXACT TITLE in veterinary_animal_services: "Cattle".
0.400
academicagriculturalagricultureeconomicfieldpartspracticeprofessionalssciencesocial
SHARED TOKENS (10): "academic", "agricultural", "agriculture", "economic", "field", "parts", "practice", "professionals", "science", "social". | EXACT TITLE in veterinary_animal_services: "Agricultural science".
0.400
Barn ↗ Q1303167 EXACT TITLE
activitiesagriculturalbuildingequipmenthouseintegratedlivestocknorthstoragestructures
SHARED TOKENS (10): "activities", "agricultural", "building", "equipment", "house", "integrated", "livestock", "north", "storage", "structures". | EXACT TITLE in wedding_events: "Barn". | EXACT TITLE in veterinary_animal_services: "Barn".
0.400
acquisitionbusinessconsolidationentitiesfinancialgroupsmallertaxationtransfertreatment
SHARED TOKENS (10): "acquisition", "business", "consolidation", "entities", "financial", "group", "smaller", "taxation", "transfer", "treatment". | EXACT TITLE in wedding_events: "Consolidation (business)". | EXACT TITLE in veterinary_animal_services: "Consolidation (business)".
0.400
Officiant ↗ Q2015874 EXACT TITLE
conductfacilityhealthhumanlawlegallifememorialperformwork
SHARED TOKENS (10): "conduct", "facility", "health", "human", "law", "legal", "life", "memorial", "perform", "work". | EXACT TITLE in wedding_events: "Officiant".
0.400
businessescomlaterpeopleproductsprofessionalreviewreviewssitesites
SHARED TOKENS (10): "businesses", "com", "later", "people", "products", "professional", "review", "reviews", "site", "sites". | EXACT TITLE in veterinary_animal_services: "Review site".
0.380
bookingbusinesscommercialestategroupmanagementprofessionalrealview
SHARED TOKENS (9): "booking", "business", "commercial", "estate", "group", "management", "professional", "real", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.380
Public records ↗ EXACT TITLE
agenciesconductdocumenteddocumentsgovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (9): "agencies", "conduct", "documented", "documents", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in wedding_events: "Public records".
0.380
Cosmetology ↗ EXACT TITLE
applicationcostlicenseoccupationalrequiredschoolspecialtystudytreatment
SHARED TOKENS (9): "application", "cost", "license", "occupational", "required", "school", "specialty", "study", "treatment". | EXACT TITLE in wedding_events: "Cosmetology".
0.380
associationcommunityeventsidahojunenampaprofessionalriverrodeo
SHARED TOKENS (9): "association", "community", "events", "idaho", "june", "nampa", "professional", "river", "rodeo". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.380
agriculturalanimalcommunitieslivestockownerownersplacepolicyshelter
SHARED TOKENS (9): "agricultural", "animal", "communities", "livestock", "owner", "owners", "place", "policy", "shelter". | EXACT TITLE in veterinary_animal_services: "Animal shelter".
0.380
Beer garden ↗ Q857909 EXACT TITLE
attachedcapitalfoodgardenlocaloutdoorremainservedshared
SHARED TOKENS (9): "attached", "capital", "food", "garden", "local", "outdoor", "remain", "served", "shared". | EXACT TITLE in wedding_events: "Beer garden".
0.380
Dairy cattle ↗ Q2915 EXACT TITLE
distinctionhistoricallyindustrylargemeatproduceproductionproductsspecialized
SHARED TOKENS (9): "distinction", "historically", "industry", "large", "meat", "produce", "production", "products", "specialized". | EXACT TITLE in veterinary_animal_services: "Dairy cattle".
0.360
Goat ↗ Q2934 EXACT TITLE
amongaroundfamilylivestockmeatpartsrelatedsouthwest
SHARED TOKENS (8): "among", "around", "family", "livestock", "meat", "parts", "related", "southwest". | EXACT TITLE in veterinary_animal_services: "Goat".
0.360
amongcannotdeterminefamilylawlegallegallyrequirements
SHARED TOKENS (8): "among", "cannot", "determine", "family", "law", "legal", "legally", "requirements". | EXACT TITLE in wedding_events: "Marriage law".
0.360
Cremation ↗ Q207315 EXACT TITLE
disposaldispositionhealthmemorialpartsremainsrisksite
SHARED TOKENS (8): "disposal", "disposition", "health", "memorial", "parts", "remains", "risk", "site". | EXACT TITLE in veterinary_animal_services: "Cremation".
0.360
designedgoalmeatoperationoperationsprincipalproductionuses
SHARED TOKENS (8): "designed", "goal", "meat", "operation", "operations", "principal", "production", "uses". | EXACT TITLE in veterinary_animal_services: "Beef cattle".
0.360
Kennel ↗ Q2724542 EXACT TITLE
buildingmaintainedmaterialsmeanspropertyshelterstructurethough
SHARED TOKENS (8): "building", "maintained", "materials", "means", "property", "shelter", "structure", "though". | EXACT TITLE in veterinary_animal_services: "Kennel".
0.360
citiesconservationdevelopmentenvironmentlegacymaintainspreserveproducts
SHARED TOKENS (8): "cities", "conservation", "development", "environment", "legacy", "maintains", "preserve", "products". | EXACT TITLE in wedding_events: "Historic preservation".
0.360
departmentdevelopmenteconomicidahoinsurancelabortechnologyworkforce
SHARED TOKENS (8): "department", "development", "economic", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in wedding_events: "Idaho Department of Labor". | EXACT TITLE in veterinary_animal_services: "Idaho Department of Labor".
0.340
equipmentgeneralindividualindustrylimitedperiodtemporary
SHARED TOKENS (7): "equipment", "general", "individual", "industry", "limited", "period", "temporary". | EXACT TITLE in wedding_events: "Equipment rental".
0.340
agreementarrangementshomeinfluencepersonremainsselection
SHARED TOKENS (7): "agreement", "arrangements", "home", "influence", "person", "remains", "selection". | EXACT TITLE in wedding_events: "Designated driver".
0.340
functionsgovernmenthealthjurisdictionprofessionalsrecordsstatistics
SHARED TOKENS (7): "functions", "government", "health", "jurisdiction", "professionals", "records", "statistics". | EXACT TITLE in wedding_events: "Vital statistics".
0.340
Restaurant ↗ Q11707 EXACT TITLE
businessfamilyfoodmodelspremisesservedserves
SHARED TOKENS (7): "business", "family", "food", "models", "premises", "served", "serves". | EXACT TITLE in wedding_events: "Restaurant".
0.340
agriculturalanimalcontrolidentificationownershipprocessresearch
SHARED TOKENS (7): "agricultural", "animal", "control", "identification", "ownership", "process", "research". | EXACT TITLE in veterinary_animal_services: "Animal identification".
0.320
businessesformslicenseofficialotherwisepermit
SHARED TOKENS (6): "businesses", "forms", "license", "official", "otherwise", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.320
Rose garden ↗ Q291177 EXACT TITLE
gardenindividuallargestpublicspecializedtype
SHARED TOKENS (6): "garden", "individual", "largest", "public", "specialized", "type". | EXACT TITLE in wedding_events: "Rose garden".
0.320
Baker ↗ Q160131 EXACT TITLE
concentratedheatpersonplaceproductssource
SHARED TOKENS (6): "concentrated", "heat", "person", "place", "products", "source". | EXACT TITLE in wedding_events: "Baker".
0.320
animalcontrolimportantmodelpartsresearch
SHARED TOKENS (6): "animal", "control", "important", "model", "parts", "research". | EXACT TITLE in veterinary_animal_services: "Pseudorabies".
0.320
Brucellosis ↗ Q156050 EXACT TITLE
affectsanimalfunctionhumanlifesmall
SHARED TOKENS (6): "affects", "animal", "function", "human", "life", "small". | EXACT TITLE in veterinary_animal_services: "Brucellosis".
0.320
Use tax ↗ Q17155766 EXACT TITLE
paidpersonalpropertysoldstoragetype
SHARED TOKENS (6): "paid", "personal", "property", "sold", "storage", "type". | EXACT TITLE in wedding_events: "Use tax".
0.320
Wedding ↗ Q49836 EXACT TITLE
authorityincorporatedpeoplepublicreceptionsocial
SHARED TOKENS (6): "authority", "incorporated", "people", "public", "reception", "social". | EXACT TITLE in wedding_events: "Wedding".
0.320
Vineyard ↗ Q22715 EXACT TITLE
itselfplacepracticeproductionsciencestudy
SHARED TOKENS (6): "itself", "place", "practice", "production", "science", "study". | EXACT TITLE in wedding_events: "Vineyard".
0.320
animalmeanspracticeproceduretechnologytreatment
SHARED TOKENS (6): "animal", "means", "practice", "procedure", "technology", "treatment". | EXACT TITLE in veterinary_animal_services: "Artificial insemination".
0.320
Boise River ↗ Q891080 EXACT TITLE
agriculturalapproximatelyboiseidahoriverwestern
SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "river", "western". | EXACT TITLE in wedding_events: "Boise River".
0.300
Elk ↗ Q180404 KW CROSS HIGH
amonganimalarounddistinctdistinguishdistributionevidencefamilyindustrylargelargestlivestockmeatnamenorthoutsidepartsproductionregionshows
SHARED TOKENS (22): "among", "animal", "around", "distinct", "distinguish", "distribution", "evidence", "family", "industry", "large", "largest", "livestock", "meat", "name", "north", "outside", "parts", "production", "region", "shows"....
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
agreementappliesassessedbeyondconsequencescontractcontractscontrolcontrolleddistinctdistinctionemergencyeventeventsfloodgeneralgoverninggovernsintendeditself
SHARED TOKENS (40): "agreement", "applies", "assessed", "beyond", "consequences", "contract", "contracts", "control", "controlled", "distinct", "distinction", "emergency", "event", "events", "flood", "general", "governing", "governs", "intended", "itself"....
0.300
Dairy farming ↗ KW CROSS HIGH
agriculturalagricultureanimalaroundconsequencescontrolcreateddevelopeddirectdisposalexpansionfarmgeneralgrowthhealthheathistoryimportantincreaseindustry
SHARED TOKENS (35): "agricultural", "agriculture", "animal", "around", "consequences", "control", "created", "developed", "direct", "disposal", "expansion", "farm", "general", "growth", "health", "heat", "history", "important", "increase", "industry"....
0.300
agriculturalagricultureanimalassociateddifferentequipmenteventeventsfarmimportantlargestlearninglivestocknorthpracticespublicshowshowstradework
SHARED TOKENS (20): "agricultural", "agriculture", "animal", "associated", "different", "equipment", "event", "events", "farm", "important", "largest", "learning", "livestock", "north", "practices", "public", "show", "shows", "trade", "work".
0.300
addressamongcurrentdatadigitaldominantfirmsgenerallevelmanagementmarketingmediaonlineplatformspotentialpractitionersproductspublicratherreviews
SHARED TOKENS (21): "address", "among", "current", "data", "digital", "dominant", "firms", "general", "level", "management", "marketing", "media", "online", "platforms", "potential", "practitioners", "products", "public", "rather", "reviews"....
0.300
aroundconnectedequipmentfacilitieshumaninfrastructurelargemobilemunicipaloutdoorpersonrequireroomssitessmallsystemtreatmenttype
SHARED TOKENS (18): "around", "connected", "equipment", "facilities", "human", "infrastructure", "large", "mobile", "municipal", "outdoor", "person", "require", "rooms", "sites", "small", "system", "treatment", "type".
0.300
animalcertaincertifiedexemptionsfederalhealthhousingindividualneedpeopleperformpersonpossessproviderreceiverequiredrequirementsrulesspecializedsupport
SHARED TOKENS (20): "animal", "certain", "certified", "exemptions", "federal", "health", "housing", "individual", "need", "people", "perform", "person", "possess", "provider", "receive", "required", "requirements", "rules", "specialized", "support".
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
amongapplicablebeyondcertaincontroldistributioneducationalformformalgroupintendeditselfjurisdictionjurisdictionslargelawlegallicenselimitedmeans
SHARED TOKENS (33): "among", "applicable", "beyond", "certain", "control", "distribution", "educational", "form", "formal", "group", "intended", "itself", "jurisdiction", "jurisdictions", "large", "law", "legal", "license", "limited", "means"....
0.300
administrationagenciesamongapplicantscertaincommercialdifferentfederalgovernmenthealthindividualindustryjurisdictionlicenselicensedlicenseslinksmedicalnationaloccupational
SHARED TOKENS (34): "administration", "agencies", "among", "applicants", "certain", "commercial", "different", "federal", "government", "health", "individual", "industry", "jurisdiction", "license", "licensed", "licenses", "links", "medical", "national", "occupational"....
0.300
academicadministrationbusinesscenterscollegecoursedegreedepartmentfieldindustrymanagementmarketingrelevantschoolstudyuniversity
SHARED TOKENS (16): "academic", "administration", "business", "centers", "college", "course", "degree", "department", "field", "industry", "management", "marketing", "relevant", "school", "study", "university".
0.300
additionaladvancedcategoriesdifferenteconomicfarmgeneralgoalhumanimportantjurisdictionmanagementperformperformedpracticeproceduressystemtreatment
SHARED TOKENS (18): "additional", "advanced", "categories", "different", "economic", "farm", "general", "goal", "human", "important", "jurisdiction", "management", "perform", "performed", "practice", "procedures", "system", "treatment".
0.300
approximatelyboisedatadistrictdistrictsevengovernmenthouseidaholegislaturelimitsnorthpeoplepopulationresidents
SHARED TOKENS (15): "approximately", "boise", "data", "district", "districts", "even", "government", "house", "idaho", "legislature", "limits", "north", "people", "population", "residents".
0.300
becomechaincombinecomplexconsolidationdifferentdirectlydistanceintegratedlargemanagementmarketneedownedownershipproduceproductsratherrelatedriver
SHARED TOKENS (23): "become", "chain", "combine", "complex", "consolidation", "different", "directly", "distance", "integrated", "large", "management", "market", "need", "owned", "ownership", "produce", "products", "rather", "related", "river"....
0.300
ageallowingannuallyappliesapplyauthorizedcertaincommunitycompliancecomplydistributiondistrictfacilityfederalgovernmenthomeimposeindividualinsteadjurisdiction
SHARED TOKENS (50): "age", "allowing", "annually", "applies", "apply", "authorized", "certain", "community", "compliance", "comply", "distribution", "district", "facility", "federal", "government", "home", "impose", "individual", "instead", "jurisdiction"....
0.300
administrationagriculturalanimalcomplianceenvironmentfarmfeedfoodgroupgrowthhealthhumanimportantincreaseindustrylivestockorganizationregulatorysafetystudy
SHARED TOKENS (25): "administration", "agricultural", "animal", "compliance", "environment", "farm", "feed", "food", "group", "growth", "health", "human", "important", "increase", "industry", "livestock", "organization", "regulatory", "safety", "study"....
0.300
accessboisecapitalconnectscontainscreateddepartmentgardenhistoryidaholandmunicipalnorthoperatedregionriverstreetuniversitywestwestern
SHARED TOKENS (20): "access", "boise", "capital", "connects", "contains", "created", "department", "garden", "history", "idaho", "land", "municipal", "north", "operated", "region", "river", "street", "university", "west", "western".
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare". | EXACT TITLE in veterinary_animal_services: "Idaho Department of Health and Welfare".
0.300
animalapproximatelyattachedcontrolexpensesfarmfoodhousingidentificationidentifyingintegratedlargemedicalownersplacesizetechnologyuses
SHARED TOKENS (18): "animal", "approximately", "attached", "control", "expenses", "farm", "food", "housing", "identification", "identifying", "integrated", "large", "medical", "owners", "place", "size", "technology", "uses".
0.300
businesscomcommunicationconnectconnectscreatesdemanddevelopeddevelopmentdigitaldirectdistincteconomicgrouphealthmarketmarketsmedianetworknetworks
SHARED TOKENS (41): "business", "com", "communication", "connect", "connects", "creates", "demand", "developed", "development", "digital", "direct", "distinct", "economic", "group", "health", "market", "markets", "media", "network", "networks"....
0.300
Dog training ↗ Q38490 KW CROSS HIGH
activitiesanalysisanimalapplicationassociationbehaviorconsequencesdevelopedenvironmenteventsformslearninglifeparticularpracticerelationshiptrainingtriggertypeuses
SHARED TOKENS (21): "activities", "analysis", "animal", "application", "association", "behavior", "consequences", "developed", "environment", "events", "forms", "learning", "life", "particular", "practice", "relationship", "training", "trigger", "type", "uses"....
0.300
acquisitionactivitybusinesscapitalcertaincombinecompetitiveconsolidationcontrolcorporatecreatedepartmentdirectentitiesfederalgovernedgovernmentlawlegalmanagement
SHARED TOKENS (35): "acquisition", "activity", "business", "capital", "certain", "combine", "competitive", "consolidation", "control", "corporate", "create", "department", "direct", "entities", "federal", "governed", "government", "law", "legal", "management"....
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activityallowsanimalchaincommercialconditionsdistributionemergencyfacefoodformhumanimportantlaterlifeparticularpeopleproduceproductsrather
SHARED TOKENS (27): "activity", "allows", "animal", "chain", "commercial", "conditions", "distribution", "emergency", "face", "food", "form", "human", "important", "later", "life", "particular", "people", "produce", "products", "rather"....
0.300
affectagriculturalagriculturecommunitiesconnectconservationcontroldistinctionecosystemevenfloodfoodhealthhumanimportantinfluencelandland-uselargelimits
SHARED TOKENS (40): "affect", "agricultural", "agriculture", "communities", "connect", "conservation", "control", "distinction", "ecosystem", "even", "flood", "food", "health", "human", "important", "influence", "land", "land-use", "large", "limits"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
applicationsapproximatelychangesfeedidentifiesincreaseissuelargelivestockmaterialsmechanismoperateoperatesoperationoperationsphysicalprocessproduceproductsrequires
SHARED TOKENS (28): "applications", "approximately", "changes", "feed", "identifies", "increase", "issue", "large", "livestock", "materials", "mechanism", "operate", "operates", "operation", "operations", "physical", "process", "produce", "products", "requires"....
0.300
activitiesanimalassociatedcontainingdetaileddevicesdisposaldistinctemergencyenvironmentfacilitiesgeneralgeneratehealthhomehumaninvolvingmaterialsmedicaloperating
SHARED TOKENS (31): "activities", "animal", "associated", "containing", "detailed", "devices", "disposal", "distinct", "emergency", "environment", "facilities", "general", "generate", "health", "home", "human", "involving", "materials", "medical", "operating"....
0.300
aroundcontainsdifferenthistoryhomehousenonprofitorganizationparticularpeopleperiodpersonphysicalplacementpreservedrolesitesocialstandardssupport
SHARED TOKENS (21): "around", "contains", "different", "history", "home", "house", "nonprofit", "organization", "particular", "people", "period", "person", "physical", "placement", "preserved", "role", "site", "social", "standards", "support"....
0.300
affectamonganimalapplychangescreateddescribesdirectdistributionenvironmenthealthhumanincreaseindividualindustrymodelpeoplepopulationpotentialrelationship
SHARED TOKENS (23): "affect", "among", "animal", "apply", "changes", "created", "describes", "direct", "distribution", "environment", "health", "human", "increase", "individual", "industry", "model", "people", "population", "potential", "relationship"....
0.300
Food truck ↗ KW CROSS HIGH
amongbecomecareercommercialdailydevelopedeconomicfoodincreasinglyindustrylargemajormobileoperationpartspeopleregionalspecialtystreetsurrounding
SHARED TOKENS (24): "among", "become", "career", "commercial", "daily", "developed", "economic", "food", "increasingly", "industry", "large", "major", "mobile", "operation", "parts", "people", "regional", "specialty", "street", "surrounding"....
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
compensationcontractcontractsdifferenteventsexpensesexpresslyforminsuranceitselflawlimitedmedicaloperationownerperformprincipalrelationshiprelevantresponsibilities
SHARED TOKENS (20): "compensation", "contract", "contracts", "different", "events", "expenses", "expressly", "form", "insurance", "itself", "law", "limited", "medical", "operation", "owner", "perform", "principal", "relationship", "relevant", "responsibilities".
0.300
Telehealth ↗ Q46994 KW CROSS HIGH
accessadministrationapplicationapplicationscommunicationconditionsdatadefinesdigitaleducationevenfacilitiesfeedhealthhomeinformationlimitedmanagementmeansmedical
SHARED TOKENS (38): "access", "administration", "application", "applications", "communication", "conditions", "data", "defines", "digital", "education", "even", "facilities", "feed", "health", "home", "information", "limited", "management", "means", "medical"....
0.300
academicbusinessescenterscommercialcomprehensivefacilitieshealthindependentinformationlong-termmanagementmedicaloperateotherwisepreventionresearchsciencesizetreatmentvolume
SHARED TOKENS (20): "academic", "businesses", "centers", "commercial", "comprehensive", "facilities", "health", "independent", "information", "long-term", "management", "medical", "operate", "otherwise", "prevention", "research", "science", "size", "treatment", "volume".
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
citiescontroldepartmentdominantfacilitiesheatintendedjurisdictionslimitedmajormunicipalitiesnorthparkingpeoplepermitrequirerequiressourcesspacessuburban
SHARED TOKENS (23): "cities", "control", "department", "dominant", "facilities", "heat", "intended", "jurisdictions", "limited", "major", "municipalities", "north", "parking", "people", "permit", "require", "requires", "sources", "spaces", "suburban"....
0.300
Calligraphy ↗ Q12681 KW CROSS HIGH
certificatesdesigndocumentsformincorporatesindividuallevelmemorialmovingpracticerelatedtextthoughtypewestern
SHARED TOKENS (15): "certificates", "design", "documents", "form", "incorporates", "individual", "level", "memorial", "moving", "practice", "related", "text", "though", "type", "western".
0.300
accessactivitiesbehaviorbusinessescontrolledcurrentdatadevicesdocumentedevenformgeographicgovernmenthealthindoorinformationissueslifelocalmobile
SHARED TOKENS (35): "access", "activities", "behavior", "businesses", "controlled", "current", "data", "devices", "documented", "even", "form", "geographic", "government", "health", "indoor", "information", "issues", "life", "local", "mobile"....
0.300
Shortage ↗ Q2184645 EXACT TITLE
demandeconomicexceedsmarketsupply
SHARED TOKENS (5): "demand", "economic", "exceeds", "market", "supply". | EXACT TITLE in veterinary_animal_services: "Shortage".
0.300
affectallowingapplicationsbrandbusinessesconnectcostcreatecreatedcustomerdevelopedentryeventimmediateincreasinginfluenceinformationmedianewsonline
SHARED TOKENS (38): "affect", "allowing", "applications", "brand", "businesses", "connect", "cost", "create", "created", "customer", "developed", "entry", "event", "immediate", "increasing", "influence", "information", "media", "news", "online"....
0.300
Dog grooming ↗ Q38479 KW CROSS HIGH
certaincoursedifferenthistoryknowledgelaternailphysicalprocessprofessionalrecordrequirethroughoutworkworking
SHARED TOKENS (15): "certain", "course", "different", "history", "knowledge", "later", "nail", "physical", "process", "professional", "record", "require", "throughout", "work", "working".
0.300
concerningconsolidationcontroldifferentdocumentationinsurancemanagementmaterialsmovepeopleplanningpurchasingroadtraffictransportworking
SHARED TOKENS (16): "concerning", "consolidation", "control", "different", "documentation", "insurance", "management", "materials", "move", "people", "planning", "purchasing", "road", "traffic", "transport", "working".
0.300
academicbecomebehaviorcompetecostsdatedevelopeddevelopmentdevicesdiscoveryfinancialformshomeinformationinputlargelearningmajormediamobile
SHARED TOKENS (41): "academic", "become", "behavior", "compete", "costs", "date", "developed", "development", "devices", "discovery", "financial", "forms", "home", "information", "input", "large", "learning", "major", "media", "mobile"....
0.300
administrationbusinesscapitalcompensationconsolidationcreatingdepartmentsdesigndevelopmentdocumentingfieldhumaninvolvinglabormanagementorganizationpeopleperformanceplanningpolicies
SHARED TOKENS (31): "administration", "business", "capital", "compensation", "consolidation", "creating", "departments", "design", "development", "documenting", "field", "human", "involving", "labor", "management", "organization", "people", "performance", "planning", "policies"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
createdigitalequipmenteveneventsfunctionsinsteadlatermediamobilepersonprivateprogramspublicrealrecordrecordssimultaneouslysmallsoftware
SHARED TOKENS (26): "create", "digital", "equipment", "even", "events", "functions", "instead", "later", "media", "mobile", "person", "private", "programs", "public", "real", "record", "records", "simultaneously", "small", "software"....
0.300
advantagearrangementsbrandbusinesscontractcontractscontroldesigndirectentryfeefunctionsgovernmentindustrylargelicensinglocalmanagementoperatingoperation
SHARED TOKENS (30): "advantage", "arrangements", "brand", "business", "contract", "contracts", "control", "design", "direct", "entry", "fee", "functions", "government", "industry", "large", "licensing", "local", "management", "operating", "operation"....
0.300
authoritybuildingbusinesscapitalcenterscertaincombinecommercialcontainingestatefarmfunctionsgeneratehousingintendedlandlocalmedicalmultipleoffice
SHARED TOKENS (26): "authority", "building", "business", "capital", "centers", "certain", "combine", "commercial", "containing", "estate", "farm", "functions", "generate", "housing", "intended", "land", "local", "medical", "multiple", "office"....
0.300
Animal rights ↗ Q426 KW CROSS HIGH
activityaddressallowinganimalassociatedcannotcentercertaincontractenterfoodformshumanindependentitselflawlegallegallylifemaintains
SHARED TOKENS (36): "activity", "address", "allowing", "animal", "associated", "cannot", "center", "certain", "contract", "enter", "food", "forms", "human", "independent", "itself", "law", "legal", "legally", "life", "maintains"....
0.300
Machine learning ↗ Q2539 KW CROSS HIGH
analysisapproximatelydatadescribingdevelopmentexplicitlyfieldframeworklearningnetworksperformperformancerelatedriskstatisticsstudy
SHARED TOKENS (16): "analysis", "approximately", "data", "describing", "development", "explicitly", "field", "framework", "learning", "networks", "perform", "performance", "related", "risk", "statistics", "study".
0.300
appliesbecomecenterscommunitiesconnectionconservationdocumentseconomicgroupindustryissuesknowledgelegacylegallocalmajornationalphysicalpreservedproperty
SHARED TOKENS (25): "applies", "become", "centers", "communities", "connection", "conservation", "documents", "economic", "group", "industry", "issues", "knowledge", "legacy", "legal", "local", "major", "national", "physical", "preserved", "property"....
0.300
arrangementscreatedesignevidencemarketing
SHARED TOKENS (5): "arrangements", "create", "design", "evidence", "marketing". | EXACT TITLE in wedding_events: "Floral design".
0.300
addaddedadministrationauthoritycontroldevicesfederalfoodforminvestigationlawmedicalnationalprincipalprovisionsrecommendationsregulationsrequirementssafetystudy
SHARED TOKENS (20): "add", "added", "administration", "authority", "control", "devices", "federal", "food", "form", "investigation", "law", "medical", "national", "principal", "provisions", "recommendations", "regulations", "requirements", "safety", "study".
0.300
amonganalysisapplicationcomplexdatadecisiondevelopmenthealthhumaninvolvingissuesmedicalplanningprofessionalspublicregulatoryrelatedsoftwaresupportsystems
SHARED TOKENS (21): "among", "analysis", "application", "complex", "data", "decision", "development", "health", "human", "involving", "issues", "medical", "planning", "professionals", "public", "regulatory", "related", "software", "support", "systems"....
0.300
aroundcompletioneveneventfamilyfoodformnameratherreceivereceivingreceptionseparatesocialwhose
SHARED TOKENS (15): "around", "completion", "even", "event", "family", "food", "form", "name", "rather", "receive", "receiving", "reception", "separate", "social", "whose".
0.300
affectedagenciesallowsassociatedbusinessescapacitycompetitiveconsequencesdeterminedistributioneconomicemploymententryfirmsfunctionimportantindustryissueslandlaw
SHARED TOKENS (34): "affected", "agencies", "allows", "associated", "businesses", "capacity", "competitive", "consequences", "determine", "distribution", "economic", "employment", "entry", "firms", "function", "important", "industry", "issues", "land", "law"....
0.300
activitiesaddressbrandbroaderbusinessbusinessesclientcommunicationcontrolledcorecreatedirecteventeventsexposurefieldfirmsformgovernmentindividual
SHARED TOKENS (54): "activities", "address", "brand", "broader", "business", "businesses", "client", "communication", "controlled", "core", "create", "direct", "event", "events", "exposure", "field", "firms", "form", "government", "individual"....
0.300
consumerfeegeneralinformationmultipleneedsonlineoperatorparticularprimaryprocessproductionproductsprovidersretailerssegmentselectionsitetypewider
SHARED TOKENS (20): "consumer", "fee", "general", "information", "multiple", "needs", "online", "operator", "particular", "primary", "process", "production", "products", "providers", "retailers", "segment", "selection", "site", "type", "wider".
0.300
investigatorslawpersonprivatework
SHARED TOKENS (5): "investigators", "law", "person", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.300
againstanimalconcerningcostsdifferenteducationevenfoodgoverningissueitselfjurisdictionslaterlifemeatpeoplepracticesproductionproductsproperty
SHARED TOKENS (26): "against", "animal", "concerning", "costs", "different", "education", "even", "food", "governing", "issue", "itself", "jurisdictions", "later", "life", "meat", "people", "practices", "production", "products", "property"....
0.300
advancedapplicationsaroundautomaticallycategoryconsumercontainingcontrolsconventionalcreateddigitalexposurefieldformfunctionshistoryincorporatedindustryinsteadlater
SHARED TOKENS (44): "advanced", "applications", "around", "automatically", "category", "consumer", "containing", "controls", "conventional", "created", "digital", "exposure", "field", "form", "functions", "history", "incorporated", "industry", "instead", "later"....
0.300
agenciesbecomecreatedigitalformincreaseincreasinglyindependentmarketingmediamobilemultipleonlineoperatingplaceplatformspotentialpracticesproductsregulation
SHARED TOKENS (29): "agencies", "become", "create", "digital", "form", "increase", "increasingly", "independent", "marketing", "media", "mobile", "multiple", "online", "operating", "place", "platforms", "potential", "practices", "products", "regulation"....
0.300
agenciesconditionscontroldesignestategeneralhumaninfrastructureinvestigationjurisdictionslicenselicensedlicensesmanagementoutdoorplanningpossessprivateproduceprofessional
SHARED TOKENS (26): "agencies", "conditions", "control", "design", "estate", "general", "human", "infrastructure", "investigation", "jurisdictions", "license", "licensed", "licenses", "management", "outdoor", "planning", "possess", "private", "produce", "professional"....
0.300
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciesappliescommunityhumanindustrylargelicensesproductionprofessionalremainrequiredschedulesthemwhosework
SHARED TOKENS (16): "access", "agencies", "applies", "community", "human", "industry", "large", "licenses", "production", "professional", "remain", "required", "schedules", "them", "whose", "work".
0.300
analysiscreatingdatadesigneddevicesdigitaldisciplineequipmentestablishesexposureformsfunctiongraphhiddenindustryinsteadintegratedlimitedmediamedical
SHARED TOKENS (29): "analysis", "creating", "data", "designed", "devices", "digital", "discipline", "equipment", "establishes", "exposure", "forms", "function", "graph", "hidden", "industry", "instead", "integrated", "limited", "media", "medical"....
0.300
Vocational education ↗ KW CROSS HIGH
careercollegecommunitydesignedeconomiceducationeducationalformalformsgeneralindividualinformalknowledgelearninglevellifepersonplacerelatedschool
SHARED TOKENS (27): "career", "college", "community", "designed", "economic", "education", "educational", "formal", "forms", "general", "individual", "informal", "knowledge", "learning", "level", "life", "person", "place", "related", "school"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycertainconservationcreateddifferentestatefacilityfullgovernmenthorseinsteadlandlegallocaloperateotherwiseownerownershippartspeople
SHARED TOKENS (30): "authority", "certain", "conservation", "created", "different", "estate", "facility", "full", "government", "horse", "instead", "land", "legal", "local", "operate", "otherwise", "owner", "ownership", "parts", "people"....
0.300
additionalagricultureanimalexhibitionfacilitiesfacilityfarmfederalhousejurisdictionlawlicenselicensedotherwisepersonpoliciespracticesprimaryprovisionsregulates
SHARED TOKENS (26): "additional", "agriculture", "animal", "exhibition", "facilities", "facility", "farm", "federal", "house", "jurisdiction", "law", "license", "licensed", "otherwise", "person", "policies", "practices", "primary", "provisions", "regulates"....
0.300
activitiesaddressinganimalconservationgoalhousinghumanmedicalprocesspublicrolesciencespecializedtemporarythemtreatmentwelfarework
SHARED TOKENS (18): "activities", "addressing", "animal", "conservation", "goal", "housing", "human", "medical", "process", "public", "role", "science", "specialized", "temporary", "them", "treatment", "welfare", "work".
0.300
accessactivitiesadministrationannouncedassociationcapacitycenterschangescontroldepartmentdesignededucationalfederalfoodfoundinggoalgovernmenthealthhumaninformation
SHARED TOKENS (38): "access", "activities", "administration", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "educational", "federal", "food", "founding", "goal", "government", "health", "human", "information"....
0.300
Brewery ↗ Q131734 KW CROSS HIGH
businesscommercialdistinctequipmenthomeindustrymakesplaceprocessproduceproductionscalesizesocialworkers
SHARED TOKENS (15): "business", "commercial", "distinct", "equipment", "home", "industry", "makes", "place", "process", "produce", "production", "scale", "size", "social", "workers".
0.300
affectedannuallyapplicableapproximatelyassociatedirectlyeconomicevenexposurefoodperiodpriorrequiringresponseresulting
SHARED TOKENS (15): "affected", "annually", "applicable", "approximately", "associate", "directly", "economic", "even", "exposure", "food", "period", "prior", "requiring", "response", "resulting".
0.300
Pre-medical ↗ Q7239245 KW CROSS HIGH
activitiesapplicationcourseworkdegreeeducationeducationalentryexperienceformalmedicalpreparationpriorprocessprofessionalprogramsrequireresearchschoolsimultaneouslystudents
SHARED TOKENS (22): "activities", "application", "coursework", "degree", "education", "educational", "entry", "experience", "formal", "medical", "preparation", "prior", "process", "professional", "programs", "require", "research", "school", "simultaneously", "students"....
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicapplicationassociatedbeyondcommunicationconsolidationconsumercreatingcustomerdemanddesigndevelopmentdifferentdigitaldisciplinedistinctestablishedfieldgrowthhuman
SHARED TOKENS (40): "academic", "application", "associated", "beyond", "communication", "consolidation", "consumer", "creating", "customer", "demand", "design", "development", "different", "digital", "discipline", "distinct", "established", "field", "growth", "human"....
0.300
additionaladdresscertaincomprehensivecontroldifferentestablishedgovernmentjurisdictionslegallevellimitslocalmunicipalnationalnoiseplacepoliceprivatepublic
SHARED TOKENS (28): "additional", "address", "certain", "comprehensive", "control", "different", "established", "government", "jurisdictions", "legal", "level", "limits", "local", "municipal", "national", "noise", "place", "police", "private", "public"....
0.300
applicationsappliescontrolcorporatedifferentdisciplineequipmenteventsinstalloperatepeopleperformancepersonnelproductionshowstechnicianstradework
SHARED TOKENS (18): "applications", "applies", "control", "corporate", "different", "discipline", "equipment", "events", "install", "operate", "people", "performance", "personnel", "production", "shows", "technicians", "trade", "work".
0.300
ageallowingappliesapproximatelyauthorizationautomaticallybeyondcertainconsentgenerallawlegalmedicalpersonrequirethough
SHARED TOKENS (16): "age", "allowing", "applies", "approximately", "authorization", "automatically", "beyond", "certain", "consent", "general", "law", "legal", "medical", "person", "require", "though".
0.300
addresscategoriescommunitiescurrentdevelopedeconomicfinanceformhealthindustrylargestmedicalpercentpersonpowerproductsprofessionalspurchasingrequirementssystem
SHARED TOKENS (21): "address", "categories", "communities", "current", "developed", "economic", "finance", "form", "health", "industry", "largest", "medical", "percent", "person", "power", "products", "professionals", "purchasing", "requirements", "system"....
0.300
ageagenciesanimalapproximatelybehaviorcannotclassificationscommercialconservationcontractcreateddifferentenvironmentfacilitygeneralgrouphandlinghomeinformationissues
SHARED TOKENS (56): "age", "agencies", "animal", "approximately", "behavior", "cannot", "classifications", "commercial", "conservation", "contract", "created", "different", "environment", "facility", "general", "group", "handling", "home", "information", "issues"....
0.300
accessagainstagricultureannuallyassociateddevelopmentdirectlyfundhealthmanagementmultipleoccursorganizationpracticesprimarypublicrequireresearchresourcesthem
SHARED TOKENS (23): "access", "against", "agriculture", "annually", "associated", "development", "directly", "fund", "health", "management", "multiple", "occurs", "organization", "practices", "primary", "public", "require", "research", "resources", "them"....
0.300
aroundconservationdepartmenteducationenforcementfederalfinancialgovernmenthouseindependentinformationlegallevellocalmattersnationaloperationpreventionprogramspublic
SHARED TOKENS (23): "around", "conservation", "department", "education", "enforcement", "federal", "financial", "government", "house", "independent", "information", "legal", "level", "local", "matters", "national", "operation", "prevention", "programs", "public"....
0.300
addressaltercomplexconnectedcontrolleddistinctiondistinguisheventeventsimportantindustryintendedmakesmarketsmultiplepowerprocessingprofessionalpublicsmall
SHARED TOKENS (29): "address", "alter", "complex", "connected", "controlled", "distinction", "distinguish", "event", "events", "important", "industry", "intended", "makes", "markets", "multiple", "power", "processing", "professional", "public", "small"....
0.300
automobilebusinessbusinessescommercialconditionsgeneralinsuranceliabilitymarketmedicaloperationspersonalpoliciespolicypremisesprofessionalpropertypublicrisksseparate
SHARED TOKENS (21): "automobile", "business", "businesses", "commercial", "conditions", "general", "insurance", "liability", "market", "medical", "operations", "personal", "policies", "policy", "premises", "professional", "property", "public", "risks", "separate"....
0.300
addedadditionalapplicableapplyauthoritydemanddistrictfacegeneralgovernedidahoimposelevellocalnationaloverviewpaidparticularpriceproducts
SHARED TOKENS (26): "added", "additional", "applicable", "apply", "authority", "demand", "district", "face", "general", "governed", "idaho", "impose", "level", "local", "national", "overview", "paid", "particular", "price", "products"....
0.300
acquireannouncedcentercreateitselflaternetworknorthoperatesoperatingplansprincipalreportingroadroutesystemtransportationwestwestern
SHARED TOKENS (19): "acquire", "announced", "center", "create", "itself", "later", "network", "north", "operates", "operating", "plans", "principal", "reporting", "road", "route", "system", "transportation", "west", "western".
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adaboisecentercommercialdepartmentfacilityfallsfieldfunctionsgeneralidahoincreasenationaloperatedoperatesreceiverequiringsupportuseswestern
SHARED TOKENS (21): "ada", "boise", "center", "commercial", "department", "facility", "falls", "field", "functions", "general", "idaho", "increase", "national", "operated", "operates", "receive", "requiring", "support", "uses", "western"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesappliesbusinesscategoriescodecommercialconductconsumercreatedistrictemploymententitiesfinancefinancialfinancingfoodframeworkgeneralgoverninginsurance
SHARED TOKENS (44): "activities", "applies", "business", "categories", "code", "commercial", "conduct", "consumer", "create", "district", "employment", "entities", "finance", "financial", "financing", "food", "framework", "general", "governing", "insurance"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesschaincommercialdataindustryinventorylargestmanagementmarketingmobileonlineplatformsprocessingproductssegmentsupplysystemstransfertype
SHARED TOKENS (20): "activities", "business", "chain", "commercial", "data", "industry", "inventory", "largest", "management", "marketing", "mobile", "online", "platforms", "processing", "products", "segment", "supply", "systems", "transfer", "type".
0.300
Zoonosis ↗ Q182672 KW CROSS HIGH
amonganimaldifferentdirectdirectlyhumanimportantmajorparticularpossesspotentialrequirerequiredroleseparatethough
SHARED TOKENS (16): "among", "animal", "different", "direct", "directly", "human", "important", "major", "particular", "possess", "potential", "require", "required", "role", "separate", "though".
0.300
accessibilityactivitiesassociatedbroaderbusinesscategoriescertaindependencedevelopmentdistrictsenvironmentfallsinvolvinglinkslocalmobilitynoisepeoplepropertyrather
SHARED TOKENS (27): "accessibility", "activities", "associated", "broader", "business", "categories", "certain", "dependence", "development", "districts", "environment", "falls", "involving", "links", "local", "mobility", "noise", "people", "property", "rather"....
0.300
Ridesharing company ↗ KW CROSS HIGH
bookingcannotcustomerdemandindependentinsurancejurisdictionlegallylicensinglocalmobilemodelonlineoperateoperationspricingregulationsrequiredrequirementsstreet
SHARED TOKENS (22): "booking", "cannot", "customer", "demand", "independent", "insurance", "jurisdiction", "legally", "licensing", "local", "mobile", "model", "online", "operate", "operations", "pricing", "regulations", "required", "requirements", "street"....
0.300
addressapplicationsbuildingcombinecommercialcommunicationdistancedistributionemergencyequipmenteventsfacilitieshumaninstitutionallargemeansmultiplenamepublicrelated
SHARED TOKENS (33): "address", "applications", "building", "combine", "commercial", "communication", "distance", "distribution", "emergency", "equipment", "events", "facilities", "human", "institutional", "large", "means", "multiple", "name", "public", "related"....
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociatedchaindistributionequipmentfoodfunctioningmanagementparticularpreserveproduceproductionproductsqualityrequiressafetystoragesupplyuses
SHARED TOKENS (21): "activities", "agricultural", "associated", "chain", "distribution", "equipment", "food", "functioning", "management", "particular", "preserve", "produce", "production", "products", "quality", "requires", "safety", "storage", "supply", "uses"....
0.300
amongbuildingcostsdesignedsustainability
SHARED TOKENS (5): "among", "building", "costs", "designed", "sustainability". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.300
Quinceañera ↗ EXACT TITLE
agedifferenteventfoodpractices
SHARED TOKENS (5): "age", "different", "event", "food", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.300
Red fox ↗ Q8332 KW CROSS HIGH
associationcategoriesdistributionfamilyhistoryhumanimportantlargelargestlaterlistnamenorthpartspopulationpriorrelatedrepresentedsizesmall
SHARED TOKENS (24): "association", "categories", "distribution", "family", "history", "human", "important", "large", "largest", "later", "list", "name", "north", "parts", "population", "prior", "related", "represented", "size", "small"....
0.300
activitiesanimalauthoritycontractingcontrolfinancialfoodgeneralhealthinformationinstitutionalmaintainsofficeprimaryproductsregionalriskssafetysupportingsystem
SHARED TOKENS (23): "activities", "animal", "authority", "contracting", "control", "financial", "food", "general", "health", "information", "institutional", "maintains", "office", "primary", "products", "regional", "risks", "safety", "supporting", "system"....
0.300
Epizootiology ↗ Q4115091 KW CROSS HIGH
affectagriculturalanimalappliescontroldistributionenvironmentgoalhealthhumaninvestigationlinkedlivestockpercentpracticepublicrecognizesrolestudysystems
SHARED TOKENS (20): "affect", "agricultural", "animal", "applies", "control", "distribution", "environment", "goal", "health", "human", "investigation", "linked", "livestock", "percent", "practice", "public", "recognizes", "role", "study", "systems".
0.300
addressageamongappliesauthorizationbecomebureaucertainconsentdifferenteconomicemployersentryfallsformalfullfunctionsgeneralindividualissues
SHARED TOKENS (39): "address", "age", "among", "applies", "authorization", "become", "bureau", "certain", "consent", "different", "economic", "employers", "entry", "falls", "formal", "full", "functions", "general", "individual", "issues"....
0.300
Marquee ↗ Q1621931 KW CROSS HIGH
attachedbuildingchainhtmlindoorlargemakesnetworkpageregionalsmallstructuretemporarytexttype
SHARED TOKENS (15): "attached", "building", "chain", "html", "indoor", "large", "makes", "network", "page", "regional", "small", "structure", "temporary", "text", "type".
🫐 BERRY61 edges
0.280
Interior design ↗ KW CROSS HIGH
buildingdesigndevelopmentenvironmentinspectionsmanagementpeopleplanningplansresearchsciencesitespacespaces
SHARED TOKENS (14): "building", "design", "development", "environment", "inspections", "management", "people", "planning", "plans", "research", "science", "site", "space", "spaces".
0.280
Q fever ↗ Q164818 EXACT TITLE
affectsevenperiodresults
SHARED TOKENS (4): "affects", "even", "period", "results". | EXACT TITLE in veterinary_animal_services: "Q fever".
0.280
Skunk ↗ Q43604020 EXACT TITLE
differentfamilynamerelated
SHARED TOKENS (4): "different", "family", "name", "related". | EXACT TITLE in veterinary_animal_services: "Skunk".
0.280
horseinputmobileperformance
SHARED TOKENS (4): "horse", "input", "mobile", "performance". | EXACT TITLE in wedding_events: "Dance floor".
0.280
Decoration ↗ Q1232942 EXACT TITLE
houseincreaseintendedperson
SHARED TOKENS (4): "house", "increase", "intended", "person". | EXACT TITLE in wedding_events: "Decoration".
0.280
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingbusinessescitiescommunitieseconomicgovernmentgrowthhousinginfrastructurelandprivateprocesspublicspaces
SHARED TOKENS (14): "addressing", "businesses", "cities", "communities", "economic", "government", "growth", "housing", "infrastructure", "land", "private", "process", "public", "spaces".
0.280
activitiesbusinessdefinesenvironmentexhibitionsgovernmenthomelimitedorganizationoutsidepaidpeopleprimaryworking
SHARED TOKENS (14): "activities", "business", "defines", "environment", "exhibitions", "government", "home", "limited", "organization", "outside", "paid", "people", "primary", "working".
0.280
animaldifferentdocumentedfacilitiesfunctioninggoalincorporatedlifeplanpopulationresultssocialtreatmenttype
SHARED TOKENS (14): "animal", "different", "documented", "facilities", "functioning", "goal", "incorporated", "life", "plan", "population", "results", "social", "treatment", "type".
0.280
boisecitiesfallshomeidahointerstatemajormemorialmetropolitannearriverrouteservestwin
SHARED TOKENS (14): "boise", "cities", "falls", "home", "idaho", "interstate", "major", "memorial", "metropolitan", "near", "river", "route", "serves", "twin".
0.260
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahometropolitannamepartspopulationschoolsharedwest
SHARED TOKENS (13): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "name", "parts", "population", "school", "shared", "west".
0.260
addressamongapplicationassociationconditionsmedicalperformpreventionspecializedtechnicianstreatmentworkworkers
SHARED TOKENS (13): "address", "among", "application", "association", "conditions", "medical", "perform", "prevention", "specialized", "technicians", "treatment", "work", "workers".
0.260
Pet sitting ↗ Q13414620 KW CROSS HIGH
businesshomeoccursorganizationownerpersonpersonalplaceproviderrequiredspecializedtemporarytraining
SHARED TOKENS (13): "business", "home", "occurs", "organization", "owner", "person", "personal", "place", "provider", "required", "specialized", "temporary", "training".
0.240
Animal science ↗ Q168091 KW CROSS HIGH
animalbroadercontroldegreeexperiencefarmhistoricallylivestockmanagementproductionsciencestudents
SHARED TOKENS (12): "animal", "broader", "control", "degree", "experience", "farm", "historically", "livestock", "management", "production", "science", "students".
0.240
costcostshealthincreasinglyinsurancemarketmedicalownerspersonpoliciestreatmenttype
SHARED TOKENS (12): "cost", "costs", "health", "increasingly", "insurance", "market", "medical", "owners", "person", "policies", "treatment", "type".
0.240
Deer ↗ Q23390 KW CROSS HIGH
activityeconomicfamilyhistorylandmeatrelatedremainsroleseparatethroughoutwater
SHARED TOKENS (12): "activity", "economic", "family", "history", "land", "meat", "related", "remains", "role", "separate", "throughout", "water".
0.240
accuracycustomerexperienceforminsteadonlineproductsprofessionalpurchasingreviewreviewssites
SHARED TOKENS (12): "accuracy", "customer", "experience", "form", "instead", "online", "products", "professional", "purchasing", "review", "reviews", "sites".
0.240
Pet adoption ↗ Q7171565 KW CROSS HIGH
animalcurrentdeterminedifferentfamilyhomemedicalneedownerspurchasingresultssources
SHARED TOKENS (12): "animal", "current", "determine", "different", "family", "home", "medical", "need", "owners", "purchasing", "results", "sources".
0.240
animalgrowthincorporateslivestockmeatpopulationproductionsciencestatisticsthroughoutvaluework
SHARED TOKENS (12): "animal", "growth", "incorporates", "livestock", "meat", "population", "production", "science", "statistics", "throughout", "value", "work".
0.230
currentgovernmentidahooffice
SHARED TOKENS (4): "current", "government", "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.220
adaboisegardengovernmentidahometropolitanmunicipalnamepopulationseparatestreet
SHARED TOKENS (11): "ada", "boise", "garden", "government", "idaho", "metropolitan", "municipal", "name", "population", "separate", "street".
0.220
documentsestategovernmentmaintainsofficeownerownershippropertypublicrealrecords
SHARED TOKENS (11): "documents", "estate", "government", "maintains", "office", "owner", "ownership", "property", "public", "real", "records".
0.220
allowinganimalhealthpracticeproceduresprofessionalprofessionalsrolesystemthroughoutworkers
SHARED TOKENS (11): "allowing", "animal", "health", "practice", "procedures", "professional", "professionals", "role", "system", "throughout", "workers".
0.220
conditionseducationemergencyenforcementenvironmentknowledgepracticespreventionresponsesurroundingthem
SHARED TOKENS (11): "conditions", "education", "emergency", "enforcement", "environment", "knowledge", "practices", "prevention", "response", "surrounding", "them".
0.220
Crowd control ↗ Q1872073 KW CROSS HIGH
controleventsinvolvinglargemanagementparticularpeoplepolicepracticepublicstreet
SHARED TOKENS (11): "control", "events", "involving", "large", "management", "particular", "people", "police", "practice", "public", "street".
0.220
brandbrandingcomplexformsidentificationlargelivestockownersystemthoughwest
SHARED TOKENS (11): "brand", "branding", "complex", "forms", "identification", "large", "livestock", "owner", "system", "though", "west".
0.220
familylaworganizationoutsidepaymentperformperformanceplacepublicpubliclythough
SHARED TOKENS (11): "family", "law", "organization", "outside", "payment", "perform", "performance", "place", "public", "publicly", "though".
0.220
Photo booth ↗ Q494312 EXACT TITLE
containsdigital
SHARED TOKENS (2): "contains", "digital". | EXACT TITLE in wedding_events: "Photo booth".
0.210
Psittacosis ↗ Q164727 EXACT TITLE
human
SHARED TOKENS (1): "human". | EXACT TITLE in veterinary_animal_services: "Psittacosis".
0.210
Fairground ↗ Q5430425 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in wedding_events: "Fairground".
0.200
agreementcertainintendedlicensedlicensinglimitedownersseparateuseswork
SHARED TOKENS (10): "agreement", "certain", "intended", "licensed", "licensing", "limited", "owners", "separate", "uses", "work".
0.200
Animal loss ↗ Q4764951 KW CROSS HIGH
animalbecomeevenevidencehumanindividuallifeotherwiseownerresults
SHARED TOKENS (10): "animal", "become", "even", "evidence", "human", "individual", "life", "otherwise", "owner", "results".
0.200
animalapplicationdiscoveryexaminationimportantmedicalresearchrolesafetyscience
SHARED TOKENS (10): "animal", "application", "discovery", "examination", "important", "medical", "research", "role", "safety", "science".
0.200
Train station ↗ Q55488 KW CROSS HIGH
accommodateboardbuildingfacilitylevelplatformrapidroomssystemstransport
SHARED TOKENS (10): "accommodate", "board", "building", "facility", "level", "platform", "rapid", "rooms", "systems", "transport".
0.180
ageanimalenvironmentexposuremajoroutsidestudytreatmenttype
SHARED TOKENS (9): "age", "animal", "environment", "exposure", "major", "outside", "study", "treatment", "type".
0.180
animalcontrolgovernmenthealthhistoricallyimportantindividualpublicsafety
SHARED TOKENS (9): "animal", "control", "government", "health", "historically", "important", "individual", "public", "safety".
0.180
Pig ↗ Q787 KW CROSS HIGH
animalaroundcitiesdistincthumanlargestmeatnearproducts
SHARED TOKENS (9): "animal", "around", "cities", "distinct", "human", "largest", "meat", "near", "products".
0.160
activitiesapplicationassociationcollegeeducationmedicalprocessrepresents
SHARED TOKENS (8): "activities", "application", "association", "college", "education", "medical", "process", "represents".
0.160
Mobile catering ↗ KW CROSS HIGH
businesscorporateemergencyeventsfoodmobilepeopleperformed
SHARED TOKENS (8): "business", "corporate", "emergency", "events", "food", "mobile", "people", "performed".
0.160
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesignedlargepeopleroutestudentstransportuniversity
SHARED TOKENS (8): "applications", "designed", "large", "people", "route", "students", "transport", "university".
0.160
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargemakesplaceproductionproperty
SHARED TOKENS (8): "building", "business", "equipment", "large", "makes", "place", "production", "property".
0.160
analysisconductdetermineexaminationinvestigationknowledgerequirescience
SHARED TOKENS (8): "analysis", "conduct", "determine", "examination", "investigation", "knowledge", "require", "science".
0.160
applicableauthorizesdistrictlandordinancepermituseszoning
SHARED TOKENS (8): "applicable", "authorizes", "district", "land", "ordinance", "permit", "uses", "zoning".
0.160
Hairstyle ↗ Q327496 KW CROSS HIGH
facehomehumaninfluenceoutsidepersonalshapethough
SHARED TOKENS (8): "face", "home", "human", "influence", "outside", "personal", "shape", "though".
0.160
activitiesapplicationhealthphysicalpublicrelatedsciencesocial
SHARED TOKENS (8): "activities", "application", "health", "physical", "public", "related", "science", "social".
0.160
Equestrianism ↗ KW CROSS HIGH
activitiescompetitivedescriptionhorsetransportationwelfareworkworking
SHARED TOKENS (8): "activities", "competitive", "description", "horse", "transportation", "welfare", "work", "working".
0.160
activitiesdifferentdocumenteventslaterofficialspecialtythroughout
SHARED TOKENS (8): "activities", "different", "document", "events", "later", "official", "specialty", "throughout".
0.160
animalconditionsdesigneddistinctprocedureproceduresresourcessupporting
SHARED TOKENS (8): "animal", "conditions", "designed", "distinct", "procedure", "procedures", "resources", "supporting".
0.140
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainjuneownedpipelineroomsserving
SHARED TOKENS (7): "business", "chain", "june", "owned", "pipeline", "rooms", "serving".
0.140
Wedding cake ↗ Q558133 KW CROSS HIGH
costevenpartsrealreceptionservedwestern
SHARED TOKENS (7): "cost", "even", "parts", "real", "reception", "served", "western".
0.140
analysishomemedicalnorthrequiresspecialtywest
SHARED TOKENS (7): "analysis", "home", "medical", "north", "requires", "specialty", "west".
0.140
categoryestateeventfoodindustryplanningreal
SHARED TOKENS (7): "category", "estate", "event", "food", "industry", "planning", "real".
0.140
additionalbrandchaindevelopmentjunepipelinerooms
SHARED TOKENS (7): "additional", "brand", "chain", "development", "june", "pipeline", "rooms".
0.140
agriculturalcitiesidaholandlargestmajorriver
SHARED TOKENS (7): "agricultural", "cities", "idaho", "land", "largest", "major", "river".
0.140
animalattachedcannothousepreventionratherthem
SHARED TOKENS (7): "animal", "attached", "cannot", "house", "prevention", "rather", "them".
0.140
continuingdepartmentfederalgovernmentmanagementpeopleworking
SHARED TOKENS (7): "continuing", "department", "federal", "government", "management", "people", "working".
0.120
boisebuildingidaholevelnationalopened
SHARED TOKENS (6): "boise", "building", "idaho", "level", "national", "opened".
0.120
lifeoperatesplanningplatformsresourcestechnology
SHARED TOKENS (6): "life", "operates", "planning", "platforms", "resources", "technology".
0.120
againstcreatepotentialthoughtreattreatment
SHARED TOKENS (6): "against", "create", "potential", "though", "treat", "treatment".
0.100
Agritourism ↗ Q1956672 KW CROSS HIGH
activityagriculturefarminvolvingoperation
SHARED TOKENS (5): "activity", "agriculture", "farm", "involving", "operation".
0.100
Bird of prey ↗ Q48428 KW CROSS HIGH
distancefeedgrouppagesmaller
SHARED TOKENS (5): "distance", "feed", "group", "page", "smaller".
0.100
Neutering ↗ Q3482590 KW CROSS HIGH
animallargeownersrequiresystem
SHARED TOKENS (5): "animal", "large", "owners", "require", "system".
◈ Frequently Asked Questions
Wedding Events × Veterinary Animal Services — Treasure Valley
HAIKU · HIGH GATE
Do Boise wedding venues need to comply with health regulations when serving food at events with animals present?
Yes, Ada County health department regulations require all food preparation at wedding events to meet food safety standards regardless of whether animals are on the property. Veterinary animal services in the Treasure Valley coordinate with local health agencies to ensure that livestock or service animals at outdoor wedding celebrations do not compromise food safety protocols.
What zoning permits are required in Boise if a wedding event includes equestrian activities or rodeo demonstrations?
Land-use planning in Boise requires separate zoning permits for events featuring horses or rodeo activities, which fall under both wedding events and veterinary animal services jurisdiction. The City of Boise Planning and Zoning Department works with the Idaho State Police and local veterinary authorities to ensure compliance with animal handling regulations during such public gatherings.
Can College of Western Idaho or Boise State University host wedding events that include working animals or veterinary demonstrations?
Both institutions can host such events, but they must obtain business licenses and coordinate with their institutional veterinary animal services to meet professional health standards. The Treasure Valley's university system requires emergency management protocols when animals are present at public events, particularly for internship programs that involve student participation.
How do Ada County zoning regulations address outdoor wedding ceremonies on properties with active veterinary or livestock operations?
Ada County administrative law allows mixed-use properties to host wedding events on land designated for veterinary or agricultural operations if proper land-use permits are obtained from local government. The Boise metropolitan area requires event organizers to demonstrate that food safety and animal welfare regulations are met when combining wedding activities with professional animal services on the same property.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Wedding Events × Veterinary Animal Services 28 QID bridges 321 edges 8,631 ext links 2026-07-18 00:13:53 UTC 6d02746696384095
Wedding Events corridor ↗ Veterinary Animal Services corridor ↗ Veterinary Animal Services × Wedding Events ↗ boisestandard.org/standard ↗
Parent Corridors
Wedding Events × All Other Verticals