—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Wedding Events ↔ relates to ↔ Biotech Life Sciences

21 Wikipedia bridge articles confirmed in both vertical ledgers. 304 deterministic cross-vertical edges. 8,084 external source links harvested. Every edge provenance-stamped. Every claim auditable.

21 QID Bridge Articles
304 Cross Edges
8,084 External Sources
348 Wikipedia Articles
21 🌲 Evergreen
228 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Wedding Events
× Biotech Life Sciences
QID Bridge Articles
21
confirmed Wikipedia overlap
Total Cross Edges
304
External Sources Harvested
8,084
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise metropolitan area
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (20)
Boise metropolitan areaTreasure ValleyIntellectual propertyIdaho State UniversityUniversity of IdahoBoise State UniversityCollege of Western IdahoBoise, IdahoIdaho Department of LaborBoise RiverIdaho Department of Health and WelfareMergers and acquisitionsOnline marketplacePrivate equityCold chainNampa, IdahoAda County, IdahoCaldwell, IdahoMeridian, IdahoCanyon County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanpublicadacanyoncapitalhomemeridiannampatreasurevalleyagriculturalriverwesternamonguniversitycollegeland
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:08:57 UTC
Content Hash
1578d2db7d46536e
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
21 BRIDGES
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "canyon", "commonly", "designated", "home", "idaho", "meridian", "metropolitan", "nampa", "pacific", "percent", "population", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise metropolitan area". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaboisecanyoncommonlydesignatedhomeidahomeridianmetropolitannampapacificpercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "lower", "metropolitan", "opportunities", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in wedding_events: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocallowermetropolitanopportunitiesregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Intellectual property
Q131257 EXACT TITLE 1.000
QID OVERLAP: Q131257 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (23): "businesses", "category", "certain", "create", "developed", "economic", "human", "individual", "information", "intellectual", "land", "law", "legal", "lower", "modern", "original", "ownership", "people", "property", "rights".... | EXACT TITLE in wedding_events: "Intellectual property". | EXACT TITLE in biotech_life_sciences: "Intellectual property".
businessescategorycertaincreatedevelopedeconomichumanindividualinformationintellectuallandlawlegallowermodernoriginalownershippeoplepropertyrightssystemsthemtrade
egal systems. Supporters of intellectual property laws often describe their main purpose as encouraging the creation of a wide variety of intellectual goods. To achieve this, the law gives people and businesses property rights to certain information and intellectual goods they create, usually for a limited period of time. Supporters argue that because IP laws allow people to protect their original ideas and prevent unauthorized copying, creators derive greater individual economic benefit from the information and intellectual goods they create, and thus have more economic incentives to create them in the first place. Advocates of IP believe that these economic incentives and legal protections stimulate innovation and contribute to technological progress of certain kinds. The intangible nature of intellectual property presents difficulties when compared with traditional property like land or goods. Unlike traditional property, intellectual property is "indivisible", since an unlimited number of people can in theory "consume" an intellectual good without its being depleted. Additionally, investments in intellectual goods suffer from appropriation problems: Landowners can surround their land with a robust fence and hire armed guards to protect it, but producers of information or literature can usually do little to stop their first buyer from replicating it and selling it at a lower price.
A trade secret is a formula, practice, process, design, instrument, pattern, or compilation of information which is not generally known or reasonably ascertainable, by which a business can obtain an economic advantage over competitors and customers. Trade secrets are protected by a combination of state and federal laws, which prescribe a combination of civil and criminal penalties for trade secret "misappropriation"—the improper acquisition, disclosure, or use of a trade secret. Examples of trade secrets include Coca-Cola's formulas for its soft drinks and the WD-40 Company's formula for its lubricant WD-40. Motivation and justification Intellectual property law is mainly intended to encourage the creation of various intellectual goods for consumers by giving people and businesses property rights to the information and intellectual goods they create, usually for a limited period of time. Because they can then profit from them, this creates economic incentives for their creation. The intangible nature of intellectual property presents difficulties when compared with traditional property like land or goods. Unlike traditional property, intellectual property is indivisible—an unlimited number of people can "consume" an intellectual good without it being depleted. Additionally, investments in intellectual goods suffer from problems of appropriation—while a landowner can surround their land with a robust fence and hire armed guards to protect it, a producer of information or an intellectual good can usually do very little to stop their first buyer from replicating it and selling it at a lower price. Balancing rights so that they are strong enough to encourage the creation of information and intellectual goods, but not so strong that they prevent their wide use, is the primary focus of modern intellectual property law. By exchanging limited exclusive rights for disclosure of inventions and creative works, society and rightsholders mutually benefit, and an incentive is created for inventors and authors to create and disclose their works. Some commentators have noted that the objective of intellectual property legislators and supporters of intellectual property laws appears to be "objective protection". "If some intellectual property is desirable because it encourages innovation, they reason, more is better. The thinking is that creators will not have sufficient incentive to invent unless they are legally entitled to capture the full social value of their inventions". This absolute protection or full-value view treats intellectual property as another type of "real" property, typically adopting its law and rhetoric. Other recent developments in intellectual property law, such as the America Invents Act, stress international harmonization. Recently, there has also been much debate over the desirability of using intellectual property rights to protect cultural heritage, including intangible ones, as well as over risks of commodification derived from this possibility.
Economic growth The WIPO treaty and several related international agreements underline that the protection of intellectual property rights is essential to maintaining economic growth. The WIPO Intellectual Property Handbook gives two reasons for intellectual property laws: "One is to give statutory expression to the moral and economic rights of creators in their creations and the rights of the public in access to those creations. The second is to promote, as a deliberate act of Government policy, creativity and the dissemination and application of its results and to encourage fair trading which would contribute to economic and social development." The Anti-Counterfeiting Trade Agreement (ACTA) states that "effective enforcement of intellectual property rights is critical to sustaining economic growth across all industries and globally". Economists estimate that two-thirds of the value of large businesses in the United States can be traced to intangible assets.
Idaho State University
Q1656608 EXACT TITLE 1.000
QID OVERLAP: Q1656608 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (15): "activity", "among", "campus", "classified", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "twin", "universities", "university". | EXACT TITLE in wedding_events: "Idaho State University". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
activityamongcampusclassifiedfallsidahomeridianpercentprogramspublicresearchstudentstwinuniversitiesuniversity
ho, Idaho State offers more than 250 programs at its main campus in Pocatello and locations in Meridian, Idaho Falls, and Twin Falls. It is classified among "R2: Doctoral Universities – High research activity ". More than 12,000 students attend Idaho State, with 57 percent of enrollment female and 43 percent male.
Student government is administered by the Associated Students of Idaho State University (ASISU). Each year a president and vice-president are elected by the student body to administer and oversee a variety of activities either partially or fully funded by tuition-based fees. The ASISU Senate is the association's legislative body. Made up of 20 student members elected by the students of each individual college (allocation of seats being based on enrollment of each college), the ASISU Senate is primarily responsible for allocating the ASISU budget. The Student Activities Board, formerly the ASISU Program Board, oversees most of the student activity programming on campus. The board plans concerts, movie showings, homecoming activities, athletic-related events and other activities generally associated with student life. Reed Gym features recreational facilities, including a climbing wall, swimming pool, tennis courts, and more. The Pond Student Union operates a movie theater, billiard room, and bowling alley, and hosts many student club activities. Fine arts events are regularly featured at the performing arts theater. ISU has more than 140 registered professional, academic, cultural, service and social student organizations. The cultural organizations host some of the largest events on campus with their "Cultural Nights" celebrations. There are currently four fraternity and sorority chapters that are recognized by the university. Students at ISU are represented by the Associated Students of Idaho State University (ASISU). Every year the students elect a president, vice-president, and 20 senators. ASISU has administrative oversight of the 140 student organizations and provides funding to various groups that provide student involvement, leadership and service opportunities and events. Student media on campus includes The Bengal, a weekly student-run newspaper and KISU-FM (91.1). KISU-FM broadcasts from the first floor of the Pond Student Union, serving the university and surrounding communities with alternative music, NPR programming, and live coverage of ISU women athletics. In 2010, KISU-FM and the university developed a monthly public affairs talk show FIRST MONDAY: Idaho State University Forum. The show provides insight into the university's programs, accomplishments and local interests. The Pond Student Union, or SUB, serves as the community center for the university. The SUB consists of three floors that house among other things the campus bookstore, student government and organization offices, Outdoor Adventure Center, craft shop, ISU Credit Union, offices of the Vice President for Student Affairs, bowling alley, movie theater, Veterans Sanctuary, LEAD Center and numerous conference/banquet rooms used for meeting and large scale campus events. The SUB is also home for Campus Connection, a one stop shop for event tickets, photo ID and campus information (282-INFO). The 255,000 square foot, five-level Rendezvous Complex built in 2007 is centrally located on the Idaho State University campus. The complex houses 50 classrooms, ranging from 15-seat seminar rooms to a 250-seat lecture hall. Other facilities in the Rendezvous include a large computer center and a large meeting room with partitions for conversion into three small meeting rooms, 80 student apartments with 301 beds and the Mind's Eye Art Gallery. The Cooperative Wilderness Handicapped Outdoor Group, otherwise known as CW HOG, is a regional self-help group that was formed in 1981 to provide recreational opportunities for people of all abilities. CW HOG is kept going through dedicated volunteers. In August 2010, Reed Gym announced the opening of a new addition, the Student Recreation Center, giving Reed nearly 100,000 square feet of recreational opportunities. Additions include added weight and endurance facilities, additional classrooms and teaching facilities, as well as open and window viewing areas to the four indoor tennis courts.
On March 11, 1901, Governor Frank W. Hunt signed Senate Bill 53, to establish the Academy of Idaho, contingent upon private land donations being made for its site. Theodore F. Turner, mayor of Pocatello, settled the issue (Battle of the Blocks) by securing a permanent location for the academy. The Academy of Idaho officially opened its doors on September 22, 1902. Theodore Swanson, a member of the board of trustees, secured the services of John W. Faris as the first administrator, with the title of principal. By 1910, enrollment had reached nearly 300 students, and the academy had purchased four additional city blocks in Pocatello to meet its growing needs. The Academy of Idaho was renamed Idaho Technical Institute in 1915. The end of World War I brought an influx of students to the school, and enrollment surged to more than 1,000 students. In the early 1920s, the institution officially adopted the Bengal as the school's mascot. Ralph Hutchinson was head football coach from 1920 to 1927, and he pushed to establish the tiger mascot and incorporate orange and black as the official colors. Hutchinson was an alumnus of Princeton, a university with a tiger mascot. The institution was renamed in 1927, this time as the University of Idaho–Southern Branch, and continued as a two-year school, overseen by John R. Nichols. an executive dean. During World War II, Idaho was one of 131 colleges and universities nationally that took part in the V-12 Navy College Training Program, which offered students a path to a Navy commission. After Nichols left in 1946, Carl McIntosh, an associate professor of speech, was named the acting executive dean in January 1947. That March, the school was elevated to four-year status and officially became Idaho State College. At the age of 32, McIntosh was appointed the first president of Idaho State College, and he was one of the youngest college presidents in the United States. Although McIntosh was not originally interested in being an administrator, once the school became an independent college, he decided to remain president and see the institution through its early growing pains. Idaho State College was accredited as a four-year degree granting institution in December 1948, after much work by McIntosh and the faculty. Enrollment reached 2,000 in 1949. McIntosh left ISC in 1959 to become president of Long Beach State College, and he was succeeded by Donald E. Walker. On July 1, 1963, ISC was renamed for the fifth and final time to Idaho State University, reflecting its new status as a four-year public university. In the ensuing years, Idaho State continuously expanded both its enrollment and the programs it offered. The presidency of Richard (Dick) Bowen, from 1985 to 2005, is particularly regarded as an era of growth. Bowen served as the president of Idaho State for 20 years, and Connie, his wife, dedicated her time to cultivating community relationships and enhancing long-standing campus traditions. During their tenure at ISU, the Bowens brought several projects forward, including the Stephens Performing Arts Center and Rendezvous Center. Bowen resigned after a vote of no confidence from the faculty, who were angered by generous pay raises for administration members in the midst of calls for fiscal austerity. Arthur Vailas, former vice chancellor of the University of Houston System and vice president of the University of Houston in Texas, became president of Idaho State on July 1, 2006. He succeeded Michael Gallagher, who had served as interim president for one year during the transition. In February 2011, a majority of ISU faculty voted no confidence in Vailas and called for his resignation. This was also followed by a vote of no confidence by the students. Although Vailas faced mounting criticism and pressure from faculty and students to step down, he refused to resign and campus tension intensified. In February 2011, the Idaho State Board of Education decided to suspend the University's faculty senate. As a result of the move, in June 2011, the American Association of University Professors censured ISU. In June 2019, the AAUP removed Idaho State from the list of sanctioned institutions. Vailas announced his retirement in August 2017, but he continued to serve as president until the expiration of his contract on June 17, 2018. He was succeeded by Kevin D.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (22): "among", "approximately", "boise", "campus", "classified", "division", "established", "extension", "falls", "idaho", "later", "operates", "production", "professional", "public", "represented", "research", "statewide", "students", "uidaho".... | EXACT TITLE in wedding_events: "University of Idaho". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
amongapproximatelyboisecampusclassifieddivisionestablishedextensionfallsidaholateroperatesproductionprofessionalpublicrepresentedresearchstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (22): "activity", "among", "boise", "business", "classified", "college", "division", "education", "engineering", "health", "idaho", "independent", "master", "million", "program", "programs", "public", "reported", "research", "school".... | EXACT TITLE in wedding_events: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboisebusinessclassifiedcollegedivisioneducationengineeringhealthidahoindependentmastermillionprogramprogramspublicreportedresearchschooluniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (26): "academic", "ada", "board", "boise", "campus", "canyon", "college", "community", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "residents", "southwest".... | EXACT TITLE in wedding_events: "College of Western Idaho". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
academicadaboardboisecampuscanyoncollegecommunitydevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Boise, Idaho
Q35775 EXACT TITLE 0.980
QID OVERLAP: Q35775 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "major", "metropolitan", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualboisecapitalemployershomeidahomajormetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Idaho Department of Labor
Q97164075 EXACT TITLE 0.860
QID OVERLAP: Q97164075 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (8): "department", "development", "economic", "idaho", "insurance", "labor", "technology", "workforce". | EXACT TITLE in wedding_events: "Idaho Department of Labor". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
Boise River
Q891080 EXACT TITLE 0.840
QID OVERLAP: Q891080 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "square", "western". | EXACT TITLE in wedding_events: "Boise River". | EXACT TITLE in biotech_life_sciences: "Boise River".
agriculturalapproximatelyboiseidahoriversquarewestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
I
Q30253346 EXACT TITLE 0.800
QID OVERLAP: Q30253346 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
departmenthealthidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (39): "acquisition", "activity", "assets", "business", "capital", "central", "certain", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "effects", "example", "federal", "governed", "government", "law"....
acquisitionactivityassetsbusinesscapitalcentralcertainconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteffectsexamplefederalgovernedgovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershippositionregulatoryrequire+9
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (20): "availability", "consumer", "consumers", "delivered", "general", "information", "multiple", "needs", "online", "operator", "process", "production", "products", "providers", "segment", "selection", "sell", "single", "site", "type".
availabilityconsumerconsumersdeliveredgeneralinformationmultipleneedsonlineoperatorprocessproductionproductsproviderssegmentselectionsellsinglesitetype
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (27): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "finance", "financing", "firms", "general", "instead", "management", "operational", "otherwise", "ownership", "partnerships", "private", "private-equity"....
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancefinancingfirmsgeneralinsteadmanagementoperationalotherwiseownershippartnershipsprivateprivate-equityproductspublicratherrolespecializedstrategyworking
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Cold chain
Q592197 QID OVERLAP 0.800
QID OVERLAP: Q592197 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (20): "activities", "agricultural", "associated", "cold", "distributed", "distribution", "equipment", "food", "logistics", "maintain", "management", "production", "products", "quality", "requires", "safety", "storage", "supply", "uses", "waste".
activitiesagriculturalassociatedcolddistributeddistributionequipmentfoodlogisticsmaintainmanagementproductionproductsqualityrequiressafetystoragesupplyuseswaste
ceutical products or perishable goods from production to consumption. A well functioning, or unbroken, cold chain requires uninterrupted sequence of refrigerated production, storage and distribution activities, along with associated equipment and fleet management logistics, which maintain a desired low-temperature interval to keep the safety and quality of perishable or sensitive products. Unlike other goods or merchandise, cold chain goods are perishable and always en-route towards end use or destination.
ation to maintain perishable goods, such as pharmaceuticals, produce or other goods that are temperature-sensitive. Common goods, sometimes called cool cargo, distributed in cold chains include fresh agricultural produce, seafood, frozen food, photographic film, chemicals, and pharmaceutical products. The objective of a cold chain is to preserve the integrity and quality of goods such as pharmaceutical products or perishable goods from production to consumption. A well functioning, or unbroken, cold chain requires uninterrupted sequence of refrigerated production, storage and distribution activities, along with associated equipment and fleet management logistics, which maintain a desired low-temperature interval to keep the safety and quality of perishable or sensitive products. Unlike other goods or merchandise, cold chain goods are perishable and always en-route towards end use or destination.
History Mobile refrigeration with ice from the ice trade began with reefer ships and refrigerator cars (iceboxes on wheels) in the mid-19th century. The term cold chain was first used in 1908. The first effective cold store in the UK opened in 1882 at St Katharine Docks. It could hold 59,000 carcasses, and by 1911 cold storage capacity in London had reached 2.84 million carcasses. By 1930 about a thousand refrigerated meat containers were in use which could be switched from road to railway. Mobile mechanical refrigeration was invented by Frederick McKinley Jones, who co-founded Thermo King with entrepreneur Joseph A. "Joe" Numero. In 1938 Numero sold his Cinema Supplies Inc. movie sound equipment business to RCA to form the new entity, U.S. Thermo Control Company (later the Thermo King Corporation), in partnership with Jones, his engineer. Jones designed a portable air-cooling unit for trucks carrying perishable food, for which they obtained a patent on 12 July 1940, subsequent to a challenge to invent a refrigerated truck over a 1937 golf game by associates of Numero's, Werner Transportation Co. president Harry Werner, and United States Air Conditioning Co. president Al Fineberg, This technology has been frequently in use since the 1950s, when it was most often used for preserving animal-based cells or tissue. As medical breakthroughs, such as in cancer treatment, have taken place, the demand for cold chain systems has grown. The COVID-19 pandemic and its associated vaccinations, have caused vastly increased need. Uses Cold chains are common in the food and pharmaceutical industries and also in some chemical shipments.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "according", "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
accordingboisecanyoncollegehomeidahointerstatemeridianmetropolitannampapopulationprincipaluniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in wedding_events (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "home", "idaho", "jurisdiction", "local", "metropolitan", "pacific", "population", "private".
adaboisecapitalhomeidahojurisdictionlocalmetropolitanpacificpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.660
QID OVERLAP: Q849592 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidahometropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "population".
adaamongboisecapitalidahomeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in wedding_events (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahometropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Snake River Plain
Q1396049 QID OVERLAP 0.600
QID OVERLAP: Q1396049 in wedding_events (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (5): "agricultural", "idaho", "land", "major", "river".
agriculturalidaholandmajorriver
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain is a geologic feature located primarily within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
283 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP283 edges
🌿 BRANCH228 edges
0.500
Biotechnology ↗ Q7108 EXACT TITLE
addressagricultureanimalapplicationsappliesapprovalcertaincoredefinitionsdevelopeddevelopmentdirectlyengineeringexampleexistingfieldfunctionsgenerallyhumanimportant
SHARED TOKENS (59): "address", "agriculture", "animal", "applications", "applies", "approval", "certain", "core", "definitions", "developed", "development", "directly", "engineering", "example", "existing", "field", "functions", "generally", "human", "important".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
agenciesassetsauthoritybehaviorbusinessescommonlydepartmentsdirectlyeligibilityemergencyequipmentexperiencefunctiongenerallygovernedgovernmentindividualjurisdictionleastlegal
SHARED TOKENS (36): "agencies", "assets", "authority", "behavior", "businesses", "commonly", "departments", "directly", "eligibility", "emergency", "equipment", "experience", "function", "generally", "governed", "government", "individual", "jurisdiction", "least", "legal".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistinctearlyeconomygeographicidahoinsteadisolatedlandmethodsmillionnationalofficialpacific
SHARED TOKENS (32): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "early", "economy", "geographic", "idaho", "instead", "isolated", "land", "methods", "million", "national", "official", "pacific".... | EXACT TITLE in wedding_events: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
0.500
Kitchen ↗ Q43164 EXACT TITLE
accordingcoldcommercialcompletedesigndevelopededucationalequipmentestablishmentestablishmentsexamplefacilitiesfoodfoundfunctionsgenerallyhealthlargelawmarket
SHARED TOKENS (34): "according", "cold", "commercial", "complete", "design", "developed", "educational", "equipment", "establishment", "establishments", "example", "facilities", "food", "found", "functions", "generally", "health", "large", "law", "market".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
Vaccine ↗ Q134808 EXACT TITLE
activeadministrationagainstalreadyassociatedcontainsdevelopeddevelopmentdifferenteffectshealthlicensedorganizationpracticepreparationproductionreportssafetysciencesystem
SHARED TOKENS (22): "active", "administration", "against", "already", "associated", "contains", "developed", "development", "different", "effects", "health", "licensed", "organization", "practice", "preparation", "production", "reports", "safety", "science", "system".... | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
buildingbusinesscorporatedesigndevelopmentdifferentemergencyenvironmenteventsexecutionformalidentifyingindustryknowledgelabellogisticsmanagementmarketmeetingsnegotiation
SHARED TOKENS (37): "building", "business", "corporate", "design", "development", "different", "emergency", "environment", "events", "execution", "formal", "identifying", "industry", "knowledge", "label", "logistics", "management", "market", "meetings", "negotiation".... | EXACT TITLE in wedding_events: "Event management".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcertificationconsumerconsumerscontaminationcreatesdeliverydescribingdevelopedenforcementfoodgrowthhandlinghealthindustryinspectionmanagementmarketmillionnutrition
SHARED TOKENS (33): "cannot", "certification", "consumer", "consumers", "contamination", "creates", "delivery", "describing", "developed", "enforcement", "food", "growth", "handling", "health", "industry", "inspection", "management", "market", "million", "nutrition".... | EXACT TITLE in wedding_events: "Food safety". | EXACT TITLE in biotech_life_sciences: "Food safety".
0.500
approvalcannotcontractcostsdesigneddevelopmentdevicesentryevidenceexperienceformhouselargelifemaintainmanagementmarketsmedicalneedorganization
SHARED TOKENS (31): "approval", "cannot", "contract", "costs", "designed", "development", "devices", "entry", "evidence", "experience", "form", "house", "large", "life", "maintain", "management", "markets", "medical", "need", "organization".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
advancedagenciesanimalapprovalsbuildingcategoryclassificationcomplexconditionsdevicesdifferentdirectlyengineeringexamplegeneralhumanisolatedmarketmedicaloutside
SHARED TOKENS (33): "advanced", "agencies", "animal", "approvals", "building", "category", "classification", "complex", "conditions", "devices", "different", "directly", "engineering", "example", "general", "human", "isolated", "market", "medical", "outside".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
Commissary ↗ Q5152616 EXACT TITLE
associatedbuildingdeliveryexampleextensiongovernmentjurisdictionnationalofficeofficialofficialsorganizationstandardstationsuppliestitleuses
SHARED TOKENS (17): "associated", "building", "delivery", "example", "extension", "government", "jurisdiction", "national", "office", "official", "officials", "organization", "standard", "station", "supplies", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
annualbecomebusinesscapitalcompleteconductcontroldevelopmentdisposalearlyfacefinancefinancingfirmsformfundinggeneratinggrowthhistoryinformation
SHARED TOKENS (42): "annual", "become", "business", "capital", "complete", "conduct", "control", "development", "disposal", "early", "face", "finance", "financing", "firms", "form", "funding", "generating", "growth", "history", "information".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbuiltbusinessescustomersdesignedearlyeventsexampleformalgenerallyhistoryholdinginsidelargelatermodernpeopleprivate
SHARED TOKENS (26): "annual", "building", "buildings", "built", "businesses", "customers", "designed", "early", "events", "example", "formal", "generally", "history", "holding", "inside", "large", "later", "modern", "people", "private".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
agriculturaldisposalenvironmentfacilityindustrymunicipalphaseprocessresultingsafelyseparationtreatedtreatmenttypeuseswastewastewaterwater
SHARED TOKENS (18): "agricultural", "disposal", "environment", "facility", "industry", "municipal", "phase", "process", "resulting", "safely", "separation", "treated", "treatment", "type", "uses", "waste", "wastewater", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
approximatelybehaviorbuiltcommonlycomplexconcentrationcurrentdepartmentengineeringfacilitiesfacilityfallshistoricallyhistoryidahoknowledgenationalpeopleresearchsite
SHARED TOKENS (21): "approximately", "behavior", "built", "commonly", "complex", "concentration", "current", "department", "engineering", "facilities", "facility", "falls", "historically", "history", "idaho", "knowledge", "national", "people", "research", "site".... | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
Microbiology ↗ Q7193 EXACT TITLE
classifiedcomplexcurrentdesigndevelopedeffectsexampleidentificationlifematerialmeansmedicalpossesssearchsmallstudythemwork
SHARED TOKENS (18): "classified", "complex", "current", "design", "developed", "effects", "example", "identification", "life", "material", "means", "medical", "possess", "search", "small", "study", "them", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
behaviorbeyondcomplianceenvironmentevidenceformidentificationidentifiedinfluenceinformationneedneedsoutsidepeopleprivatepublicpubliclyresponseresultsshared
SHARED TOKENS (22): "behavior", "beyond", "compliance", "environment", "evidence", "form", "identification", "identified", "influence", "information", "need", "needs", "outside", "people", "private", "public", "publicly", "response", "results", "shared".... | EXACT TITLE in wedding_events: "Social influence".
0.500
administrationagenciescertainclassificationclassificationscontrolcontrolleddeterminedistributionenforcementestablishingfederalfoodisolatedlawlistingmedicalnationalpolicypossession
SHARED TOKENS (26): "administration", "agencies", "certain", "classification", "classifications", "control", "controlled", "determine", "distribution", "enforcement", "establishing", "federal", "food", "isolated", "law", "listing", "medical", "national", "policy", "possession".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
Patent ↗ Q253623 EXACT TITLE
accordingagreementsamongcapabledefineintellectuallawlegalmodelsnationalorganizationprivateprocedurepropertyprotectionpublicratherrequirementsrightssubject
SHARED TOKENS (23): "according", "agreements", "among", "capable", "define", "intellectual", "law", "legal", "models", "national", "organization", "private", "procedure", "property", "protection", "public", "rather", "requirements", "rights", "subject".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
agriculturalanalysisbuildingcomplexdatadevelopmentengineeringfieldidentificationimportantinformationlargemethodsmodelsnetworksprocessprocessingregulationresultsrole
SHARED TOKENS (26): "agricultural", "analysis", "building", "complex", "data", "development", "engineering", "field", "identification", "important", "information", "large", "methods", "models", "networks", "process", "processing", "regulation", "results", "role".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
administrationbureaucommunitycontrolleddepartmentdistributionenforcementestablishedfederalgovernmentinvestigationinvolvingjurisdictionlawnationaloperationsprotectionratherreportsuses
SHARED TOKENS (20): "administration", "bureau", "community", "controlled", "department", "distribution", "enforcement", "established", "federal", "government", "investigation", "involving", "jurisdiction", "law", "national", "operations", "protection", "rather", "reports", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
Marketing ↗ Q39809 EXACT TITLE
advertisingagriculturalassociationbusinessbusinesseschannelscharacteristicsconcerningconsumerscustomersdedicateddirectlyenvironmentfirmsfoodgovernmentindustrymanagementmarketmarketed
SHARED TOKENS (34): "advertising", "agricultural", "association", "business", "businesses", "channels", "characteristics", "concerning", "consumers", "customers", "dedicated", "directly", "environment", "firms", "food", "government", "industry", "management", "market", "marketed".... | EXACT TITLE in wedding_events: "Marketing".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstcertainconditionscontractdesignatedestablishedformhealthinsurancelargemanagementmeansownershippaymentpolicypossessionprocessingprotectionrelationshiprequired
SHARED TOKENS (22): "against", "certain", "conditions", "contract", "designated", "established", "form", "health", "insurance", "large", "management", "means", "ownership", "payment", "policy", "possession", "processing", "protection", "relationship", "required".... | EXACT TITLE in wedding_events: "Insurance". | EXACT TITLE in biotech_life_sciences: "Insurance".
0.500
Rodeo ↗ Q207703 EXACT TITLE
animalassociationcategoriescertaindesignedequipmenteventsfederalgenerallygoverngovernedindustrylaterlivestocklocalmodernnationalofficialorganizationpractices
SHARED TOKENS (31): "animal", "association", "categories", "certain", "designed", "equipment", "events", "federal", "generally", "govern", "governed", "industry", "later", "livestock", "local", "modern", "national", "official", "organization", "practices".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesallowingalreadybusinessescareerscollegecurrentdetermineemployersemploymentexperiencefieldgovernmentindustryinternshipslargemedicalnetworkopportunitiesorganization
SHARED TOKENS (37): "agencies", "allowing", "already", "businesses", "careers", "college", "current", "determine", "employers", "employment", "experience", "field", "government", "industry", "internships", "large", "medical", "network", "opportunities", "organization".... | EXACT TITLE in wedding_events: "Internship". | EXACT TITLE in biotech_life_sciences: "Internship".
0.500
Convention ↗ Q225862 EXACT TITLE
animalboardcertaincharacteristicsconductdifferentfieldformalhumanindustrylargelawlegalmediaofficepeoplepractitionerspropertysharestandard
SHARED TOKENS (22): "animal", "board", "certain", "characteristics", "conduct", "different", "field", "formal", "human", "industry", "large", "law", "legal", "media", "office", "people", "practitioners", "property", "share", "standard".... | EXACT TITLE in wedding_events: "Convention". | EXACT TITLE in biotech_life_sciences: "Convention".
0.500
advancedanalysisappliedchangesdevelopmentdifferentdivisionengineeringevaluationfieldformgenerallyhealthimportantinterfaceknowledgelatermedicalperformpractice
SHARED TOKENS (31): "advanced", "analysis", "applied", "changes", "development", "different", "division", "engineering", "evaluation", "field", "form", "generally", "health", "important", "interface", "knowledge", "later", "medical", "perform", "practice".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessesdesigneddirectlyfacilityfunctionlargematerialspartsproductionstandardtransport
SHARED TOKENS (15): "agriculture", "associated", "building", "buildings", "businesses", "designed", "directly", "facility", "function", "large", "materials", "parts", "production", "standard", "transport". | EXACT TITLE in wedding_events: "Warehouse".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
assetsbusinesscentercontractingcontroleconomicevenfacilityfunctionslaterlegalmanagementoperationalorganizationotherwiseoutsidepracticepresenceprivateprocess
SHARED TOKENS (27): "assets", "business", "center", "contracting", "control", "economic", "even", "facility", "functions", "later", "legal", "management", "operational", "organization", "otherwise", "outside", "practice", "presence", "private", "process".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedassociatedbecomecontroldependsdevelopeddistincteffectsengineeringenvironmentexampleexplainingfunctionfunctionshealthlifemaintainmethodsnutrition
SHARED TOKENS (29): "agriculture", "applied", "associated", "become", "control", "depends", "developed", "distinct", "effects", "engineering", "environment", "example", "explaining", "function", "functions", "health", "life", "maintain", "methods", "nutrition".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
appliedassociatedcapacitycapitalcostsdirectlydocumentearlyestablishingexistingformgrowthimportantinformationinstitutionallegallistedmarketmethodsofferings
SHARED TOKENS (32): "applied", "associated", "capacity", "capital", "costs", "directly", "document", "early", "establishing", "existing", "form", "growth", "important", "information", "institutional", "legal", "listed", "market", "methods", "offerings".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesaffectagricultureairchangechangesconditionscontroldifferentdistributioneffectsevidencegenerallyhistoryhumanindustrylargelayerleastlower
SHARED TOKENS (29): "activities", "affect", "agriculture", "air", "change", "changes", "conditions", "control", "different", "distribution", "effects", "evidence", "generally", "history", "human", "industry", "large", "layer", "least", "lower".... | EXACT TITLE in wedding_events: "Weather".
0.500
Antibody ↗ Q79460 EXACT TITLE
allowinganimalbecomecapacityclassificationcompositioncontainsdeliverydescribesdescribingdifferentdirectlydistinctdistributionexampleformfunctionfunctionsgeneralgenerally
SHARED TOKENS (40): "allowing", "animal", "become", "capacity", "classification", "composition", "contains", "delivery", "describes", "describing", "different", "directly", "distinct", "distribution", "example", "form", "function", "functions", "general", "generally".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
activityconditionsdependsdirectlyfoodformhealthmaintainmajorpeoplephysicalpreparationrequiredsafesuppliedwaterwork
SHARED TOKENS (17): "activity", "conditions", "depends", "directly", "food", "form", "health", "maintain", "major", "people", "physical", "preparation", "required", "safe", "supplied", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.500
accordingappliedbecomecapablecomplexdeterminedifferentexamplefieldfunctionidentifiedidentitymechanismpatternprocedureresultsstructurethem
SHARED TOKENS (18): "according", "applied", "become", "capable", "complex", "determine", "different", "example", "field", "function", "identified", "identity", "mechanism", "pattern", "procedure", "results", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.500
Photography ↗ Q11633 EXACT TITLE
basebusinesscapturecreatedevelopeddirectelectricalexposureforminsidelatermaterialmeansoperatespracticeprocessingproducesproductionrealscience
SHARED TOKENS (24): "base", "business", "capture", "create", "developed", "direct", "electrical", "exposure", "form", "inside", "later", "material", "means", "operates", "practice", "processing", "produces", "production", "real", "science".... | EXACT TITLE in wedding_events: "Photography".
0.500
alreadybuildingbuildingscodescommonlyconductdepartmentdivisionfireinspectionsintendedlimitplannedpracticespreventionresultssafetytrain
SHARED TOKENS (18): "already", "building", "buildings", "codes", "commonly", "conduct", "department", "division", "fire", "inspections", "intended", "limit", "planned", "practices", "prevention", "results", "safety", "train". | EXACT TITLE in wedding_events: "Fire safety". | EXACT TITLE in biotech_life_sciences: "Fire safety".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscleaningcommercialestablishmentsfoodgenerallyindividualmanagementmenumodelpracticesprivaterestaurantsrisksafetyservesservingsettingstaff
SHARED TOKENS (19): "business", "cleaning", "commercial", "establishments", "food", "generally", "individual", "management", "menu", "model", "practices", "private", "restaurants", "risk", "safety", "serves", "serving", "setting", "staff". | EXACT TITLE in wedding_events: "Catering".
0.500
Waste management ↗ EXACT TITLE
accordingactivitiesactivityadditionalairapproximatelycenterschangecommercialcontrolleddevelopeddifferentdisposaleconomiceffectsenvironmentexampleexistingfinalfood
SHARED TOKENS (48): "according", "activities", "activity", "additional", "air", "approximately", "centers", "change", "commercial", "controlled", "developed", "different", "disposal", "economic", "effects", "environment", "example", "existing", "final", "food".... | EXACT TITLE in wedding_events: "Waste management".
0.500
addadministrationauthoritycontroldevicesfederalfoodforminvestigationlawmarketedmedicalnationalprincipalprovisionsregulationsrequirementssafetystudytimes
SHARED TOKENS (20): "add", "administration", "authority", "control", "devices", "federal", "food", "form", "investigation", "law", "marketed", "medical", "national", "principal", "provisions", "regulations", "requirements", "safety", "study", "times". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesadjacentagainstagenciesbuildingsbuiltgovernmenthumanhundredsinsidelandlargelawnationalprotectedprotectionrulesshowsspacesquare
SHARED TOKENS (21): "activities", "adjacent", "against", "agencies", "buildings", "built", "government", "human", "hundreds", "inside", "land", "large", "law", "national", "protected", "protection", "rules", "shows", "space", "square".... | EXACT TITLE in wedding_events: "Park". | EXACT TITLE in biotech_life_sciences: "Park".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingbuildingscertaindeterminedevelopeddevelopmentdifferentformgoverngovernmentgrowthlandland-uselocalperceivedplanningpolicyprocedure
SHARED TOKENS (32): "activities", "allowing", "building", "buildings", "certain", "determine", "developed", "development", "different", "form", "govern", "government", "growth", "land", "land-use", "local", "perceived", "planning", "policy", "procedure".... | EXACT TITLE in wedding_events: "Zoning". | EXACT TITLE in biotech_life_sciences: "Zoning".
0.500
amonganalysisappearsappliedchangeconditionsdatadescriptiondesigndistributioneffectsengineeringexposurefunctiongeneralhealthhistoricallyhumanidentifyinginvestigation
SHARED TOKENS (38): "among", "analysis", "appears", "applied", "change", "conditions", "data", "description", "design", "distribution", "effects", "engineering", "exposure", "function", "general", "health", "historically", "human", "identifying", "investigation".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
Floristry ↗ Q637125 EXACT TITLE
businessconsumerscorporatecreatecustomersdeliverydesigndistributioneventsgenerallygeographichandlingimportantindustryknowledgelargemarketmaterialmaterialsmeetings
SHARED TOKENS (35): "business", "consumers", "corporate", "create", "customers", "delivery", "design", "distribution", "events", "generally", "geographic", "handling", "important", "industry", "knowledge", "large", "market", "material", "materials", "meetings".... | EXACT TITLE in wedding_events: "Floristry".
0.500
administrationappliesapplyfederalfoodintendedlawprivateprotectionpublicqualityregulatedrequiredsafestandardssystemsystemswater
SHARED TOKENS (18): "administration", "applies", "apply", "federal", "food", "intended", "law", "private", "protection", "public", "quality", "regulated", "required", "safe", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
activeadvancedagainstapplicationsassociatedbecomecharacteristicsearlyhealthimportantincreasinglatermaintainphysicalratherresponsesmallstudysurroundingsystem
SHARED TOKENS (23): "active", "advanced", "against", "applications", "associated", "become", "characteristics", "early", "health", "important", "increasing", "later", "maintain", "physical", "rather", "response", "small", "study", "surrounding", "system".... | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityadvancedbehaviorcomplexcouncildetaileddiscoveryearlyfieldfunctiongoverninginsteadmedicalmodelorganizationphysicalrelyingresearchsciencestructure
SHARED TOKENS (24): "activity", "advanced", "behavior", "complex", "council", "detailed", "discovery", "early", "field", "function", "governing", "instead", "medical", "model", "organization", "physical", "relying", "research", "science", "structure".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Cleanroom ↗ Q794827 EXACT TITLE
aircommonlyconcentrationcontainscontaminationdesignedfacilitiesinsidemaintainsmaterialmaterialspermitsproductionresearchroomssizesmallerspacework
SHARED TOKENS (19): "air", "commonly", "concentration", "contains", "contamination", "designed", "facilities", "inside", "maintains", "material", "materials", "permits", "production", "research", "rooms", "size", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureanimalappliedclassificationcoveringdifferentdistinctfieldfunctionshealthidentificationmedicalmethodsofficialpartsresearchsciencesourcestructurestudy
SHARED TOKENS (23): "agriculture", "animal", "applied", "classification", "covering", "different", "distinct", "field", "functions", "health", "identification", "medical", "methods", "official", "parts", "research", "science", "source", "structure", "study".... | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
applicationsbecomecleaningcompleteequipmenthouseidentifyingleastlicensedoccupationperformproductsprofessionalsafelyshapetrainingtreatmentwhosework
SHARED TOKENS (19): "applications", "become", "cleaning", "complete", "equipment", "house", "identifying", "least", "licensed", "occupation", "perform", "products", "professional", "safely", "shape", "training", "treatment", "whose", "work". | EXACT TITLE in wedding_events: "Nail technician".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdevelopmenteconomiceffectsenvironmentgenerallygrowthincreaseincreasedlocalmarketsorganizationoutsidepeoplepracticesprograms
SHARED TOKENS (23): "activity", "beyond", "business", "commercial", "communities", "development", "economic", "effects", "environment", "generally", "growth", "increase", "increased", "local", "markets", "organization", "outside", "people", "practices", "programs".... | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
advertisingannualapproximatelybecomebusinessbusinessescomcompetingdirectoryestimatesexpandedfundinginformationlatermilliononlineoperatespracticepracticespublic
SHARED TOKENS (25): "advertising", "annual", "approximately", "become", "business", "businesses", "com", "competing", "directory", "estimates", "expanded", "funding", "information", "later", "million", "online", "operates", "practice", "practices", "public".... | EXACT TITLE in wedding_events: "Yelp".
0.500
analysisappliesapprovalbehaviorboardboardscertaincodescommonlyconductdelivereddesignateddeterminedevicesformhealthhumanindependentinstitutionalinvolving
SHARED TOKENS (40): "analysis", "applies", "approval", "behavior", "board", "boards", "certain", "codes", "commonly", "conduct", "delivered", "designated", "determine", "devices", "form", "health", "human", "independent", "institutional", "involving".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
activitiesaddressapplybusinesschangecompleteconstraintscontractorsdesigneddevelopmentdistinctdocumentationestablishedexamplefundinginfluenceinformationmanagementoperationspractice
SHARED TOKENS (31): "activities", "address", "apply", "business", "change", "complete", "constraints", "contractors", "designed", "development", "distinct", "documentation", "established", "example", "funding", "influence", "information", "management", "operations", "practice".... | EXACT TITLE in wedding_events: "Project management".
0.500
Toxicology ↗ Q7218 EXACT TITLE
academiceffectsenvironmentexampleexposurefieldinfluencepracticepracticesrelationshipresearchroutestudysubjecttreatingtreatment
SHARED TOKENS (16): "academic", "effects", "environment", "example", "exposure", "field", "influence", "practice", "practices", "relationship", "research", "route", "study", "subject", "treating", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
becomeclassifiedcommonlycommunitydirectestablishmenthealthinformationinstitutionalinvestigationlinksmodernofficepracticeproductsprofessionalrelatedsafesafetyscience
SHARED TOKENS (25): "become", "classified", "commonly", "community", "direct", "establishment", "health", "information", "institutional", "investigation", "links", "modern", "office", "practice", "products", "professional", "related", "safe", "safety", "science".... | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
Accounting ↗ Q4116214 EXACT TITLE
activitiesanalysisboardbusinessbusinessescouncildesigneddevelopedeconomicfirmsfunctionsgenerallyhistoryhumaninformationmajormanagementoperationsorganizationpractitioners
SHARED TOKENS (33): "activities", "analysis", "board", "business", "businesses", "council", "designed", "developed", "economic", "firms", "functions", "generally", "history", "human", "information", "major", "management", "operations", "organization", "practitioners".... | EXACT TITLE in wedding_events: "Accounting".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesclassifiedconsumercustomersestablishedeventsexamplefinalgeneralindustrylatestmarketmarketsonlineopportunitiesproductspublicshowshowsstudy
SHARED TOKENS (22): "activities", "classified", "consumer", "customers", "established", "events", "example", "final", "general", "industry", "latest", "market", "markets", "online", "opportunities", "products", "public", "show", "shows", "study".... | EXACT TITLE in wedding_events: "Trade show".
0.500
activeanalysisapplicationschannelscontroldesigndeterminedevelopmentfieldformhundredsmeansmediaotherwisepracticalprocessscienceseparatesinglesmall
SHARED TOKENS (26): "active", "analysis", "applications", "channels", "control", "design", "determine", "development", "field", "form", "hundreds", "means", "media", "otherwise", "practical", "process", "science", "separate", "single", "small".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
addressagriculturalappliedcontrolcreatedesigndevicesengineeringequipmentgenerallyknowledgematerialsmedicalprocessproductsrapidresearchscienceseparationspace
SHARED TOKENS (25): "address", "agricultural", "applied", "control", "create", "design", "devices", "engineering", "equipment", "generally", "knowledge", "materials", "medical", "process", "products", "rapid", "research", "science", "separation", "space".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Biomaterial ↗ Q865663 EXACT TITLE
developmentdifferentengineeringexperiencedfieldfunctiongrowthhistorylargematerialmaterialsmedicalproductssciencestudysystemsystems
SHARED TOKENS (17): "development", "different", "engineering", "experienced", "field", "function", "growth", "history", "large", "material", "materials", "medical", "products", "science", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.500
beyondbusinesscertainchangesconditionsdatademandeconomiceconomyemploymentexperiencedfallsgenerallyinventoryjobleastmaintenancemarketneedperformance
SHARED TOKENS (31): "beyond", "business", "certain", "changes", "conditions", "data", "demand", "economic", "economy", "employment", "experienced", "falls", "generally", "inventory", "job", "least", "maintenance", "market", "need", "performance".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
academicactivitiesagenciesbeyondcollegecurriculumdegreedelivereddevelopmentdifferentdivisioneconomiceducationextensionfeedformalgeneralgeneratinggovernmentinstitutional
SHARED TOKENS (41): "academic", "activities", "agencies", "beyond", "college", "curriculum", "degree", "delivered", "development", "different", "division", "economic", "education", "extension", "feed", "formal", "general", "generating", "government", "institutional".... | EXACT TITLE in wedding_events: "Continuing education".
0.500
accordingalreadyappliesapplycontroldesigndeviceselectricalengineeringexistingfieldfoundmaterialpartssciencesystemsthem
SHARED TOKENS (17): "according", "already", "applies", "apply", "control", "design", "devices", "electrical", "engineering", "existing", "field", "found", "material", "parts", "science", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordingcostscustomersdedicatedequipmentfacilityfieldfoodinformationlogisticsmanagementmaterialmaterialsmodelneedsoperationalpartsphysicalplanningproduction
SHARED TOKENS (29): "according", "costs", "customers", "dedicated", "equipment", "facility", "field", "food", "information", "logistics", "management", "material", "materials", "model", "needs", "operational", "parts", "physical", "planning", "production".... | EXACT TITLE in wedding_events: "Logistics". | EXACT TITLE in biotech_life_sciences: "Logistics".
0.500
affectagainstcompensationcontractcostsdedicateddesignedevenexpresslyfinancinggeneralindividualinsurancelegalliabilitymodernotherwisepaymentpoliciespolicy
SHARED TOKENS (27): "affect", "against", "compensation", "contract", "costs", "dedicated", "designed", "even", "expressly", "financing", "general", "individual", "insurance", "legal", "liability", "modern", "otherwise", "payment", "policies", "policy".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
activityapprovalapprovedauthoritybecomecentercenterscentralcertaincompleteconductcontractcostsdatadesigndesigneddevelopmentdevicesfunctionsgenerate
SHARED TOKENS (43): "activity", "approval", "approved", "authority", "become", "center", "centers", "central", "certain", "complete", "conduct", "contract", "costs", "data", "design", "designed", "development", "devices", "functions", "generate".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionalboardbuiltbusinesscenterdepartmentdepartmentsdirectearlyeconomyenvironmentequipmentestablishmentestablishmentsexampleexecutivefacilitiesfacilityfood
SHARED TOKENS (52): "access", "additional", "board", "built", "business", "center", "department", "departments", "direct", "early", "economy", "environment", "equipment", "establishment", "establishments", "example", "executive", "facilities", "facility", "food".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstbeginbehaviorconditionsdirectlydistinctevenexamplegenerallyindividualinfluenceinformationnetworkoutsidepeoplepositionproblemprocessspacesupport
SHARED TOKENS (21): "against", "begin", "behavior", "conditions", "directly", "distinct", "even", "example", "generally", "individual", "influence", "information", "network", "outside", "people", "position", "problem", "process", "space", "support".... | EXACT TITLE in wedding_events: "Information cascade".
0.500
agriculturalappliedcentralcompositionconductconsumersdesigndevelopmentdirectlyearlyevaluationfieldfoodlifematerialsmethodsmodernperformpracticesprocessing
SHARED TOKENS (26): "agricultural", "applied", "central", "composition", "conduct", "consumers", "design", "development", "directly", "early", "evaluation", "field", "food", "life", "materials", "methods", "modern", "perform", "practices", "processing".... | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
affectanalysisassociatedcostsdifferentestablishingformlatermaterialphasepresenceprocessproductionseparateseparationsitessmallersystemthem
SHARED TOKENS (19): "affect", "analysis", "associated", "costs", "different", "establishing", "form", "later", "material", "phase", "presence", "process", "production", "separate", "separation", "sites", "smaller", "system", "them". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
academicboardsdepartmentfundinggovernedhealthhumaninstitutionalinvolvingpublicresearchreviewrightsrulestandardtitlewelfare
SHARED TOKENS (17): "academic", "boards", "department", "funding", "governed", "health", "human", "institutional", "involving", "public", "research", "review", "rights", "rule", "standard", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongapplicationscurrentdesigndevelopmentdevicesengineeringequipmentfieldgrowthhealthindustrymaintenancemanagementmedicalprocurementrelevantresearchrolestandards
SHARED TOKENS (22): "among", "applications", "current", "design", "development", "devices", "engineering", "equipment", "field", "growth", "health", "industry", "maintenance", "management", "medical", "procurement", "relevant", "research", "role", "standards".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
changesdevelopmentengineeringexperiencedfieldhumaninterfacelowermajormedicalphysicalregulationrolesciencestructurework
SHARED TOKENS (16): "changes", "development", "engineering", "experienced", "field", "human", "interface", "lower", "major", "medical", "physical", "regulation", "role", "science", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.500
associatedcomplexcontrolsdesigndevicesdiscoveryengineeringestablishestablishedfederalfieldfoodgeneralincreaseintendedlaterlifemajormarketmedical
SHARED TOKENS (33): "associated", "complex", "controls", "design", "devices", "discovery", "engineering", "establish", "established", "federal", "field", "food", "general", "increase", "intended", "later", "life", "major", "market", "medical".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysischangesconditionsconsequencesdevelopmentdifferentdistinctexamplefieldgeneralhumanmajormedicalmodernphysicalpracticepracticesresearchstudysystems
SHARED TOKENS (21): "analysis", "changes", "conditions", "consequences", "development", "different", "distinct", "example", "field", "general", "human", "major", "medical", "modern", "physical", "practice", "practices", "research", "study", "systems".... | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
academicactivitiesanalysisapplicationscommercialconductdatadegreedevelopmentdevicesdifferentexamplefieldgenerallygovernmentincreaseotherwiseproceduresprocessprogram
SHARED TOKENS (31): "academic", "activities", "analysis", "applications", "commercial", "conduct", "data", "degree", "development", "devices", "different", "example", "field", "generally", "government", "increase", "otherwise", "procedures", "process", "program".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
accordingalreadyassetschangecharacteristicsconsumerscreatecustomersexperienceidentifiedincreaseindustrymeasuredneedsorganizationpersonnelpoliciesproductsqualitystandards
SHARED TOKENS (21): "according", "already", "assets", "change", "characteristics", "consumers", "create", "customers", "experience", "identified", "increase", "industry", "measured", "needs", "organization", "personnel", "policies", "products", "quality", "standards".... | EXACT TITLE in wedding_events: "Customer service".
0.500
Tent ↗ Q170544 EXACT TITLE
capablecategoriesexperienceincreasinglyintendedlargematerialmultiplenearpeoplesizesmallsmallersupportingtype
SHARED TOKENS (15): "capable", "categories", "experience", "increasingly", "intended", "large", "material", "multiple", "near", "people", "size", "small", "smaller", "supporting", "type". | EXACT TITLE in wedding_events: "Tent". | EXACT TITLE in biotech_life_sciences: "Tent".
0.500
Orchard ↗ Q236371 EXACT TITLE
basecommercialconcentratedfoodgenerallylargemaintainedmaintenancemakesmodernnearproductionscalesinglesmallerwater
SHARED TOKENS (16): "base", "commercial", "concentrated", "food", "generally", "large", "maintained", "maintenance", "makes", "modern", "near", "production", "scale", "single", "smaller", "water". | EXACT TITLE in wedding_events: "Orchard".
0.500
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingbuiltconcentrateddifferenteveneventsfoodformformallargemodernpeoplethem
SHARED TOKENS (15): "additional", "among", "building", "built", "concentrated", "different", "even", "events", "food", "form", "formal", "large", "modern", "people", "them". | EXACT TITLE in wedding_events: "Banquet".
0.500
administrationanimalassociatedauthorityconsentcontrolcurrentdepartmentdevicesdirectlyfederalfeedfieldfoodhealthhumanmedicalproductspublicregulated
SHARED TOKENS (26): "administration", "animal", "associated", "authority", "consent", "control", "current", "department", "devices", "directly", "federal", "feed", "field", "food", "health", "human", "medical", "products", "public", "regulated".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
activityaddressagenciesauthorizationbusinessconductdepartmentsdeterminesgovernmentjurisdictionlicenselocalmultipleoperateoperatingpermitsphysicalrequiredrequiressingle
SHARED TOKENS (20): "activity", "address", "agencies", "authorization", "business", "conduct", "departments", "determines", "government", "jurisdiction", "license", "local", "multiple", "operate", "operating", "permits", "physical", "required", "requires", "single". | EXACT TITLE in wedding_events: "Business license".
0.500
academiccareerscentercentralcertificationeducationemployersinsteadknowledgelifemissionprivateproductionpublicratherresearchsitesstudentstransferundergraduate
SHARED TOKENS (23): "academic", "careers", "center", "central", "certification", "education", "employers", "instead", "knowledge", "life", "mission", "private", "production", "public", "rather", "research", "sites", "students", "transfer", "undergraduate".... | EXACT TITLE in biotech_life_sciences: "Research university".
0.490
boisecenterexpansionidahooperatingspacesquare
SHARED TOKENS (7): "boise", "center", "expansion", "idaho", "operating", "space", "square". | URL->A (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.480
Microscopy ↗ Q1074953 EXACT TITLE
allowingcreatedevelopmentexamplefieldinsidelifephysicalprocessremainssmallstandardusesview
SHARED TOKENS (14): "allowing", "create", "development", "example", "field", "inside", "life", "physical", "process", "remains", "small", "standard", "uses", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.480
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectionexperiencefoodimportantlocalmeansnationalpracticesource
SHARED TOKENS (14): "agriculture", "among", "associated", "communities", "community", "connection", "experience", "food", "important", "local", "means", "national", "practice", "source". | EXACT TITLE in wedding_events: "Festival".
0.470
approximatelyboisecentercomplexidahonampa
SHARED TOKENS (6): "approximately", "boise", "center", "complex", "idaho", "nampa". | URL->A (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.460
Resort ↗ Q875157 EXACT TITLE
activitiescentralcommercialcontainingestablishmentfoodmeansneedsownedownershippeoplesingletype
SHARED TOKENS (13): "activities", "central", "commercial", "containing", "establishment", "food", "means", "needs", "owned", "ownership", "people", "single", "type". | EXACT TITLE in wedding_events: "Resort".
0.460
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialconcentratedemploymentgeographiclowerofficepopulationpublicsmallsmaller
SHARED TOKENS (13): "business", "center", "central", "commercial", "concentrated", "employment", "geographic", "lower", "office", "population", "public", "small", "smaller". | EXACT TITLE in wedding_events: "Downtown".
0.460
Signage ↗ Q1211272 EXACT TITLE
boardsbuildingsdesigndesigneddistinctdocumentedforminformationinsidemeansoutsidesizesmaller
SHARED TOKENS (13): "boards", "buildings", "design", "designed", "distinct", "documented", "form", "information", "inside", "means", "outside", "size", "smaller". | EXACT TITLE in wedding_events: "Signage".
0.460
Concert ↗ Q182832 EXACT TITLE
designatedequipmentlargelogisticsperformperformanceprivateprofessionalrequireshowsinglesmallsupport
SHARED TOKENS (13): "designated", "equipment", "large", "logistics", "perform", "performance", "private", "professional", "require", "show", "single", "small", "support". | EXACT TITLE in wedding_events: "Concert".
0.460
designdifferentdocumentationindustryjobmanagementplannersplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (13): "design", "different", "documentation", "industry", "job", "management", "planners", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.460
Restaurant ↗ Q11707 EXACT TITLE
businesscustomersdeliveryestablishmentestablishmentsfamilyfoodgenerallymodelsofferingsrestaurantsservessingle
SHARED TOKENS (13): "business", "customers", "delivery", "establishment", "establishments", "family", "food", "generally", "models", "offerings", "restaurants", "serves", "single". | EXACT TITLE in wedding_events: "Restaurant". | EXACT TITLE in biotech_life_sciences: "Restaurant".
0.440
Biosensor ↗ Q669391 EXACT TITLE
associatedcombinesconnectsdifferentengineeringgeneratematerialrecognizesresultingresultsstudyworking
SHARED TOKENS (12): "associated", "combines", "connects", "different", "engineering", "generate", "material", "recognizes", "resulting", "results", "study", "working". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.440
agriculturalcharacteristicsdevelopeddifferentengineeringgrowthinvolvingpossessproductssciencesizetimes
SHARED TOKENS (12): "agricultural", "characteristics", "developed", "different", "engineering", "growth", "involving", "possess", "products", "science", "size", "times". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.440
becomecommercialdirectfieldhistoricallylocalmediamethodsnewsproductionstoragework
SHARED TOKENS (12): "become", "commercial", "direct", "field", "historically", "local", "media", "methods", "news", "production", "storage", "work". | EXACT TITLE in wedding_events: "Videography".
0.430
govgovernmenthealthnational
SHARED TOKENS (4): "gov", "government", "health", "national". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.420
administrationapplycannotcommunitydemandexamplefieldformneedspreparationregulations
SHARED TOKENS (11): "administration", "apply", "cannot", "community", "demand", "example", "field", "form", "needs", "preparation", "regulations". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.420
Parking ↗ Q267917 EXACT TITLE
availabilitybuildingscentersdesignfacilitieslandlocalparkingpercentrulessupport
SHARED TOKENS (11): "availability", "buildings", "centers", "design", "facilities", "land", "local", "parking", "percent", "rules", "support". | EXACT TITLE in wedding_events: "Parking". | EXACT TITLE in biotech_life_sciences: "Parking".
0.420
Officiant ↗ Q2015874 EXACT TITLE
commonlyconductfacilityhealthhumanlawlegallifeperformspecifiedwork
SHARED TOKENS (11): "commonly", "conduct", "facility", "health", "human", "law", "legal", "life", "perform", "specified", "work". | EXACT TITLE in wedding_events: "Officiant".
0.420
buildingcentercentersdesignedlargeleastmajorroomsshareshowstrade
SHARED TOKENS (11): "building", "center", "centers", "designed", "large", "least", "major", "rooms", "share", "shows", "trade". | EXACT TITLE in wedding_events: "Convention center".
0.400
Public records ↗ EXACT TITLE
agenciesconductdocumenteddocumentsgenerallygovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (10): "agencies", "conduct", "documented", "documents", "generally", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in wedding_events: "Public records".
0.400
Hazardous waste ↗ EXACT TITLE
environmenthealthhumanlocalmaterialsmillionnationalproducesregulatedwaste
SHARED TOKENS (10): "environment", "health", "human", "local", "materials", "million", "national", "produces", "regulated", "waste". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.400
behaviorcombinesdifferentexpandedfunctionsindividualsciencestatisticsstudysystem
SHARED TOKENS (10): "behavior", "combines", "different", "expanded", "functions", "individual", "science", "statistics", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.400
bureaudepartmentenforcementfebruaryidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (10): "bureau", "department", "enforcement", "february", "idaho", "law", "municipal", "organization", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police".
0.400
authoritydocumentlegallicenseorganizationotherwiseprocedurerecordrequirerequired
SHARED TOKENS (10): "authority", "document", "legal", "license", "organization", "otherwise", "procedure", "record", "require", "required". | EXACT TITLE in wedding_events: "Marriage license".
0.380
Rose garden ↗ Q291177 EXACT TITLE
alongsidealreadyexistingindividualleastpublicspecializedtreatedtype
SHARED TOKENS (9): "alongside", "already", "existing", "individual", "least", "public", "specialized", "treated", "type". | EXACT TITLE in wedding_events: "Rose garden".
0.380
Cell biology ↗ Q7141 EXACT TITLE
behaviorcompositionfunctionlifemedicalresearchstructurestudywork
SHARED TOKENS (9): "behavior", "composition", "function", "life", "medical", "research", "structure", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.380
Barn ↗ Q1303167 EXACT TITLE
activitiesagriculturalappliedbuildingbuildingsequipmenthouselivestockstorage
SHARED TOKENS (9): "activities", "agricultural", "applied", "building", "buildings", "equipment", "house", "livestock", "storage". | EXACT TITLE in wedding_events: "Barn".
0.380
consentdifferentfacilityinformationmaterialmaterialsmedicalpeopleresearch
SHARED TOKENS (9): "consent", "different", "facility", "information", "material", "materials", "medical", "people", "research". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.380
boisedepartmentfederalgovernmentidahomaintainedqualityregionalregulations
SHARED TOKENS (9): "boise", "department", "federal", "government", "idaho", "maintained", "quality", "regional", "regulations". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.360
associationcentersfirmsindustryorganizationrelatedresearchserves
SHARED TOKENS (8): "association", "centers", "firms", "industry", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.360
commonlydesignatedhomeinfluencepracticalremainssafelyselection
SHARED TOKENS (8): "commonly", "designated", "home", "influence", "practical", "remains", "safely", "selection". | EXACT TITLE in wedding_events: "Designated driver".
0.360
Cosmetology ↗ EXACT TITLE
licenseoccupationalrequiredschoolstudytimestreatmentwage
SHARED TOKENS (8): "license", "occupational", "required", "school", "study", "times", "treatment", "wage". | EXACT TITLE in wedding_events: "Cosmetology".
0.360
amongcannotdeterminefamilylawlegallegallyrequirements
SHARED TOKENS (8): "among", "cannot", "determine", "family", "law", "legal", "legally", "requirements". | EXACT TITLE in wedding_events: "Marriage law".
0.360
buildingsbuiltconservationdevelopmentenvironmentexamplemaintainsproducts
SHARED TOKENS (8): "buildings", "built", "conservation", "development", "environment", "example", "maintains", "products". | EXACT TITLE in wedding_events: "Historic preservation".
0.360
chaptercodefederalhealthlawpublictitlewelfare
SHARED TOKENS (8): "chapter", "code", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.340
consumerscontractorsequipmentfinalgeneralindividualindustry
SHARED TOKENS (7): "consumers", "contractors", "equipment", "final", "general", "individual", "industry". | EXACT TITLE in wedding_events: "Equipment rental".
0.340
businesscommercialestatemanagementprofessionalrealview
SHARED TOKENS (7): "business", "commercial", "estate", "management", "professional", "real", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.340
Phlebotomy ↗ Q3595842 EXACT TITLE
involvingmedicalprocedureprocesstechnicianstreatmentvolume
SHARED TOKENS (7): "involving", "medical", "procedure", "process", "technicians", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.340
associationcommunityeventsidahonampaprofessionalriver
SHARED TOKENS (7): "association", "community", "events", "idaho", "nampa", "professional", "river". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.340
analysisapplieddatafieldrelationshipssciencesystems
SHARED TOKENS (7): "analysis", "applied", "data", "field", "relationships", "science", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.340
compositioncreatedeliverydesignevidencefoundmaterial
SHARED TOKENS (7): "composition", "create", "delivery", "design", "evidence", "found", "material". | EXACT TITLE in wedding_events: "Floral design".
0.340
evenfunctionmethodsoperatesstructurestudysystems
SHARED TOKENS (7): "even", "function", "methods", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.340
amongbuildingbuildingsbuiltcostsdesignedexisting
SHARED TOKENS (7): "among", "building", "buildings", "built", "costs", "designed", "existing". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.320
Forage ↗ Q13377214 EXACT TITLE
annualdefinedirectlyhistoricallylivestockmaterial
SHARED TOKENS (6): "annual", "define", "directly", "historically", "livestock", "material". | EXACT TITLE in biotech_life_sciences: "Forage".
0.320
conservationdisposalfederalgoverninglawwaste
SHARED TOKENS (6): "conservation", "disposal", "federal", "governing", "law", "waste". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.320
functionsgovernmenthealthjurisdictionrecordsstatistics
SHARED TOKENS (6): "functions", "government", "health", "jurisdiction", "records", "statistics". | EXACT TITLE in wedding_events: "Vital statistics".
0.320
Use tax ↗ Q17155766 EXACT TITLE
appliedpropertysoldstoragesubjecttype
SHARED TOKENS (6): "applied", "property", "sold", "storage", "subject", "type". | EXACT TITLE in wedding_events: "Use tax".
0.320
agenciesbusinessescapitalidentificationonlineprocess
SHARED TOKENS (6): "agencies", "businesses", "capital", "identification", "online", "process". | EXACT TITLE in wedding_events: "Fundraising".
0.320
Histology ↗ Q7168 EXACT TITLE
fieldhistoricallyidentificationmodernstudyvisible
SHARED TOKENS (6): "field", "historically", "identification", "modern", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.320
affectconditionseconomicidentificationmanagementstudy
SHARED TOKENS (6): "affect", "conditions", "economic", "identification", "management", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.310
federalgovernmenthealthmedicalmillionnationalrelatedreports
SHARED TOKENS (8): "federal", "government", "health", "medical", "million", "national", "related", "reports". | URL->B (1): http://clinicaltrials.gov/.
0.300
businesseslicenseofficialotherwisesell
SHARED TOKENS (5): "businesses", "license", "official", "otherwise", "sell". | EXACT TITLE in wedding_events: "Liquor license".
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
appliesbeyondchangeconsequencescontractcontrolcontrolleddistinctemergencyeventsexamplegeneralgenerallygoverninggovernsintendedlawlegallegallyliability
SHARED TOKENS (35): "applies", "beyond", "change", "consequences", "contract", "control", "controlled", "distinct", "emergency", "events", "example", "general", "generally", "governing", "governs", "intended", "law", "legal", "legally", "liability"....
0.300
accordingagriculturalagricultureairanimalcommerciallyconsequencescontroldevelopeddirectdisposalearlyexpansiongeneralgenerallygrowthhealthhistoryimportantincrease
SHARED TOKENS (33): "according", "agricultural", "agriculture", "air", "animal", "commercially", "consequences", "control", "developed", "direct", "disposal", "early", "expansion", "general", "generally", "growth", "health", "history", "important", "increase"....
0.300
appliedbusinesscapitalcenterscorporatedevelopmenteducationalemploymentgovernmentlocalnetworksplannersprivatepublicrelatedresearchrevenuesupportingtechnologyuniversities
SHARED TOKENS (21): "applied", "business", "capital", "centers", "corporate", "development", "educational", "employment", "government", "local", "networks", "planners", "private", "public", "related", "research", "revenue", "supporting", "technology", "universities"....
0.300
administrationapplyapprovalapprovedboardcertaincommercialcompleteconsentcontroldatadesigndevicesdistributionestablishmentevaluationfoodhumaninformationinstitutional
SHARED TOKENS (47): "administration", "apply", "approval", "approved", "board", "certain", "commercial", "complete", "consent", "control", "data", "design", "devices", "distribution", "establishment", "evaluation", "food", "human", "information", "institutional"....
0.300
agriculturalagricultureanimalassociateddifferentequipmenteventsimportantlivestockpracticespublicshowshowstradework
SHARED TOKENS (15): "agricultural", "agriculture", "animal", "associated", "different", "equipment", "events", "important", "livestock", "practices", "public", "show", "shows", "trade", "work".
0.300
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysiscompositiondistinctexpandedfieldfoodformationfunctionsgenerallyidentificationimportantlargerequirementsscalesinglestructurestudysystem
SHARED TOKENS (19): "activity", "analysis", "composition", "distinct", "expanded", "field", "food", "formation", "functions", "generally", "identification", "important", "large", "requirements", "scale", "single", "structure", "study", "system".
0.300
activeaddressadvertisingamongcurrentcustomersdatadominantestablishmentfirmsgeneralmanagementmediaonlineplatformspractitionersproductspublicrathersetting
SHARED TOKENS (20): "active", "address", "advertising", "among", "current", "customers", "data", "dominant", "establishment", "firms", "general", "management", "media", "online", "platforms", "practitioners", "products", "public", "rather", "setting".
0.300
connectedequipmentexamplefacilitieshumaninfrastructurelargemunicipalprivacyrequireroomssinglesitessmallsystemtreatmenttype
SHARED TOKENS (17): "connected", "equipment", "example", "facilities", "human", "infrastructure", "large", "municipal", "privacy", "require", "rooms", "single", "sites", "small", "system", "treatment", "type".
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
agreementsamongapplicablebeyondcertaincommonlycontroldistributioneducationalestablishingextendformformalintellectualintendedjurisdictionlargelawlegallicense
SHARED TOKENS (36): "agreements", "among", "applicable", "beyond", "certain", "commonly", "control", "distribution", "educational", "establishing", "extend", "form", "formal", "intellectual", "intended", "jurisdiction", "large", "law", "legal", "license"....
0.300
activitiesaffectaircategoriesdesignatedestablishedexposurehealthhumanmillionmultipleprecipitationqualityrisksafestandardstype
SHARED TOKENS (17): "activities", "affect", "air", "categories", "designated", "established", "exposure", "health", "human", "million", "multiple", "precipitation", "quality", "risk", "safe", "standards", "type".
0.300
academicadministrationbusinesscenterscollegededicateddegreedepartmentfieldindustrymanagementmasterrelevantrestaurantsschoolstudysubjectuniversity
SHARED TOKENS (18): "academic", "administration", "business", "centers", "college", "dedicated", "degree", "department", "field", "industry", "management", "master", "relevant", "restaurants", "school", "study", "subject", "university".
0.300
classificationexampleexplainsfieldhistoryinformationmajormedicalphysicalprocedureproceduresprocessprofessionalrequiredstatisticsstudyview
SHARED TOKENS (17): "classification", "example", "explains", "field", "history", "information", "major", "medical", "physical", "procedure", "procedures", "process", "professional", "required", "statistics", "study", "view".
0.300
becomecomplexconsolidationconsumersdifferentdirectlyeconomyexamplefinallargemanagementmarketneedownedownershipownspositionproblemproducesproducts
SHARED TOKENS (26): "become", "complex", "consolidation", "consumers", "different", "directly", "economy", "example", "final", "large", "management", "market", "need", "owned", "ownership", "owns", "position", "problem", "produces", "products"....
0.300
activitiesactivityadministrationagenciesbuiltchangescontroldivisioneconomiceducationenforcementenvironmentexecutiveexpandedgenerallygoverninggovernmenthumanincreaseinfluence
SHARED TOKENS (32): "activities", "activity", "administration", "agencies", "built", "changes", "control", "division", "economic", "education", "enforcement", "environment", "executive", "expanded", "generally", "governing", "government", "human", "increase", "influence"....
0.300
affectanimalapplicationsconditionscontrolcoveringdifferentfoodhealthhumanlivestockmaintainmanagementmedicalpreventionprofessionalresearchsafesafetyscience
SHARED TOKENS (28): "affect", "animal", "applications", "conditions", "control", "covering", "different", "food", "health", "human", "livestock", "maintain", "management", "medical", "prevention", "professional", "research", "safe", "safety", "science"....
0.300
allowingappliesapplyauthorizedbasecertainchangecommunitycompliancedistributionfacilityfederalfinalfundinggovernmenthomeindividualinsteadjurisdictionland
SHARED TOKENS (49): "allowing", "applies", "apply", "authorized", "base", "certain", "change", "community", "compliance", "distribution", "facility", "federal", "final", "funding", "government", "home", "individual", "instead", "jurisdiction", "land"....
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagenciesagriculturalapplicationscenterscharacteristicscomplexconditionscreatedeterminedevelopmentdifferentfoodgovernmentimportantindustryknowledgelandmethodsmillion
SHARED TOKENS (32): "additional", "agencies", "agricultural", "applications", "centers", "characteristics", "complex", "conditions", "create", "determine", "development", "different", "food", "government", "important", "industry", "knowledge", "land", "methods", "million"....
0.300
applicableappliedassociationauthoritybehaviorcentralchangechangescommunitiescommunitycomparableconditionsconservationcostsdependdependsdesigndevelopmentdistrictseconomic
SHARED TOKENS (47): "applicable", "applied", "association", "authority", "behavior", "central", "change", "changes", "communities", "community", "comparable", "conditions", "conservation", "costs", "depend", "depends", "design", "development", "districts", "economic"....
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
animalcommonlyconditionscontainingcontrolleddevelopmentenvironmentformgenerallygrowthisolatedmaintainedmethodsneedoriginaloutsidepopulationpracticeprocessregulates
SHARED TOKENS (26): "animal", "commonly", "conditions", "containing", "controlled", "development", "environment", "form", "generally", "growth", "isolated", "maintained", "methods", "need", "original", "outside", "population", "practice", "process", "regulates"....
0.300
businesscomconnectconnectsconsumerscreatescustomersdemanddevelopeddevelopmentdirectdistincteconomicexampleexplainingformalizedfoundhealthjobmaintenance
SHARED TOKENS (46): "business", "com", "connect", "connects", "consumers", "creates", "customers", "demand", "developed", "development", "direct", "distinct", "economic", "example", "explaining", "formalized", "found", "health", "job", "maintenance"....
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activityanimalcoldcommercialconditionsconsumersdeliverydistributionemergencyexamplefacefoodformhumanimportantlaterlifelogisticspeopleproducts
SHARED TOKENS (28): "activity", "animal", "cold", "commercial", "conditions", "consumers", "delivery", "distribution", "emergency", "example", "face", "food", "form", "human", "important", "later", "life", "logistics", "people", "products"....
0.300
adjacentaffectagriculturalagriculturechangecharacteristicscommunitiesconnectconservationcontaminationcontrolecosystemengineeringevenfoodhealthhumanimportantinfluenceinterface
SHARED TOKENS (43): "adjacent", "affect", "agricultural", "agriculture", "change", "characteristics", "communities", "connect", "conservation", "contamination", "control", "ecosystem", "engineering", "even", "food", "health", "human", "important", "influence", "interface"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
airapplicationsapproximatelycapablechangesfeedidentifiesincreaseissuelargelivestockmaterialsmechanismoperateoperatesoperationoperationsphasephysicalprocess
SHARED TOKENS (32): "air", "applications", "approximately", "capable", "changes", "feed", "identifies", "increase", "issue", "large", "livestock", "materials", "mechanism", "operate", "operates", "operation", "operations", "phase", "physical", "process"....
0.300
activitiesanimalappearsassociatedcapablecharacteristicscontainingdetaileddevicesdisposaldistinctemergencyenvironmentfacilitiesgeneralgeneratehealthhomehumaninvolving
SHARED TOKENS (34): "activities", "animal", "appears", "associated", "capable", "characteristics", "containing", "detailed", "devices", "disposal", "distinct", "emergency", "environment", "facilities", "general", "generate", "health", "home", "human", "involving"....
0.300
containscouncildifferentexamplehistoryhomehouseorganizationoriginalpeoplephysicalplacementrolesitestandardssupportvalue
SHARED TOKENS (17): "contains", "council", "different", "example", "history", "home", "house", "organization", "original", "people", "physical", "placement", "role", "site", "standards", "support", "value".
0.300
Food truck ↗ KW CROSS HIGH
amongbecomecommercialcustomersdevelopedeconomicfoodincreasinglyindustrylargemajoroperationpartspeopleregionalsellsurroundingtransportwaterworkers
SHARED TOKENS (20): "among", "become", "commercial", "customers", "developed", "economic", "food", "increasingly", "industry", "large", "major", "operation", "parts", "people", "regional", "sell", "surrounding", "transport", "water", "workers".
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
compensationcontractdifferenteventsexampleexpresslyforminsurancelawmedicaloperationperformprincipalrelationshiprelevantspecified
SHARED TOKENS (16): "compensation", "contract", "different", "events", "example", "expressly", "form", "insurance", "law", "medical", "operation", "perform", "principal", "relationship", "relevant", "specified".
0.300
applyfederalregulatoryresearchstandards
SHARED TOKENS (5): "apply", "federal", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.300
applicationsapplycodedesigndetailedengineeringevenexpandedfoundfunctiongeneralknowledgemarketmethodsprocessproductionresearchstructurevalue
SHARED TOKENS (19): "applications", "apply", "code", "design", "detailed", "engineering", "even", "expanded", "found", "function", "general", "knowledge", "market", "methods", "process", "production", "research", "structure", "value".
0.300
administersadministrationcenterscertificationcommonlydepartmentfacilitiesfederalfinancinggovhealthhomehumaninsuranceprocessprogramprogramsqualityreportsstandards
SHARED TOKENS (21): "administers", "administration", "centers", "certification", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "home", "human", "insurance", "process", "program", "programs", "quality", "reports", "standards"....
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscontroldedicateddepartmentdominantfacilitiesholdingintendedmajormodernparkingpeoplerequirerequiresthemtransportationwater
SHARED TOKENS (17): "buildings", "control", "dedicated", "department", "dominant", "facilities", "holding", "intended", "major", "modern", "parking", "people", "require", "requires", "them", "transportation", "water".
0.300
accessactivitiesadvertisingbehaviorbusinessescommonlyconstraintsconsumerscontrolledcurrentcustomersdatadevicesdocumentedevenformgenerallygeographicgovernmenthealth
SHARED TOKENS (37): "access", "activities", "advertising", "behavior", "businesses", "commonly", "constraints", "consumers", "controlled", "current", "customers", "data", "devices", "documented", "even", "form", "generally", "geographic", "government", "health"....
0.300
administrationconditionscostsdepartmenteducationeffectsemploymentestablishedfederalhealthinspectionslaborlawmissionoccupationalregulationsregulatorysafesafetysetting
SHARED TOKENS (23): "administration", "conditions", "costs", "department", "education", "effects", "employment", "established", "federal", "health", "inspections", "labor", "law", "mission", "occupational", "regulations", "regulatory", "safe", "safety", "setting"....
0.300
activeadvertisingaffectallowingapplicationsbusinesseschannelsconnectconsumerscreatecustomersdevelopeddispenseentryexampleimmediateincreasinginfluenceinformationmedia
SHARED TOKENS (37): "active", "advertising", "affect", "allowing", "applications", "businesses", "channels", "connect", "consumers", "create", "customers", "developed", "dispense", "entry", "example", "immediate", "increasing", "influence", "information", "media"....
0.300
airconcerningconsolidationcontroldifferentdocumentationexampleinsurancejoblogisticsmanagementmaterialsmovepeopleplanningpurchasingtraintransportworking
SHARED TOKENS (19): "air", "concerning", "consolidation", "control", "different", "documentation", "example", "insurance", "job", "logistics", "management", "materials", "move", "people", "planning", "purchasing", "train", "transport", "working".
0.300
academicbecomebehaviorcommonlycostsdedicateddevelopeddevelopmentdevicesdiscoveryhomeinformationlargemaintenancemajormediamultiplenewsonlineoperate
SHARED TOKENS (36): "academic", "become", "behavior", "commonly", "costs", "dedicated", "developed", "development", "devices", "discovery", "home", "information", "large", "maintenance", "major", "media", "multiple", "news", "online", "operate"....
0.300
administrationbusinesscapitalcompensationconsolidationdepartmentsdesigndevelopmentdocumentingearlyemployeefieldhumaninvolvinglabormanagementorganizationpeopleperformanceplanning
SHARED TOKENS (29): "administration", "business", "capital", "compensation", "consolidation", "departments", "design", "development", "documenting", "early", "employee", "field", "human", "involving", "labor", "management", "organization", "people", "performance", "planning"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
commonlycreateeffectsequipmenteveneventsfunctionsinsteadlaterleastmediaprivateprogramspublicrealrecordrecordssmallsoftwaresound
SHARED TOKENS (24): "commonly", "create", "effects", "equipment", "even", "events", "functions", "instead", "later", "least", "media", "private", "programs", "public", "real", "record", "records", "small", "software", "sound"....
0.300
advantagebusinesscontractcontroldesigndirectentryfunctionsgovernmentindustrylargelicensinglocallowermanagementmethodsoperatingoperationoperationalpersonnel
SHARED TOKENS (28): "advantage", "business", "contract", "control", "design", "direct", "entry", "functions", "government", "industry", "large", "licensing", "local", "lower", "management", "methods", "operating", "operation", "operational", "personnel"....
0.300
activitiesamonganalysisbehaviorcentercompletecomplexconcerningconventionalcreatedatadescriptiondetaileddifferenteffectsexamplefieldfunctionfunctionsgenerating
SHARED TOKENS (47): "activities", "among", "analysis", "behavior", "center", "complete", "complex", "concerning", "conventional", "create", "data", "description", "detailed", "different", "effects", "example", "field", "function", "functions", "generating"....
0.300
conditionseducationemergencyenforcementengineeringenvironmentfireknowledgemethodspracticespreventionresponsesafelysurroundingthem
SHARED TOKENS (15): "conditions", "education", "emergency", "enforcement", "engineering", "environment", "fire", "knowledge", "methods", "practices", "prevention", "response", "safely", "surrounding", "them".
0.300
Wedding ↗ Q49836 EXACT TITLE
authoritycommonlyincorporatedpeoplepublic
SHARED TOKENS (5): "authority", "commonly", "incorporated", "people", "public". | EXACT TITLE in wedding_events: "Wedding".
0.300
analysisappliedarchitecturebeyondcommercialdatadevelopmentdifferentequipmentevenexampleexecutionfacilitiesfunctionsgenerallyhistoricallyinformationinfrastructuremanagementmarkets
SHARED TOKENS (37): "analysis", "applied", "architecture", "beyond", "commercial", "data", "development", "different", "equipment", "even", "example", "execution", "facilities", "functions", "generally", "historically", "information", "infrastructure", "management", "markets"....
0.300
agreementsanchorappliesbecomebuildingscenterscommunitiesconnectionconservationdocumentseconomicindustryintellectualknowledgelegallocalmajornationalphysicalproperty
SHARED TOKENS (25): "agreements", "anchor", "applies", "become", "buildings", "centers", "communities", "connection", "conservation", "documents", "economic", "industry", "intellectual", "knowledge", "legal", "local", "major", "national", "physical", "property"....
0.300
activitiesappliedappliesapplyauthorityauthorizedboardcapacityconditionsconductconsentdefinitionsevidenceexampleformformalizedgenerallyimmediateindividualinformation
SHARED TOKENS (44): "activities", "applied", "applies", "apply", "authority", "authorized", "board", "capacity", "conditions", "conduct", "consent", "definitions", "evidence", "example", "form", "formalized", "generally", "immediate", "individual", "information"....
0.300
Vineyard ↗ Q22715 EXACT TITLE
characteristicspracticeproductionsciencestudy
SHARED TOKENS (5): "characteristics", "practice", "production", "science", "study". | EXACT TITLE in wedding_events: "Vineyard".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
alongsideapplicationsclassifiedcompositiondesigndeterminediscoverydistributioneffectsfieldfunctionfunctionshealthmedicalpracticeresearchrolesciencesystems
SHARED TOKENS (19): "alongside", "applications", "classified", "composition", "design", "determine", "discovery", "distribution", "effects", "field", "function", "functions", "health", "medical", "practice", "research", "role", "science", "systems".
0.300
activitiescommunitydifferentemergencyeventsfederalgenerallylocalmanagementneedspreventionprofessionalrequiresresponserisksearch
SHARED TOKENS (16): "activities", "community", "different", "emergency", "events", "federal", "generally", "local", "management", "needs", "prevention", "professional", "requires", "response", "risk", "search".
0.300
activeagenciesassociatedbusinessescapacityconcentrationconsequencesdeterminedistributioneconomicemploymententryexampleexistingfirmsfunctionimportantindustrylandlaw
SHARED TOKENS (37): "active", "agencies", "associated", "businesses", "capacity", "concentration", "consequences", "determine", "distribution", "economic", "employment", "entry", "example", "existing", "firms", "function", "important", "industry", "land", "law"....
0.300
alreadyapplicationsassociatedbecomechangeconcerningconditionscreatecurrentdevelopmentexamplefoundimportantmajormedicalmethodsopportunitiesphasephysicalrelated
SHARED TOKENS (25): "already", "applications", "associated", "become", "change", "concerning", "conditions", "create", "current", "development", "example", "found", "important", "major", "medical", "methods", "opportunities", "phase", "physical", "related"....
0.300
activitiesaddressadvertisingbroaderbusinessbusinessescentralcontrolledcorecreatecustomersdirectestablisheventsexampleexecutiveexposurefieldfirmsform
SHARED TOKENS (55): "activities", "address", "advertising", "broader", "business", "businesses", "central", "controlled", "core", "create", "customers", "direct", "establish", "events", "example", "executive", "exposure", "field", "firms", "form"....
0.300
Beer garden ↗ Q857909 EXACT TITLE
capitalfoodlocalremainshared
SHARED TOKENS (5): "capital", "food", "local", "remain", "shared". | EXACT TITLE in wedding_events: "Beer garden".
0.300
advancedapplicationscategoryconsumercontainingcontrolsconventionalearlyexposurefieldfinalformfunctionshistoryincorporatedindustryinsteadinterfacelatermanual
SHARED TOKENS (45): "advanced", "applications", "category", "consumer", "containing", "controls", "conventional", "early", "exposure", "field", "final", "form", "functions", "history", "incorporated", "industry", "instead", "interface", "later", "manual"....
0.300
advertisingagenciesbecomecreatedeliveredestimatesformincreaseincreasinglyindependentmediamultipleonlineoperatingplatformspracticesproductsregulationresearchrevenue
SHARED TOKENS (27): "advertising", "agencies", "become", "create", "delivered", "estimates", "form", "increase", "increasingly", "independent", "media", "multiple", "online", "operating", "platforms", "practices", "products", "regulation", "research", "revenue"....
0.300
agenciesarchitectsarchitectureconditionscontroldesignengineeringestateexistinggeneralhumaninfrastructureinvestigationlicenselicensedmanagementmasterplanningpossessprivate
SHARED TOKENS (25): "agencies", "architects", "architecture", "conditions", "control", "design", "engineering", "estate", "existing", "general", "human", "infrastructure", "investigation", "license", "licensed", "management", "master", "planning", "possess", "private"....
0.300
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciesappliescommunityfoundgenerallyhumanindustrylargeproductionprofessionalprojectremainrequiredthemwhosework
SHARED TOKENS (17): "access", "agencies", "applies", "community", "found", "generally", "human", "industry", "large", "production", "professional", "project", "remain", "required", "them", "whose", "work".
0.300
Vocational education ↗ KW CROSS HIGH
collegecommunitydesignedeconomiceducationeducationalformalgeneralindividualknowledgelifemethodsoccupationrelatedschoolspecializedtechnologytradetrainingtype
SHARED TOKENS (21): "college", "community", "designed", "economic", "education", "educational", "formal", "general", "individual", "knowledge", "life", "methods", "occupation", "related", "school", "specialized", "technology", "trade", "training", "type"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecertainconservationdifferentestateexamplefacilitygovernmentinsteadlandlegallocaloperateoriginalotherwiseownershippartspathpeople
SHARED TOKENS (28): "authority", "capable", "certain", "conservation", "different", "estate", "example", "facility", "government", "instead", "land", "legal", "local", "operate", "original", "otherwise", "ownership", "parts", "path", "people"....
0.300
applicationsappliedassociatedcertaindefinitionsdifferentengineeringfieldformationfunctionsinvolvingmaintainmaterialsmedicalmethodsperformpracticerequiresupportsystem
SHARED TOKENS (21): "applications", "applied", "associated", "certain", "definitions", "different", "engineering", "field", "formation", "functions", "involving", "maintain", "materials", "medical", "methods", "perform", "practice", "require", "support", "system"....
0.300
accessactivitiesadministrationannouncedassociationcapacitycenterschangescontroldepartmentdesignededucationalfebruaryfederalfoodgovernmenthealthhumaninformationinstitutional
SHARED TOKENS (37): "access", "activities", "administration", "announced", "association", "capacity", "centers", "changes", "control", "department", "designed", "educational", "february", "federal", "food", "government", "health", "human", "information", "institutional"....
0.300
certificationcompleteexperiencedextendfieldformalfoundjoblaborlicensemasteroccupationoutsidepeopleplacementpracticepractitionersprofessionalreachregulated
SHARED TOKENS (25): "certification", "complete", "experienced", "extend", "field", "formal", "found", "job", "labor", "license", "master", "occupation", "outside", "people", "placement", "practice", "practitioners", "professional", "reach", "regulated"....
0.300
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialcommerciallydedicateddistinctequipmenthomeindustryleastmakesprocessproductionprotectionscalesizeworkers
SHARED TOKENS (17): "built", "business", "commercial", "commercially", "dedicated", "distinct", "equipment", "home", "industry", "least", "makes", "process", "production", "protection", "scale", "size", "workers".
0.300
applicableapproximatelybegincontaminationdirectlyeconomiceffectsevenexampleexposurefoodleastmillionrequiringresponseresulting
SHARED TOKENS (16): "applicable", "approximately", "begin", "contamination", "directly", "economic", "effects", "even", "example", "exposure", "food", "least", "million", "requiring", "response", "resulting".
0.300
academicaccessagenciesannualapplicationsapproximatelybrandedbusinessescapitalcooperativedevelopeddevelopmentdiscoverydistinctdocumentededucationeffectsevaluationexpansionfield
SHARED TOKENS (54): "academic", "access", "agencies", "annual", "applications", "approximately", "branded", "businesses", "capital", "cooperative", "developed", "development", "discovery", "distinct", "documented", "education", "effects", "evaluation", "expansion", "field"....
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicadvertisingaloneappliedassociatedbeyondconsolidationconsumerdemanddesigndevelopmentdifferentdistinctestablishedexampleexperiencedfieldgrowthhumaninformation
SHARED TOKENS (37): "academic", "advertising", "alone", "applied", "associated", "beyond", "consolidation", "consumer", "demand", "design", "development", "different", "distinct", "established", "example", "experienced", "field", "growth", "human", "information"....
0.300
accordingadministrationannualapprovalcenterchangescomplianceestablishmentevaluationeventsfacilitiesfoodforminformationinterstatelegallicensephaseproductsregulated
SHARED TOKENS (26): "according", "administration", "annual", "approval", "center", "changes", "compliance", "establishment", "evaluation", "events", "facilities", "food", "form", "information", "interstate", "legal", "license", "phase", "products", "regulated"....
0.300
additionaladdresscertaincontroldifferentestablishedgenerallygovernmentlegallocalmunicipalnationalprivatepublicregulationregulationsresidentssoundsourcestandard
SHARED TOKENS (23): "additional", "address", "certain", "control", "different", "established", "generally", "government", "legal", "local", "municipal", "national", "private", "public", "regulation", "regulations", "residents", "sound", "source", "standard"....
0.300
applicationsappliescommonlycontrolcorporatedifferenteffectsequipmenteventsmodernoperatepeopleperformancepersonnelproductionshowstechnicianstradework
SHARED TOKENS (19): "applications", "applies", "commonly", "control", "corporate", "different", "effects", "equipment", "events", "modern", "operate", "people", "performance", "personnel", "production", "shows", "technicians", "trade", "work".
0.300
allowingappliesapproximatelyauthorizationbeyondcertaincommonlyconsentgenerallawleastlegalmedicalrequirerights
SHARED TOKENS (15): "allowing", "applies", "approximately", "authorization", "beyond", "certain", "commonly", "consent", "general", "law", "least", "legal", "medical", "require", "rights".
0.300
addresscategoriescommunitiescurrentdevelopedeconomiceconomyfinanceformhealthindustrymedicalpercentproductspurchasingrequirementssharesystem
SHARED TOKENS (18): "address", "categories", "communities", "current", "developed", "economic", "economy", "finance", "form", "health", "industry", "medical", "percent", "products", "purchasing", "requirements", "share", "system".
0.300
approvedconservationdepartmenteducationemployeeenforcementestablishingestablishmentexecutivefederalgovernmenthouseindependentinformationlegallocalmattersnationaloperationpermitting
SHARED TOKENS (27): "approved", "conservation", "department", "education", "employee", "enforcement", "establishing", "establishment", "executive", "federal", "government", "house", "independent", "information", "legal", "local", "matters", "national", "operation", "permitting"....
0.300
addressbuildingscomplexconnectedcontrolledeffectseventsexamplehundredsimportantindustryintendedmakesmarketsmultipleprocessingprofessionalpublicsinglesmall
SHARED TOKENS (26): "address", "buildings", "complex", "connected", "controlled", "effects", "events", "example", "hundreds", "important", "industry", "intended", "makes", "markets", "multiple", "processing", "professional", "public", "single", "small"....
0.300
activeagainstapprovalbecomecommercialcomplexdevelopeddevelopmentdiscoveryeffectsexperiencefundinghealthhistoricallyhumanidentificationidentifiedidentifyingincreaseindustry
SHARED TOKENS (41): "active", "against", "approval", "become", "commercial", "complex", "developed", "development", "discovery", "effects", "experience", "funding", "health", "historically", "human", "identification", "identified", "identifying", "increase", "industry"....
0.300
accesscenterscontainmentcontrolequipmentestablishedfacilitiesfacilityhealthmultiplepersonnelpreventionproceduresprotectionpublicationreportsrequiredroomsspecifiedsystems
SHARED TOKENS (21): "access", "centers", "containment", "control", "equipment", "established", "facilities", "facility", "health", "multiple", "personnel", "prevention", "procedures", "protection", "publication", "reports", "required", "rooms", "specified", "systems"....
0.300
advertisingbusinessbusinessescommercialconditionsdutiesgeneralgenerallyimposesinsuranceliabilitymarketmedicaloperationspoliciespolicyprofessionalpropertypublicseparate
SHARED TOKENS (22): "advertising", "business", "businesses", "commercial", "conditions", "duties", "general", "generally", "imposes", "insurance", "liability", "market", "medical", "operations", "policies", "policy", "professional", "property", "public", "separate"....
0.300
additionalapplicableapplyauthoritydemandfacegeneralgenerallygovernedidaholocalnationaloverviewproductsrequireresidentsrulessoldstatewidesubject
SHARED TOKENS (22): "additional", "applicable", "apply", "authority", "demand", "face", "general", "generally", "governed", "idaho", "local", "national", "overview", "products", "require", "residents", "rules", "sold", "statewide", "subject"....
0.300
announcedapprovedcentercreatelaternetworkoperatesoperatingoriginalpacificprincipalprojectreachregulatorsreportingroutesystemtransportationwestern
SHARED TOKENS (19): "announced", "approved", "center", "create", "later", "network", "operates", "operating", "original", "pacific", "principal", "project", "reach", "regulators", "reporting", "route", "system", "transportation", "western".
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adaairbaseboisecentercommercialdepartmentfacilityfallsfieldfirefunctionsgeneralidahoincreasemillionnationaloperatesprotectionreceive
SHARED TOKENS (27): "ada", "air", "base", "boise", "center", "commercial", "department", "facility", "falls", "field", "fire", "functions", "general", "idaho", "increase", "million", "national", "operates", "protection", "receive"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesappliesassetsbusinesscategoriescodecommercialconductconsumercreateemploymentestablishingfinancefinancingfoodformationframeworkgeneralgoverngoverning
SHARED TOKENS (46): "activities", "applies", "assets", "business", "categories", "code", "commercial", "conduct", "consumer", "create", "employment", "establishing", "finance", "financing", "food", "formation", "framework", "general", "govern", "governing"....
0.300
administersagriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyexecutivefebruaryfederalfoodgovernmentlivestocknationalneedsnutritionproductionprogram
SHARED TOKENS (25): "administers", "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "executive", "february", "federal", "food", "government", "livestock", "national", "needs", "nutrition", "production", "program"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesscommercialdataindustryinventorymanagementonlineplatformsprocessingproductssegmentsupplysystemstransfertype
SHARED TOKENS (16): "activities", "business", "commercial", "data", "industry", "inventory", "management", "online", "platforms", "processing", "products", "segment", "supply", "systems", "transfer", "type".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
appliedapplyapprovedarchitectsauthoritybuildingbuildingscodecodescompliancecontrolcouncildepartmentsdesigneffectselectricalestateexamplefacilitygeneral
SHARED TOKENS (47): "applied", "apply", "approved", "architects", "authority", "building", "buildings", "code", "codes", "compliance", "control", "council", "departments", "design", "effects", "electrical", "estate", "example", "facility", "general"....
0.300
characteristicscontainingdataengineeringfunctionhealthphysicalpopulationpracticeprocessresearchroutinelyseparatesizeuses
SHARED TOKENS (15): "characteristics", "containing", "data", "engineering", "function", "health", "physical", "population", "practice", "process", "research", "routinely", "separate", "size", "uses".
0.300
analysisapplicationsbecomebuildingchangesdetaileddevelopeddifferentexampleidentificationisolatedmedicalmethodsoriginalproceduresprocessrapidlyregionresearchscience
SHARED TOKENS (24): "analysis", "applications", "become", "building", "changes", "detailed", "developed", "different", "example", "identification", "isolated", "medical", "methods", "original", "procedures", "process", "rapidly", "region", "research", "science"....
0.300
accessibilityactivitiesairassociatedbroaderbusinesscategoriescertaindependencedevelopmentdistrictsenvironmentfallsgenerallyimpliesincreasedinvolvinglinkslocalpeople
SHARED TOKENS (29): "accessibility", "activities", "air", "associated", "broader", "business", "categories", "certain", "dependence", "development", "districts", "environment", "falls", "generally", "implies", "increased", "involving", "links", "local", "people"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
brandedbusinesscapitalcertainconditionscorporatedirecteconomicexampleexpansionexplicitlygrowthindividualintellectuallargelegalliabilitylicensingmarketmeans
SHARED TOKENS (35): "branded", "business", "capital", "certain", "conditions", "corporate", "direct", "economic", "example", "expansion", "explicitly", "growth", "individual", "intellectual", "large", "legal", "liability", "licensing", "market", "means"....
0.300
agricultureapplicationscertainexamplefoodhealthhumaninformationlifemajorphysicalqualityscalesciencestandardstudytype
SHARED TOKENS (17): "agriculture", "applications", "certain", "example", "food", "health", "human", "information", "life", "major", "physical", "quality", "scale", "science", "standard", "study", "type".
0.300
Ridesharing company ↗ KW CROSS HIGH
cannotcontractorsdemandindependentinsurancejurisdictionlegallylicensinglocalmodelonlineoperateoperationsregulationsrequiredrequirementssubjectsupplythemwage
SHARED TOKENS (20): "cannot", "contractors", "demand", "independent", "insurance", "jurisdiction", "legally", "licensing", "local", "model", "online", "operate", "operations", "regulations", "required", "requirements", "subject", "supply", "them", "wage".
0.300
addressapplicationsbuildingbuildingscommercialcommonlydistributionemergencyequipmenteventsfacilitiesgenerallyhumaninstitutionallargemeansmultiplepublicrelatedrequires
SHARED TOKENS (29): "address", "applications", "building", "buildings", "commercial", "commonly", "distribution", "emergency", "equipment", "events", "facilities", "generally", "human", "institutional", "large", "means", "multiple", "public", "related", "requires"....
0.300
businesscommunityfinancegeneratelocalmissionoperatesoperationsorganizationprivateprogrampublicratherreceiverevenuestatussubject
SHARED TOKENS (17): "business", "community", "finance", "generate", "local", "mission", "operates", "operations", "organization", "private", "program", "public", "rather", "receive", "revenue", "status", "subject".
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysiscapacitycommercialconnectingcontrolcoredevelopmentenvironmentestablishesfundinggovernmentimportantinfluenceintellectualknowledgelicensingmarketmeans
SHARED TOKENS (38): "academic", "activity", "analysis", "capacity", "commercial", "connecting", "control", "core", "development", "environment", "establishes", "funding", "government", "important", "influence", "intellectual", "knowledge", "licensing", "market", "means"....
0.300
accordingaddressamongappliedappliesauthorizationbecomebureaucertainconsentdifferentearlyeconomicemployersentryfallsformalfoundfunctionsgeneral
SHARED TOKENS (40): "according", "address", "among", "applied", "applies", "authorization", "become", "bureau", "certain", "consent", "different", "early", "economic", "employers", "entry", "falls", "formal", "found", "functions", "general"....
0.300
amongdevelopmentdifferentengineeringhealthidentifiedindividualleastmedicalmodelnationalpeoplepracticesproductsrelatedresponserisksystemsthereforetreatment
SHARED TOKENS (20): "among", "development", "different", "engineering", "health", "identified", "individual", "least", "medical", "model", "national", "people", "practices", "products", "related", "response", "risk", "systems", "therefore", "treatment".
0.300
Marquee ↗ Q1621931 KW CROSS HIGH
buildingcommonlycoveringgenerallylargemakesnetworkpageregionalsinglesmallstationstructuretexttraintype
SHARED TOKENS (16): "building", "commonly", "covering", "generally", "large", "makes", "network", "page", "regional", "single", "small", "station", "structure", "text", "train", "type".
🫐 BERRY55 edges
0.280
Interior design ↗ KW CROSS HIGH
buildingdesigndevelopmentenvironmentexecutioninspectionsmanagementpeopleplanningprojectresearchsciencesitespace
SHARED TOKENS (14): "building", "design", "development", "environment", "execution", "inspections", "management", "people", "planning", "project", "research", "science", "site", "space".
0.280
Alfalfa ↗ Q156106 EXACT TITLE
commonlyfamilyimportantlivestock
SHARED TOKENS (4): "commonly", "family", "important", "livestock". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.280
Water quality ↗ Q625376 KW CROSS HIGH
againstcharacteristicscompliancedeterminesgenerallyhealthhumanphysicalqualitysafetystandardssupplytreatmentwater
SHARED TOKENS (14): "against", "characteristics", "compliance", "determines", "generally", "health", "human", "physical", "quality", "safety", "standards", "supply", "treatment", "water".
0.280
Serology ↗ Q502159 EXACT TITLE
againstexampleresponsestudy
SHARED TOKENS (4): "against", "example", "response", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.280
investigatorslawprivatework
SHARED TOKENS (4): "investigators", "law", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.280
accuracyconsumerscustomersdedicatedevaluationexperienceforminsteadonlineproductsprofessionalpurchasingreviewsites
SHARED TOKENS (14): "accuracy", "consumers", "customers", "dedicated", "evaluation", "experience", "form", "instead", "online", "products", "professional", "purchasing", "review", "sites".
0.280
beyondbusinessbusinessesearlyfacefundinggrowthinfluencelargemodelprivateprojectpublicrapid
SHARED TOKENS (14): "beyond", "business", "businesses", "early", "face", "funding", "growth", "influence", "large", "model", "private", "project", "public", "rapid".
0.280
Biophysics ↗ Q7100 EXACT TITLE
appliesmethodssciencestudy
SHARED TOKENS (4): "applies", "methods", "science", "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.270
currentexecutivegovernmentidahoofficeposition
SHARED TOKENS (6): "current", "executive", "government", "idaho", "office", "position". | URL->A (1): https://sos.idaho.gov/.
0.260
Baker ↗ Q160131 EXACT TITLE
concentratedproductssource
SHARED TOKENS (3): "concentrated", "products", "source". | EXACT TITLE in wedding_events: "Baker".
0.260
Decoration ↗ Q1232942 EXACT TITLE
houseincreaseintended
SHARED TOKENS (3): "house", "increase", "intended". | EXACT TITLE in wedding_events: "Decoration".
0.260
Train station ↗ Q55488 KW CROSS HIGH
boardbuildingconnectionsfacilitygenerallyleastplatformrapidroomsstationsystemstraintransport
SHARED TOKENS (13): "board", "building", "connections", "facility", "generally", "least", "platform", "rapid", "rooms", "station", "systems", "train", "transport".
0.260
Quinceañera ↗ EXACT TITLE
differentfoodpractices
SHARED TOKENS (3): "different", "food", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.260
boisedesignatedfallshomeidahointerstatemajormetropolitannearriverrouteservestwin
SHARED TOKENS (13): "boise", "designated", "falls", "home", "idaho", "interstate", "major", "metropolitan", "near", "river", "route", "serves", "twin".
0.240
documentsestategovernmentmaintainsofficeownershippositionpropertypublicrealrecordsrights
SHARED TOKENS (12): "documents", "estate", "government", "maintains", "office", "ownership", "position", "property", "public", "real", "records", "rights".
0.240
complexconcentrationdominanteffectsexampleinfluencemodelmodelsrelationshipsrepresentsresponsestudy
SHARED TOKENS (12): "complex", "concentration", "dominant", "effects", "example", "influence", "model", "models", "relationships", "represents", "response", "study".
0.240
familygenerallylaworganizationoutsidepaymentperformperformancepublicpubliclyrestaurantsrights
SHARED TOKENS (12): "family", "generally", "law", "organization", "outside", "payment", "perform", "performance", "public", "publicly", "restaurants", "rights".
0.220
applicationscertaindesigneddevelopedfieldintendedmedicalprogramregulatedresearchsingle
SHARED TOKENS (11): "applications", "certain", "designed", "developed", "field", "intended", "medical", "program", "regulated", "research", "single".
0.220
Calligraphy ↗ Q12681 KW CROSS HIGH
designdocumentsexecutionformindividualmodernpracticerelatedtexttypewestern
SHARED TOKENS (11): "design", "documents", "execution", "form", "individual", "modern", "practice", "related", "text", "type", "western".
0.220
administrationapprovedcouncilfoodhumaninvestigatorsmeansproceduresprogramregulationsregulatory
SHARED TOKENS (11): "administration", "approved", "council", "food", "human", "investigators", "means", "procedures", "program", "regulations", "regulatory".
0.220
Photo booth ↗ Q494312 EXACT TITLE
containsmodern
SHARED TOKENS (2): "contains", "modern". | EXACT TITLE in wedding_events: "Photo booth".
0.220
activitiesbusinessdefinitionsenvironmentgovernmenthomemeetingsorganizationoutsidepeopleworking
SHARED TOKENS (11): "activities", "business", "definitions", "environment", "government", "home", "meetings", "organization", "outside", "people", "working".
0.220
researchstudy
SHARED TOKENS (2): "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.210
Biomarker ↗ EXACT TITLE
measured
SHARED TOKENS (1): "measured". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.210
performance
SHARED TOKENS (1): "performance". | EXACT TITLE in wedding_events: "Dance floor".
0.210
Fairground ↗ Q5430425 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in wedding_events: "Fairground".
0.200
administrationconcentrationdedicateddescribingeffectsfoodinfluencemodelsrelationshipstudy
SHARED TOKENS (10): "administration", "concentration", "dedicated", "describing", "effects", "food", "influence", "models", "relationship", "study".
0.200
facilitieshealthhomeidahonetworkoperatesoperatingpeoplesupportsystem
SHARED TOKENS (10): "facilities", "health", "home", "idaho", "network", "operates", "operating", "people", "support", "system".
0.200
appliedevenfamilyfoodformratherreceivereceivingseparatewhose
SHARED TOKENS (10): "applied", "even", "family", "food", "form", "rather", "receive", "receiving", "separate", "whose".
0.200
Urban renewal ↗ Q920600 KW CROSS HIGH
businessescommunitieseconomicgovernmentgrowthinfrastructurelandprivateprocesspublic
SHARED TOKENS (10): "businesses", "communities", "economic", "government", "growth", "infrastructure", "land", "private", "process", "public".
0.200
Review site ↗ Q1340449 KW CROSS HIGH
businessescomearlylaterpeopleproductsprofessionalreviewsitesites
SHARED TOKENS (10): "businesses", "com", "early", "later", "people", "products", "professional", "review", "site", "sites".
0.200
Seed testing ↗ Q7445654 KW CROSS HIGH
analysiscommerciallydedicateddesigneddetermineevaluatequalityresearchsoldstorage
SHARED TOKENS (10): "analysis", "commercially", "dedicated", "designed", "determine", "evaluate", "quality", "research", "sold", "storage".
0.180
Mobile catering ↗ KW CROSS HIGH
businesscommonlycorporateemergencyeventsfoodmodernpeopletimes
SHARED TOKENS (9): "business", "commonly", "corporate", "emergency", "events", "food", "modern", "people", "times".
0.180
boisebuildingbuiltidaholistednationalpacificstationtrain
SHARED TOKENS (9): "boise", "building", "built", "idaho", "listed", "national", "pacific", "station", "train".
0.180
analysisconductdetermineestablishfireinvestigationknowledgerequirescience
SHARED TOKENS (9): "analysis", "conduct", "determine", "establish", "fire", "investigation", "knowledge", "require", "science".
0.180
Crowd control ↗ Q1872073 KW CROSS HIGH
controleventshundredsinvolvinglargemanagementpeoplepracticepublic
SHARED TOKENS (9): "control", "events", "hundreds", "involving", "large", "management", "people", "practice", "public".
0.160
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesignedlargepeopleroutestudentstransportuniversity
SHARED TOKENS (8): "applications", "designed", "large", "people", "route", "students", "transport", "university".
0.160
certaindifferentenvironmentformrelationshiprelationshipsstudythem
SHARED TOKENS (8): "certain", "different", "environment", "form", "relationship", "relationships", "study", "them".
0.160
certainintendedlicensedlicensingrightsseparateuseswork
SHARED TOKENS (8): "certain", "intended", "licensed", "licensing", "rights", "separate", "uses", "work".
0.160
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargemakesproducesproductionproperty
SHARED TOKENS (8): "building", "business", "equipment", "large", "makes", "produces", "production", "property".
0.160
Wedding cake ↗ Q558133 KW CROSS HIGH
builtevenmodernpartsrealsharesinglewestern
SHARED TOKENS (8): "built", "even", "modern", "parts", "real", "share", "single", "western".
0.160
academicdegreeeducationphaseprofessionalschoolstudentsundergraduate
SHARED TOKENS (8): "academic", "degree", "education", "phase", "professional", "school", "students", "undergraduate".
0.160
Hairstyle ↗ Q327496 KW CROSS HIGH
facehomehumaninfluencemethodsoutsidepracticalshape
SHARED TOKENS (8): "face", "home", "human", "influence", "methods", "outside", "practical", "shape".
0.160
Select agent ↗ KW CROSS HIGH
agriculturecontrolleddepartmenthealthhumanlawpublicsafety
SHARED TOKENS (8): "agriculture", "controlled", "department", "health", "human", "law", "public", "safety".
0.160
Equestrianism ↗ KW CROSS HIGH
activitiescommonlydescriptionpracticaltransportationwelfareworkworking
SHARED TOKENS (8): "activities", "commonly", "description", "practical", "transportation", "welfare", "work", "working".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahometropolitanpercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "metropolitan", "percent", "population".
0.140
Medical test ↗ Q2671652 KW CROSS HIGH
analysisdeterminemedicalphysicalproceduresettingtreatment
SHARED TOKENS (7): "analysis", "determine", "medical", "physical", "procedure", "setting", "treatment".
0.140
categoryestatefoodindustryplanningrealrestaurants
SHARED TOKENS (7): "category", "estate", "food", "industry", "planning", "real", "restaurants".
0.140
certificationeducationaljobperformprofessionalpublictrade
SHARED TOKENS (7): "certification", "educational", "job", "perform", "professional", "public", "trade".
0.140
lifeoperatesplanningplatformsportfolioresourcestechnology
SHARED TOKENS (7): "life", "operates", "planning", "platforms", "portfolio", "resources", "technology".
0.140
appliedarchitecturebuildingsfoundoriginalratherrelationship
SHARED TOKENS (7): "applied", "architecture", "buildings", "found", "original", "rather", "relationship".
0.120
activitiesdifferentdocumenteventslaterofficial
SHARED TOKENS (6): "activities", "different", "document", "events", "later", "official".
0.120
becomedifferentmultiplesitessubsequenttreatment
SHARED TOKENS (6): "become", "different", "multiple", "sites", "subsequent", "treatment".
0.100
AC Hotels ↗ Q5653536 KW CROSS HIGH
businessownedpipelineroomsserving
SHARED TOKENS (5): "business", "owned", "pipeline", "rooms", "serving".
0.100
applicablelandordinanceuseszoning
SHARED TOKENS (5): "applicable", "land", "ordinance", "uses", "zoning".
◈ Frequently Asked Questions
Wedding Events × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
Why do biotech companies in the Treasure Valley host corporate events and product launches in Boise's wedding venues?
Boise State University, Idaho State University, and the University of Idaho generate life sciences research that biotech firms commercialize through mergers and acquisitions, requiring professional event spaces to showcase intellectual property to investors and partners. Wedding venues in the Boise metropolitan area provide the infrastructure and capacity to host these corporate gatherings for the region's growing biotech sector.
How does the Idaho Department of Labor track employment growth from wedding event services supporting biotech conferences in Ada County?
The Idaho Department of Labor monitors job creation across Boise, Meridian, and Nampa as biotech companies expand their cold chain logistics, pharmaceutical manufacturing, and research operations, all requiring event planning and hospitality services. Wedding event planners in the Treasure Valley increasingly serve the biotech sector's networking conferences and product launches, generating measurable employment data.
What role do Treasure Valley wedding venues play in attracting private equity investors to biotech startups?
Private equity firms evaluating biotech acquisitions and mergers in the Treasure Valley use professional wedding and event venues across Boise to host investor presentations and due diligence meetings. College of Western Idaho, Boise State University, and local event spaces provide neutral ground where biotech founders demonstrate intellectual property and cold chain capabilities to capital sources.
How do online marketplaces connect wedding event vendors in Boise with biotech industry conferences?
Online marketplaces serving the Boise metropolitan area list catering, venue, and logistics services that biotech companies require for conferences and trade shows related to intellectual property licensing and pharmaceutical development. Wedding event platforms in Ada County increasingly serve biotech firms planning corporate retreats and merger celebration events throughout the Treasure Valley.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Wedding Events × Biotech Life Sciences 21 QID bridges 304 edges 8,084 ext links 2026-07-18 00:08:57 UTC 228830a043357b2b
Wedding Events corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Wedding Events ↗ boisestandard.org/standard ↗
Parent Corridors
Wedding Events × All Other Verticals