—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Wedding Events ↔ relates to ↔ Manufacturing Food Processing

32 Wikipedia bridge articles confirmed in both vertical ledgers. 304 deterministic cross-vertical edges. 7,914 external source links harvested. Every edge provenance-stamped. Every claim auditable.

32 QID Bridge Articles
304 Cross Edges
7,914 External Sources
358 Wikipedia Articles
32 🌲 Evergreen
211 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Wedding Events
× Manufacturing Food Processing
QID Bridge Articles
32
confirmed Wikipedia overlap
Total Cross Edges
304
External Sources Harvested
7,914
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Kitchen
score: 1.0000  ·  type: exact_title_cross  ·  34 shared tokens
QID Bridge Titles (20)
KitchenFood safetyTreasure ValleyBoise, IdahoWarehouseUniversity of IdahoFire safetyZoningLogisticsBoise State UniversityBoise AirportCollege of Western IdahoBusiness licenseBoise RiverSnake River PlainIdaho Department of LaborVertical integrationIdaho Department of Health and WelfareAda County, IdahoMergers and acquisitions
Shared Semantics (20 tokens)
idahoboisepublicmetropolitanadamanagementriverwesternfoodhealthestimatedlocalcapitaldepartmentproductslargemarketrelatedchainsafety
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:11:28 UTC
Content Hash
4b15d3ec6df225cc
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
32 BRIDGES
Kitchen
Q43164 EXACT TITLE 1.000
QID OVERLAP: Q43164 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (34): "cold", "commercial", "cooking", "design", "developed", "equipment", "establishment", "establishments", "facilities", "food", "found", "functions", "generally", "health", "kitchen", "kitchens", "large", "larger", "law", "market".... | EXACT TITLE in wedding_events: "Kitchen". | EXACT TITLE in manufacturing_food_processing: "Kitchen".
coldcommercialcookingdesigndevelopedequipmentestablishmentestablishmentsfacilitiesfoodfoundfunctionsgenerallyhealthkitchenkitchenslargelargerlawmarketpreparationpublicpublic-healthrelatedrequirementsresidentialrestaurantrestaurantsroomsmall+4
part of a room used for cooking and food preparation in a dwelling or in a commercial establishment. A modern middle-class residential kitchen is typically equipped with a stove, a sink with hot and cold running water, a refrigerator, and worktops and kitchen cabinets arranged according to a modular design. Many households have a microwave oven, a dishwasher, and other electric appliances. The main functions of a kitchen are to store, prepare and cook food (and to complete related tasks such as dishwashing). The room or area may also be used for dining (or small meals such as breakfast), entertaining and laundry. The design and construction of kitchens is a huge market all over the world. Commercial kitchens are found in restaurants, cafeterias, hotels, hospitals, educational and workplace facilities, army barracks, and similar establishments. These kitchens are generally larger and equipped with bigger and more heavy-duty equipment than a residential kitchen. For example, a large restaurant may have a walk-in refrigerator and a large commercial dishwashing machine. In some instances, commercial kitchen equipment such as commercial sinks are used in household settings as they offer ease of use for food preparation and high durability. In developed countries, commercial kitchens are generally subject to public health laws.
s dishwashing). The room or area may also be used for dining (or small meals such as breakfast), entertaining and laundry. The design and construction of kitchens is a huge market all over the world. Commercial kitchens are found in restaurants, cafeterias, hotels, hospitals, educational and workplace facilities, army barracks, and similar establishments. These kitchens are generally larger and equipped with bigger and more heavy-duty equipment than a residential kitchen. For example, a large restaurant may have a walk-in refrigerator and a large commercial dishwashing machine. In some instances, commercial kitchen equipment such as commercial sinks are used in household settings as they offer ease of use for food preparation and high durability. In developed countries, commercial kitchens are generally subject to public health laws.
nts. These kitchens are generally larger and equipped with bigger and more heavy-duty equipment than a residential kitchen. For example, a large restaurant may have a walk-in refrigerator and a large commercial dishwashing machine. In some instances, commercial kitchen equipment such as commercial sinks are used in household settings as they offer ease of use for food preparation and high durability. In developed countries, commercial kitchens are generally subject to public health laws.
Food safety
Q909821 EXACT TITLE 1.000
QID OVERLAP: Q909821 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (35): "cannot", "certification", "chain", "consumer", "consumers", "contamination", "creates", "describing", "developed", "enforcement", "estimated", "food", "handling", "hazards", "health", "industry", "inspection", "line", "management", "market".... | EXACT TITLE in wedding_events: "Food safety". | EXACT TITLE in manufacturing_food_processing: "Food safety".
cannotcertificationchainconsumerconsumerscontaminationcreatesdescribingdevelopedenforcementestimatedfoodhandlinghazardshealthindustryinspectionlinemanagementmarketnutritionorganizationoriginspersonsphysicalpracticespreparationrelatedresultingsafe+5
ns. In developed countries, there are intricate standards for food preparation, whereas in lesser developed countries there are fewer standards and less enforcement of those standards. Food poisoning cannot be completely avoided due to the number of persons involved in the supply chain, as well as the fact that pathogens can be introduced into foods. Issues Food safety issues and regulations concern: Agriculture and animal husbandry practices Food manufacturing practices Food additives Novel foods Genetically modified foods Food label Food contamination Chemical Contamination Chemical contamination in food happens when harmful chemicals make the food unsafe to eat. This occurs when chemicals enter food or are present at unsafe levels. This can happen at any of the four stages of production. Some of the most common chemical contaminants consist of pesticides, industrial chemicals, heavy metals, and chemicals that migrate from packaging materials. How Contamination Enters Food One of the two main reasons for chemical contamination occurring is through agricultural production and from environmental exposure. During agricultural production pesticides, fertilizers, and chemicals are used on crops. Farmers use those to protect the crops, but they can leave residues that can stay on or inside food. During environmental exposure, the plant is exposed to pollution, contaminated soil, and contaminated water. When these chemicals enter the plants, it can be absorbed naturally from polluted air, contaminated soil, or water sources. Animals can also absorb these substances through feed and environmental contact, which can even enter products such as meat and milk. Contamination is unintentional and could build up over time. Overall, contamination can come from multiple sources before food even reaches consumers. Processing and Packaging Contamination doesn't just originate from farms, it can still happen in the processing and the packaging stages. During processing, food is handled with machinery and industrial chemicals. Chemicals used during this process can contaminate the food. Chemicals from packaging itself can move into the food when using materials such as plastics, coatings, and adhesives, especially when it is hot or has been in storage for a long period of time. This is known as chemical migration, which also tends to happen with fatty foods, as they are able to absorb it more. This raises concerns about food safety. Health Effects Chemical contamination can have a big effect on human health. In the short term, people can get poisoning, nausea, and illnesses. In the long term, people can get chronic diseases and long term exposure risks. In many cases, people get effects such as endocrine disruption, which affects hormone function. Another one is neurological effects, which impacts your brain and nervous system. As effects are not the same on everyone, they all depend on the type of chemical, the amount consumed, and how long they've been exposed to it. Overall, this shows the importance of monitoring food safety. Prevention There are many ways chemical contamination in food can be reduced through the proper safety measures. First, this includes making sure that everything is going through the correct government regulations, which consists of laws enforced to have the correct safety standards, limit on chemicals such as pesticides, and an overall monitoring to make sure these regulations are being followed the correct way. Another is agricultural improvements, which can include using safer pesticides, possibly safer farming practices, and eliminating chemical overuse as much as possible. Packaging improvements can also be a great impact. This includes using safer materials and reducing chemical migration. Better technology can also help packaging production as a whole. Lastly, organization, making sure that public health agencies and global organizations help monitor and assess risks to overall improve food safety everywhere.
to food labeling, food hygiene, food additives and pesticide residues; as well as policies on biotechnology and food and guidelines for the management of governmental import and export inspection and certification systems for foods. In considering market-to-consumer practices, the usual thought is that food ought to be safe in the market and the concern is safe delivery and preparation of the food for the consumer. Food safety, nutrition and food security are closely related. Unhealthy food creates a cycle of disease and malnutrition that affects infants and adults as well. Food can transmit pathogens, which can result in the illness or death of the person or other animals. The main types of pathogens are bacteria, viruses, parasites, and fungus. The World Health Organization estimated that foodborne pathogens cause 600 million cases of diseases and 420,000 deaths per year. Food can also serve as a growth and reproductive medium for pathogens. In developed countries, there are intricate standards for food preparation, whereas in lesser developed countries there are fewer standards and less enforcement of those standards.
Pakistan The Pure Food Ordinance 1960 consolidates and amends the law in relation to the preparation and the sale of foods. Its aim is to ensure purity of food being supplied to people in the market and, therefore, provides for preventing adulteration. Pakistan Hotels and Restaurant Act, 1976 applies to all hotels and restaurants in Pakistan and seeks to control and regulate the standard of service(s) by hotels and restaurants. In addition to other provisions, under section 22(2), the sale of food or beverages that are contaminated, not prepared hygienically or served in utensils that are not hygienic or clean is an offense. South Korea Ministry of Food and Drug Safety The Ministry of Food and Drug Safety has been working for food safety since 1945. It is part of the Government of South Korea. IOAS-Organic Certification Bodies Registered in KFDA: "Organic" or related claims can be labelled on food products when organic certificates are considered as valid by KFDA. KFDA admits organic certificates which can be issued by 1) IFOAM (International Federation of Organic Agriculture Movement) accredited certification bodies 2) Government accredited certification bodies – 328 bodies in 29 countries have been registered in KFDA. Food Import Report: According to Food Import Report, it is supposed to report or register what you import.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (17): "agricultural", "boise", "historically", "idaho", "land", "local", "metropolitan", "name", "payette", "region", "river", "rural", "snake", "southwestern", "treasure", "valley", "western". | EXACT TITLE in wedding_events: "Treasure Valley". | EXACT TITLE in manufacturing_food_processing: "Treasure Valley".
agriculturalboisehistoricallyidaholandlocalmetropolitannamepayetteregionriverruralsnakesouthwesterntreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (19): "ada", "annual", "boise", "capital", "counties", "east", "employers", "estimated", "feet", "home", "idaho", "major", "metropolitan", "north", "river", "southwestern", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualboisecapitalcountieseastemployersestimatedfeethomeidahomajormetropolitannorthriversouthwesterntechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Warehouse
Q181623 EXACT TITLE 1.000
QID OVERLAP: Q181623 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (18): "agriculture", "associated", "building", "buildings", "businesses", "designed", "directly", "facility", "function", "goods", "large", "loading", "materials", "moving", "parks", "production", "standard", "warehouse". | EXACT TITLE in wedding_events: "Warehouse". | EXACT TITLE in manufacturing_food_processing: "Warehouse".
agricultureassociatedbuildingbuildingsbusinessesdesigneddirectlyfacilityfunctiongoodslargeloadingmaterialsmovingparksproductionstandardwarehouse
are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
ng goods, which are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown. There are also godowns in the Shanghai Bund. Warehousing in the past Prehistory and ancient history A warehouse can be defined functionally as a building in which to store bulk produce or goods (wares) for commercial purposes.
A warehouse is a building for storing goods. Warehouses are used by manufacturers, importers, exporters, wholesalers, transport businesses, customs, etc. For a warehouse to function efficiently, the facility must be properly slotted. They are usually large plain buildings, often in industrial parks on the outskirts of cities, towns, or villages. Warehouses usually have loading docks to load and unload goods from trucks. Sometimes warehouses are designed for the loading and unloading of goods directly from railways, airports, or seaports. They often have cranes and forklifts for moving goods, which are usually placed on ISO standard pallets and then loaded into pallet racks. Stored goods can include any raw materials, packing materials, spare parts, components, or finished goods associated with agriculture, manufacturing, and production. In India and Hong Kong, a warehouse may be referred to as a godown.
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (24): "among", "approximately", "boise", "campus", "compete", "division", "established", "extension", "falls", "idaho", "offices", "opened", "operates", "production", "professional", "public", "research", "rural", "schools", "statewide".... | EXACT TITLE in wedding_events: "University of Idaho". | EXACT TITLE in manufacturing_food_processing: "University of Idaho".
amongapproximatelyboisecampuscompetedivisionestablishedextensionfallsidahoofficesopenedoperatesproductionprofessionalpublicresearchruralschoolsstatewidestudentsuidahouniversityuntil
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Fire safety
Q2997557 EXACT TITLE 1.000
QID OVERLAP: Q2997557 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (19): "already", "building", "buildings", "codes", "commonly", "department", "division", "event", "fire", "hazards", "increases", "inspect", "occurs", "practices", "prevention", "results", "safety", "schools", "structures". | EXACT TITLE in wedding_events: "Fire safety".
alreadybuildingbuildingscodescommonlydepartmentdivisioneventfirehazardsincreasesinspectoccurspracticespreventionresultssafetyschoolsstructures
fire and those that are used to limit the spread and impact of a fire. Fire safety measures include those that are planned during the construction of a building or implemented in structures that are already standing and those that are taught or provided to occupants of the building. Threats to fire safety are commonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
e safety measures include those that are planned during the construction of a building or implemented in structures that are already standing and those that are taught or provided to occupants of the building. Threats to fire safety are commonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
ommonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (28): "activities", "building", "buildings", "combine", "determine", "developed", "development", "different", "form", "government", "guide", "land", "land-use", "local", "municipality", "perceived", "planning", "policy", "property", "regulations".... | EXACT TITLE in wedding_events: "Zoning". | EXACT TITLE in manufacturing_food_processing: "Zoning".
activitiesbuildingbuildingscombinedeterminedevelopeddevelopmentdifferentformgovernmentguidelandland-uselocalmunicipalityperceivedplanningpolicypropertyregulationsregulatoryresidentialrulesscalesinglesystemsuseszoning
s", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
History The origins of zoning districts can be traced back to antiquity. The ancient walled city was the predecessor for classifying and regulating land, based on use. Outside the city walls were the undesirable functions, which were usually based on noise and smell. The space between the walls is where unsanitary and dangerous activities occurred such as butchering, waste disposal, and brick-firing. Within the walls were civic and religious places, and where the majority of people lived. Beyond distinguishing between urban and non-urban land, most ancient cities further classified land types and uses inside their walls. This was practiced in many regions of the world – for example, in China during the Zhou Dynasty (1046 – 256 BC), in India during the Vedic Era (1500 – 500 BC), and in the military camps that spread throughout the Roman Empire (31 BC – 476 AD). Throughout the Age of Enlightenment and Industrial Revolution, cultural and socio-economic shifts led to the rapid increase in the enforcement and invention of urban regulations. The shifts were informed by a new scientific rationality, the advent of mass production and complex manufacturing, and the subsequent onset of urbanisation. Industry leaving the home reshaped modern cities. The definition of home was tied to the definition of economy, which caused a much greater mixing of uses within the residential quarters of cities. Separation between uses is a feature of many planned cities designed before the advent of zoning. A notable example is Adelaide in South Australia, whose city centre, along with the suburb of North Adelaide, is surrounded on all sides by a park, the Adelaide Park Lands. The park was designed by Colonel William Light in 1836 in order to physically separate the city centre from its suburbs. Low density residential areas surround the park, providing a pleasant walk between work in the city within and the family homes outside. Sir Ebenezer Howard, founder of the garden city movement, cited Adelaide as an example of how green open space could be used to prevent cities from expanding beyond their boundaries and coalescing. His design for an ideal city, published in his 1902 book Garden Cities of To-morrow, envisaged separate concentric rings of public buildings, parks, retail space, residential areas and industrial areas, all surrounded by open space and farmland. All retail activity was to be conducted within a single glass-roofed building, an early concept for the modern shopping centre inspired by the Crystal Palace. However, these planned or ideal cities were static designs embodied in a single masterplan. What was lacking was a regulatory mechanism to allow the city to develop over time, setting guidelines to developers and private citizens over what could be built where.
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Logistics
Q177777 EXACT TITLE 1.000
QID OVERLAP: Q177777 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (26): "chain", "costs", "customers", "dedicated", "equipment", "facility", "field", "food", "goods", "information", "logistics", "management", "material", "materials", "model", "moving", "operational", "physical", "planning", "production".... | EXACT TITLE in wedding_events: "Logistics". | EXACT TITLE in manufacturing_food_processing: "Logistics".
chaincostscustomersdedicatedequipmentfacilityfieldfoodgoodsinformationlogisticsmanagementmaterialmaterialsmodelmovingoperationalphysicalplanningproductionproductsprofessionalpublicrelatedsupplytransportation
Logistics is the part of supply chain management that deals with the efficient forward and reverse flow of goods, services, and related information from the point of origin to the point of consumption according to the needs of customers, and a logistician is a professional working in the field of logistics management. Logistics management is a component that holds the supply chain together. The resources managed in logistics include physical goods such as materials, equipment, and foodstuffs, and also intangible items such as time and information. Military logistics is concerned with maintaining army supply lines with food, armaments, ammunition, and spare parts, apart from the transportation of troops themselves. Civil logistics deals with acquiring, moving, and storing raw materials, semi-finished goods, and finished goods. For organisations that provide garbage collection, mail deliveries, public utilities, and after-sales services, logistical problems must be addressed. Logistics deals with the movement of materials or products from one facility to another; it does not include material flow within production or assembly plants, such as production planning or single-machine scheduling. Logistics accounts for a significant amount of the operational costs of an organisation or country. Dedicated simulation software can model, analyse, visualise, and optimize logistic complexities.
The Oxford English Dictionary defines logistics as "the branch of military science relating to procuring, maintaining and transporting material, personnel and facilities". However, the New Oxford American Dictionary defines logistics as "the detailed coordination of a complex operation involving many people, facilities, or supplies", and the Oxford Dictionary on-line defines it as "the detailed organization and implementation of a complex operation". As such, logistics is commonly seen as a branch of engineering that creates "people systems" rather than "machine systems". According to the Council of Supply Chain Management Professionals (previously the Council of Logistics Management), logistics is the process of planning, implementing and controlling procedures for the efficient and effective transportation and storage of goods including services and related information from the point of origin to the point of consumption for the purpose of conforming to customer requirements and includes inbound, outbound, internal and external movements. Academics and practitioners traditionally refer to the terms operations or production management when referring to physical transformations taking place in a single business location (factory, restaurant or even bank clerking) and reserve the term logistics for activities related to distribution, that is, moving products on the territory. Managing a distribution center is seen, therefore, as pertaining to the realm of logistics since, while in theory, the products made by a factory are ready for consumption they still need to be moved along the distribution network according to some logic, and the distribution center aggregates and processes orders coming from different areas of the territory. That being said, from a modeling perspective, there are similarities between operations management and logistics, and companies sometimes use hybrid professionals, with for example a "Director of Operations" or a "Logistics Officer" working on similar problems.
Procurement logistics, which consists of market research, requirements planning, make-or-buy decisions, supplier management, ordering, and order control. The targets in procurement logistics might be contradictory: maximizing efficiency by concentrating on core competencies, outsourcing while maintaining the company's autonomy, or minimizing procurement costs while maximizing security within the supply process. Advance logistics involves the activities required to set up or establish a supply base in advance of other resources arriving. The term is used, for example, in military logistics for the assembly of resources ahead of troop arrival or the delivery of infrastructure components. Global logistics is technically the process of managing the "flow" of goods through a supply chain from its place of production to other parts of the world. This often requires an intermodal transport system via ocean, air, rail, and truck. The effectiveness of global logistics is measured in the Logistics Performance Index. Distribution logistics has, as its main task, the delivery of the finished products to the customer. It consists of order processing, warehousing, and transportation. Modern distribution often includes the use of a vehicle tracking system to monitor shipments by collecting real-time vehicle location data. Distribution logistics is necessary because production time, place, and quantity differ with the time, place, and quantity of consumption. Disposal logistics has the function of reducing logistics cost(s) and enhancing service(s) related to the disposal of waste produced during a business's operation. Reverse logistics denotes all operations related to the reuse of products and materials. The reverse logistics process includes the management and the sale of surpluses, as well as products being returned to vendors from buyers. It is "the process of planning, implementing, and controlling the efficient, cost-effective flow of raw materials, in-process inventory, finished goods, and related information from the point of consumption to the point of origin to recapture value or proper disposal". More precisely, reverse logistics is the process of moving goods from their typical final destination for the purpose of capturing value, or proper disposal. The opposite of reverse logistics is forward logistics. Green logistics describes all attempts to measure and minimize the ecological impact of logistics activities, including all activities of the forward and reverse flows. This can be supported by fleet digitalization initiatives aimed at optimizing routes and reducing fuel consumption. RAM logistics (see also Logistic engineering) combines both business logistics and military logistics since it concerns highly complicated technological systems for which reliability, availability and maintainability are essential, e.g., weapon system and military supercomputers. Asset control logistics: companies in the retail channels, both organized retailers and suppliers, often deploy assets required for the display, preservation, and promotion of their products. This can involve using a tracking system to monitor the location and status of these assets. Humanitarian logistics or emergency logistics: these terms are used by the logistics, supply chain, and manufacturing industries to denote specific time-critical modes of transport used to move goods rapidly in the event of an emergency. The reason for enlisting emergency logistics services could be a production delay or anticipated production delay, or an urgent need for specialized equipment to prevent events such as aircraft being grounded (also known as "aircraft on ground"—AOG), ships being delayed, or telecommunications failure. Humanitarian logistics involves governments, the military, aid agencies, donors, non-governmental organizations, and emergency logistics services are typically sourced from a specialist provider. In addition, the term production logistics describes logistic processes within a value-adding system (e.g., a factory or a mine). Production logistics aims to ensure that each machine and workstation receives the right product in the correct quantity and quality at the right time. The concern is with production, testing, transportation, storage, and supply. Production logistics can operate in existing as well as new plants. Since manufacturing in an existing plant is a constantly changing process, machines are exchanged and new ones added, which allows for improving the production logistics system accordingly. Production logistics provides the means to achieve customer response and capital efficiency. Track and trace solutions, which provide visibility of products through the production line, are an important part of modern production logistics, especially in the automotive and medical industries. The term construction logistics has also been employed by civilizations for thousands of years. Now, construction logistics is an important part of the sector. In recent years, it has emerged as a distinct field of study within supply chain management and logistics.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "college", "compete", "division", "education", "engineering", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "universities", "university", "west". | EXACT TITLE in wedding_events: "Boise State University". | EXACT TITLE in manufacturing_food_processing: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationengineeringhealthidahoindependentprogramprogramspublicreportedresearchuniversitiesuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in wedding_events (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (23): "ada", "air", "airport", "base", "boise", "center", "commercial", "department", "facility", "falls", "field", "fire", "functions", "general", "idaho", "national", "operated", "operates", "protection", "requiring".... | EXACT TITLE in manufacturing_food_processing: "Boise Airport".
adaairairportbaseboisecentercommercialdepartmentfacilityfallsfieldfirefunctionsgeneralidahonationaloperatedoperatesprotectionrequiringsupportuseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (28): "academic", "ada", "boise", "campus", "canyon", "career", "college", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "north", "primary", "programs", "public", "reported".... | EXACT TITLE in wedding_events: "College of Western Idaho". | EXACT TITLE in manufacturing_food_processing: "College of Western Idaho".
academicadaboisecampuscanyoncareercollegecountiescwidevelopmenteducationgovernedidaholargenampanorthprimaryprogramspublicreportedservedsouthweststudentsthroughouttreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
B
Q5001891 EXACT TITLE 1.000
QID OVERLAP: Q5001891 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (19): "activity", "address", "authorization", "business", "departments", "determines", "government", "issued", "jurisdiction", "license", "licenses", "local", "multiple", "operate", "operating", "permits", "physical", "requires", "single". | EXACT TITLE in wedding_events: "Business license". | EXACT TITLE in manufacturing_food_processing: "Business license".
activityaddressauthorizationbusinessdepartmentsdeterminesgovernmentissuedjurisdictionlicenselicenseslocalmultipleoperateoperatingpermitsphysicalrequiressingle
tween countries, states, and local municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
al municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
Business licenses are permits issued by government agencies that allow individuals or companies to conduct business within the government's geographical jurisdiction. It is the authorization to start a business issued by the local government. A single jurisdiction often requires multiple licenses that are issued by multiple government departments and agencies. Business licenses vary between countries, states, and local municipalities. There are often many licenses, registrations and certifications required to conduct a business in a single location. Typically, a company's business activity and physical location (address) determines which licenses are required to operate lawfully. Other determining factors may include the number of employees and the business, such as sole proprietor or corporation.
Boise River
Q891080 EXACT TITLE 0.880
QID OVERLAP: Q891080 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (9): "agricultural", "approximately", "boise", "idaho", "river", "snake", "southwestern", "square", "western". | EXACT TITLE in wedding_events: "Boise River". | EXACT TITLE in manufacturing_food_processing: "Boise River".
agriculturalapproximatelyboiseidahoriversnakesouthwesternsquarewestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Snake River Plain
Q1396049 EXACT TITLE 0.860
QID OVERLAP: Q1396049 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (8): "agricultural", "east", "idaho", "land", "largest", "major", "river", "snake". | EXACT TITLE in manufacturing_food_processing: "Snake River Plain".
agriculturaleastidaholandlargestmajorriversnake
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Idaho Department of Labor
Q97164075 EXACT TITLE 0.840
QID OVERLAP: Q97164075 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (7): "department", "development", "economic", "idaho", "labor", "technology", "workforce". | EXACT TITLE in wedding_events: "Idaho Department of Labor". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Labor".
Vertical integration
Q1571520 QID OVERLAP 0.800
QID OVERLAP: Q1571520 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (27): "become", "chain", "combine", "consolidation", "consumers", "different", "directly", "economy", "integrated", "large", "management", "market", "need", "owned", "ownership", "owns", "produce", "produced", "produces", "products"....
becomechaincombineconsolidationconsumersdifferentdirectlyeconomyintegratedlargemanagementmarketneedownedownershipownsproduceproducedproducesproductsratherrelatedriversupplierssuppliessupplyvertical
ather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
Vertical expansion Vertical integration is often closely associated with vertical expansion which, in economics, is the growth of a business enterprise through the acquisition of companies that produce the intermediate goods needed by the business or help market and distribute its product. A firm may desire such expansion to secure the supplies needed by the firm to produce its product and the market needed to sell the product. Such expansion can become undesirable from a system-wide perspective when it becomes anti-competitive and impede free competition in an open marketplace. The result is a more efficient business with lower costs and more profits. On the undesirable side, when vertical expansion leads toward monopolistic control of a product or service then regulative action may be required to rectify anti-competitive behavior. Related to vertical expansion is lateral expansion, which is the growth of a business enterprise through the acquisition of similar firms, in the hope of achieving economies of scale. Vertical expansion is also known as a vertical acquisition. Vertical expansion or acquisitions can also be used to increase sales and to gain market power. The acquisition of DirecTV by News Corporation is an example of forwarding vertical expansion or acquisition. DirecTV is a satellite TV company through which News Corporation can distribute more of its media content: news, movies, and television shows. The acquisition of NBC by Comcast is an example of backward vertical integration. For example, in the United States, protecting the public from communications monopolies that can be built in this way is one of the missions of the Federal Communications Commission. Scholars' findings suggest that a reduction in inefficiencies caused by the market vertical value chains, including downstream prices or double mark-up, can be negated with vertical integration. Application in more complex environments can help firms overcome market failures (markets with high transaction costs or assets specificities). Scholars also identified potential risks and boundaries which may occur under vertical integration. This includes the potential competitor, the enhancements to horizontal collusion, and development of barriers to entry. However, it is still debated over if vertical integration expected efficiencies can lead to competitive harm to the market.
There are many problems and benefits that vertical integration brings to an economic system. Problems that can stem from vertical integration can include large capital investments needed to set up and buy factories and maintain efficient profits. Rapid technology development can increase integration difficulties and further increase costs. The requirement of different business skills venturing into new portions of the supply chain can be challenging for the firm. Another problem that may stem from vertical integration is the collapse of goals among the various firms in a supply chain. With each firm operating under different systems, integration may cause initial problems in management and production. Vertical integration also proves to be dangerous when monopolistic problems arise in a capitalistic economy. When this happens, competition is removed and a corporation has the power to control all firms in its supply chain. Large companies are more likely than smaller companies to employ vertical integration, as they have more resources to manage each stage of production (e.g. major expansion and funding). Vertical integration allows control of production from beginning to end. Vertical integration requires a company to focus not only on its core business, but also on several difficult areas such as sourcing materials and manufacturing partners, distribution, and finally selling the product. One benefit is that the implementation of vertical integration can yield increased profit margins or eliminate the leverage that other firms or buyers may have over the firm. It allows improved coordination between production and distribution firms and decreases the cost of exchange of goods between firms within a supply chain. Operational routines also become more consistent and certain as the management of these firms gradually merge. Vertically integrated firms rarely need to worry about the sufficiency in their supply of materials because they generally control the facilities that provide them. A vertically integrated company also creates high barriers of entry into their respective economy, eliminating most potential competition. Implementing vertical integration can be beneficial in that it reduces the distance that separates the suppliers and customers from the resources or information, which can then boost profits and efficiency. There are internal and external society-wide gains and losses stemming from vertical integration, which vary according to the state of technology in the industries involved, roughly corresponding to the stages of the industry lifecycle. Static technology represents the simplest case, where the gains and losses have been studied extensively.
I
Q30253346 EXACT TITLE 0.800
QID OVERLAP: Q30253346 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Health and Welfare".
departmenthealthidahopublicwelfare
Idaho Department of Health and Welfare is a public health agency in the state of Idaho. History The department was founded in 1972. Functions The department provides healthcare services, records management, children and family services, food assistance programs, and healthcare services.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (16): "ada", "boise", "capital", "district", "east", "estimated", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "pacific", "private", "second", "southwestern".
adaboisecapitaldistricteastestimatedhomeidahojurisdictionlargestlocalmetropolitanpacificprivatesecondsouthwestern
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (40): "acquisition", "activity", "assets", "business", "capital", "central", "combine", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "effects", "federal", "governed", "government", "law", "legal"....
acquisitionactivityassetsbusinesscapitalcentralcombineconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteffectsfederalgovernedgovernmentlawlegalmanagementmarketoccursoperatingoperationsorganizationownershipprohibitsregulatoryrequire+10
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (15): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "name", "nampa", "principal", "second", "university", "west", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannamenampaprincipalseconduniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Union Pacific Railroad
Q725793 QID OVERLAP 0.800
QID OVERLAP: Q725793 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (19): "acquire", "center", "create", "network", "north", "operates", "operating", "pacific", "principal", "rail", "reach", "regulators", "reporting", "routes", "system", "transportation", "union", "west", "western".
acquirecentercreatenetworknorthoperatesoperatingpacificprincipalrailreachregulatorsreportingroutessystemtransportationunionwestwestern
ic Railroad Company is the principal operating company of Union Pacific Corporation, which are both headquartered at the Union Pacific Center, in Omaha, Nebraska. Union Pacific has announced plans to acquire the Norfolk Southern Railway in a deal worth $85 billion.
Union Pacific in the 20th century In the early 20th century, Union Pacific's focus shifted from expansion to internal improvement. Recognizing that farmers in the Central and Salinas Valleys of California grew produce far in excess of local markets, Union Pacific worked with its rival Southern Pacific to develop a spoilage-resistant rail-based transport system. These efforts culminated in the 1906 founding of Pacific Fruit Express, soon to be the world's largest lessee of refrigerated railcars. Meanwhile, Union Pacific worked to construct a faster, and more direct substitute for the original climb to Promontory Summit. In 1904, the Lucin cutoff opened, reducing curvature and grades. The original route would eventually be stripped of track in 1942 to provide war scrap. To attract customers during the Great Depression, Union Pacific's chairman W. Averell Harriman simultaneously sought to "spruce up" the quality of its rolling stock and to make its unique locations more desirable travel destinations. The first effort resulted in the purchase of the first streamlined train: the M-10000. The latter resulted in the Sun Valley ski resort in central Idaho; it opened in 1936 and finally was sold in 1964. Despite the fact that the M-10000 and its successors were among the first diesel locomotives, Union Pacific completed dieselization relatively late. In 1944, UP finally received delivery of its last steam locomotive: Union Pacific 844. As the 20th century waned, Union Pacific recognized—like most railroads—that remaining a regional railroad would only lead to bankruptcy. On December 31, 1925, UP and its subsidiaries operated 9,834 miles (15,826 km) routes and 15,265 miles (24,567 km) tracks; in 1980, these numbers had remained roughly constant (9,266 route-miles and 15,647 track-miles). But in 1982, UP acquired the Missouri Pacific and Western Pacific railroads, and 1988, the Missouri–Kansas–Texas. By 1993, Union Pacific had doubled its system to 17,385 miles (27,978 km) routes. By then, few large (class I) railroads remained. The same year that Union Pacific merged with the Chicago and North Western (1995), Burlington Northern and ATSF announced merger plans. The impending BNSF amalgamation would leave one mega-railroad in control of the west. To compete, UP merged with Southern Pacific, thereby incorporating D&RGW and Cotton Belt, and forming a duopoly in the West. The merged railroad took the Union Pacific name.
Commemorative color schemes From the second half of 2005 to the summer of 2006, UP unveiled a new set of six EMD SD70ACe locomotives in "Heritage Colors", painted in schemes reminiscent of railroads acquired by the Union Pacific Corporation since the 1980s. The engine numbers match the year that the predecessor railroad became part of the Union Pacific system. The locomotives commemorate the Missouri Pacific with UP 1982, the Western Pacific with UP 1983, the Missouri–Kansas–Texas with UP 1988, the Chicago and North Western with UP 1995, the Southern Pacific with UP 1996, and the Denver and Rio Grande Western with UP 1989. In October 2005, UP unveiled SD70ACe 4141, commissioned in honor of George Bush. The locomotive has "George Bush 41" on the sides and its paint scheme resembles that of Air Force One. It was sent into storage in 2007, but returned in 2018 to power Bush's funeral train. It was donated to the George H. W. Bush Presidential Library and Museum on November 8, 2019. On March 31, 2010, UP dedicated a specially painted GE ES44AC locomotive commemorating the centennial of the Boy Scouts of America. On September 28, 2010, UP dedicated a specially painted GE ES44AC locomotive, as a tribute to Susan G.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (44): "applied", "apply", "architects", "authority", "building", "buildings", "charges", "code", "codes", "compliance", "control", "departments", "design", "district", "effects", "electrical", "estate", "facility", "general", "generally"....
appliedapplyarchitectsauthoritybuildingbuildingschargescodecodescompliancecontroldepartmentsdesigndistricteffectselectricalestatefacilitygeneralgenerallyhealthjurisdictionlawlocalmaterialsmodelnationaloccupancyplanningprivate+14
gn of new buildings. The building code becomes law of a particular jurisdiction when formally enacted by the appropriate governmental or private authority. Building codes are generally intended to be applied by architects, engineers, interior designers, constructors and regulators but are also used for various purposes by safety inspectors, environmental scientists, real estate developers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
gdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments. Building Control regularisation charges apply in case work is undertaken which should have had been inspected at the time of the work if this was not done. Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Standards for structure, placement, size, usage, wall assemblies, fenestration size/locations, egress rules, size/location of rooms, foundations, floor assemblies, roof structures/assemblies, energy efficiency, stairs and halls, mechanical, electrical, plumbing, site drainage & storage, appliance, lighting, fixtures standards, occupancy rules, and swimming pool regulations Rules regarding parking and traffic impact Fire code rules to minimize the risk of a fire and to ensure safe evacuation in the event of such an emergency Requirements for earthquake (seismic code), hurricane, flood, and tsunami resistance, especially in disaster prone areas or for very large buildings where a failure would be catastrophic Requirements for specific building uses (for example, storage of flammable substances, or housing a large number of people) Energy provisions and consumption Grandfather clauses: Unless the building is being renovated, the building code usually does not apply to existing buildings. Specifications on components Allowable installation methodologies Minimum and maximum room ceiling heights, exit sizes and location Qualification of individuals or corporations doing the work For high structures, anti-collision markers for the benefit of aircraft Building codes are generally separate from zoning ordinances, but exterior restrictions (such as setbacks) may fall into either category. Designers use building code standards out of substantial reference books during design. Building departments review plans submitted to them before construction, issue permits [or not] and inspectors verify compliance to these standards at the site during construction.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (24): "active", "business", "capital", "category", "control", "development", "expansion", "finance", "financial", "firms", "general", "investment", "limited", "management", "operational", "otherwise", "ownership", "private", "products", "public"....
activebusinesscapitalcategorycontroldevelopmentexpansionfinancefinancialfirmsgeneralinvestmentlimitedmanagementoperationalotherwiseownershipprivateproductspublicratherrolespecializedstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Cold chain
Q592197 QID OVERLAP 0.800
QID OVERLAP: Q592197 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (27): "activities", "agricultural", "associated", "chain", "cold", "distributed", "distribution", "equipment", "food", "fresh", "goods", "logistics", "maintain", "management", "preserve", "produce", "production", "products", "quality", "refrigerated"....
activitiesagriculturalassociatedchaincolddistributeddistributionequipmentfoodfreshgoodslogisticsmaintainmanagementpreserveproduceproductionproductsqualityrefrigeratedrequiressafetysensitivestoragesupplyuseswaste
ceutical products or perishable goods from production to consumption. A well functioning, or unbroken, cold chain requires uninterrupted sequence of refrigerated production, storage and distribution activities, along with associated equipment and fleet management logistics, which maintain a desired low-temperature interval to keep the safety and quality of perishable or sensitive products. Unlike other goods or merchandise, cold chain goods are perishable and always en-route towards end use or destination.
ation to maintain perishable goods, such as pharmaceuticals, produce or other goods that are temperature-sensitive. Common goods, sometimes called cool cargo, distributed in cold chains include fresh agricultural produce, seafood, frozen food, photographic film, chemicals, and pharmaceutical products. The objective of a cold chain is to preserve the integrity and quality of goods such as pharmaceutical products or perishable goods from production to consumption. A well functioning, or unbroken, cold chain requires uninterrupted sequence of refrigerated production, storage and distribution activities, along with associated equipment and fleet management logistics, which maintain a desired low-temperature interval to keep the safety and quality of perishable or sensitive products. Unlike other goods or merchandise, cold chain goods are perishable and always en-route towards end use or destination.
History Mobile refrigeration with ice from the ice trade began with reefer ships and refrigerator cars (iceboxes on wheels) in the mid-19th century. The term cold chain was first used in 1908. The first effective cold store in the UK opened in 1882 at St Katharine Docks. It could hold 59,000 carcasses, and by 1911 cold storage capacity in London had reached 2.84 million carcasses. By 1930 about a thousand refrigerated meat containers were in use which could be switched from road to railway. Mobile mechanical refrigeration was invented by Frederick McKinley Jones, who co-founded Thermo King with entrepreneur Joseph A. "Joe" Numero. In 1938 Numero sold his Cinema Supplies Inc. movie sound equipment business to RCA to form the new entity, U.S. Thermo Control Company (later the Thermo King Corporation), in partnership with Jones, his engineer. Jones designed a portable air-cooling unit for trucks carrying perishable food, for which they obtained a patent on 12 July 1940, subsequent to a challenge to invent a refrigerated truck over a 1937 golf game by associates of Numero's, Werner Transportation Co. president Harry Werner, and United States Air Conditioning Co. president Al Fineberg, This technology has been frequently in use since the 1950s, when it was most often used for preserving animal-based cells or tissue. As medical breakthroughs, such as in cancer treatment, have taken place, the demand for cold chain systems has grown. The COVID-19 pandemic and its associated vaccinations, have caused vastly increased need. Uses Cold chains are common in the food and pharmaceutical industries and also in some chemical shipments.
F
Q272002 QID OVERLAP 0.760
QID OVERLAP: Q272002 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (13): "applicable", "approximately", "contamination", "directly", "economic", "effects", "estimated", "even", "exposure", "food", "period", "requiring", "resulting".
applicableapproximatelycontaminationdirectlyeconomiceffectsestimatedevenexposurefoodperiodrequiringresulting
and diarrhea. Bouts of vomiting can be repeated with an extended delay in between. This is because even if infected food was eliminated from the stomach in the first bout, microbes, like bacteria (if applicable), can pass through the stomach into the intestine and begin to multiply. Some types of microbes stay in the intestine. For contaminants requiring an incubation period, symptoms may not manifest for hours to days, depending on the cause and on the quantity of consumption.
Cultural adaptation and food safety Traditional preservation methods like fermentation, sun-drying, and smoking have been used for centuries. These methods not only preserve food but also enhance nutritional value and can reduce foodborne illnesses by creating environments that inhibit harmful bacteria. The notion that modern food safety standards are universally applicable is challenged by the effectiveness of these traditional methods. In cultures without access to modern refrigeration, traditional preservation techniques adapted to local climates and resources have proven effective in preventing spoilage and illness.
sociate the symptoms with the item consumed, so they may misattribute the symptoms to gastroenteritis, for example. In low- and middle-income countries in 2010, foodborne disease were responsible for approximately 600 million illnesses and 420,000 deaths, along with an economic loss estimated at US$110 billion annually. Causes Foodborne disease can be caused by a number of bacteria, such as Campylobacter jejuni, and chemicals, such as pesticides, medicines, and natural toxic substances, such as vomitoxin, poisonous mushrooms, or reef fish. Foodborne illness usually arises from improper handling, preparation, or food storage. However, many cases result from the immune system's response to unfamiliar microbes rather than from direct microbial damage, explaining why local populations often tolerate food that sickens travelers. Good hygiene practices before, during, and after food preparation can reduce the chances of contracting an illness. There is a consensus in the public health community that regular hand-washing is one of the most effective defenses against the spread of foodborne illness.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.740
QID OVERLAP: Q843258 in wedding_events (tier:evergreen) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (12): "boise", "falls", "home", "idaho", "interstate", "line", "major", "metropolitan", "near", "river", "routes", "snake".
boisefallshomeidahointerstatelinemajormetropolitannearriverroutessnake
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah. The highway has an auxiliary route, I-184, which serves downtown Boise. Route description I-84 is the longest Interstate highway in Idaho, running for 276 miles (444 km) and connecting several of the state's largest metropolitan areas. It has a single auxiliary route, I-184 in Boise, and several business routes. The highway was officially designated as the Vietnam Veterans Memorial Highway in 2014, mirroring the name for Oregon's section of I-84. The Idaho section of I-84 is maintained by the Idaho Transportation Department (ITD), which conducts an annual survey of traffic on certain highway segments that is expressed in terms of annual average daily traffic (AADT), a measure of traffic volume for any average day of the year.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "metropolitan", "west".
approximatelyboisecaldwellcanyoncollegeeastidahometropolitanwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in wedding_events (tier:branch) and manufacturing_food_processing (tier:evergreen). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "largest", "metropolitan", "nampa".
boisecaldwellcanyonestimatedidaholargestmetropolitannampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Kuna, Idaho
Q1515177 QID OVERLAP 0.640
QID OVERLAP: Q1515177 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent".
adaadditionalboiseidahokunametropolitanpercent
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (7): "ada", "among", "boise", "capital", "idaho", "meridian", "second".
adaamongboisecapitalidahomeridiansecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.580
QID OVERLAP: Q1516870 in wedding_events (tier:branch) and manufacturing_food_processing (tier:branch). | SHARED TOKENS (4): "ada", "boise", "eagle", "idaho".
adaboiseeagleidaho
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
272 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP272 edges
🌲 EVERGREEN1 edges
0.630
accommodateboisecentercompleteddistricteventexpansionfeetgreateridaholargestoperatingspacesquare
SHARED TOKENS (14): "accommodate", "boise", "center", "completed", "district", "event", "expansion", "feet", "greater", "idaho", "largest", "operating", "space", "square". | URL->A (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
🌿 BRANCH210 edges
0.500
assetsauthoritiesauthoritybusinessescommonlydepartmentsdirectlyequipmentexperiencefunctiongenerallygovernedgovernmenthazardshousingjurisdictionlegallicenseslocalnorth
SHARED TOKENS (35): "assets", "authorities", "authority", "businesses", "commonly", "departments", "directly", "equipment", "experience", "function", "generally", "governed", "government", "hazards", "housing", "jurisdiction", "legal", "licenses", "local", "north".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Resort ↗ Q875157 EXACT TITLE
activitiescentralcommercialcontainingestablishmentfoodfrequentlymeansnorthoperatedownedownershippeoplepremisessingletype
SHARED TOKENS (16): "activities", "central", "commercial", "containing", "establishment", "food", "frequently", "means", "north", "operated", "owned", "ownership", "people", "premises", "single", "type". | EXACT TITLE in wedding_events: "Resort".
0.500
applicationbrandbuildingbusinesscareercommunicationcorporatedesigndevelopmentdifferenteventformalfrequentlyidentifyingindustryknowledgelogisticsmanagementmarketmarketing
SHARED TOKENS (34): "application", "brand", "building", "business", "career", "communication", "corporate", "design", "development", "different", "event", "formal", "frequently", "identifying", "industry", "knowledge", "logistics", "management", "market", "marketing".... | EXACT TITLE in wedding_events: "Event management".
0.500
adaboisecanyoncommonlycountieshomeidaholargerlargestmeridianmetropolitannampapacificpayettepercentsouthwesterntreasurevalleywider
SHARED TOKENS (19): "ada", "boise", "canyon", "commonly", "counties", "home", "idaho", "larger", "largest", "meridian", "metropolitan", "nampa", "pacific", "payette", "percent", "southwestern", "treasure", "valley", "wider". | EXACT TITLE in wedding_events: "Boise metropolitan area".
0.500
activitiesactivityadministrativeassociatedcharacteristicsconsumerscontainscontrolcorecustomercustomersdefinesdesigndevelopmentdifferentengineeringhistoricallyinspectionmanagementmaterials
SHARED TOKENS (37): "activities", "activity", "administrative", "associated", "characteristics", "consumers", "contains", "control", "core", "customer", "customers", "defines", "design", "development", "different", "engineering", "historically", "inspection", "management", "materials".... | EXACT TITLE in manufacturing_food_processing: "Quality assurance".
0.500
Commissary ↗ Q5152616 EXACT TITLE
administrativeassociatedbuildingextensionfinancialgovernmentjurisdictionnationalofficeofficialorganizationstandardstationsuppliestitleuses
SHARED TOKENS (16): "administrative", "associated", "building", "extension", "financial", "government", "jurisdiction", "national", "office", "official", "organization", "standard", "station", "supplies", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
activeagricultureapplicationclimatecommonlyconditionsdifferenceseconomicfieldirrigationmanagementneedpracticepracticesqualitysitesourcewater
SHARED TOKENS (18): "active", "agriculture", "application", "climate", "commonly", "conditions", "differences", "economic", "field", "irrigation", "management", "need", "practice", "practices", "quality", "site", "source", "water". | EXACT TITLE in manufacturing_food_processing: "Nutrient management".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbusinessescustomersdesignedearlyeventfloorformalgenerallyhelphistoryhostinsidelargelargestpeopleprimaryprivate
SHARED TOKENS (27): "annual", "building", "buildings", "businesses", "customers", "designed", "early", "event", "floor", "formal", "generally", "help", "history", "host", "inside", "large", "largest", "people", "primary", "private".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
Private label ↗ EXACT TITLE
amongbrandbrandschaincompetecontractdeterminesdirectlydistinctgoodsgreatmakesmultiplenamenationalownedprivatepubliclyretailerrole
SHARED TOKENS (22): "among", "brand", "brands", "chain", "compete", "contract", "determines", "directly", "distinct", "goods", "great", "makes", "multiple", "name", "national", "owned", "private", "publicly", "retailer", "role".... | EXACT TITLE in manufacturing_food_processing: "Private label".
0.500
Frozen food ↗ Q751728 EXACT TITLE
buildingsearlyfoodgroupindustrykitchensmaintainspreservepreservesproducequalityreportedsmallerstandardsstructuresupportingtechnologytemperaturewaste
SHARED TOKENS (19): "buildings", "early", "food", "group", "industry", "kitchens", "maintains", "preserve", "preserves", "produce", "quality", "reported", "smaller", "standards", "structure", "supporting", "technology", "temperature", "waste". | EXACT TITLE in manufacturing_food_processing: "Frozen food".
0.500
businessescategorycreatedevelopedeconomicgoodsgreaterhumaninformationlandlawlegallimitedownershippeopleperiodprimarypropertysystemsthem
SHARED TOKENS (23): "businesses", "category", "create", "developed", "economic", "goods", "greater", "human", "information", "land", "law", "legal", "limited", "ownership", "people", "period", "primary", "property", "systems", "them".... | EXACT TITLE in wedding_events: "Intellectual property".
0.500
beyondcomplianceevidenceformformsgroupidentificationidentifiedinfluenceinformationmarketingneedoutsidepeoplepressureprivatepublicpubliclyresultssales
SHARED TOKENS (22): "beyond", "compliance", "evidence", "form", "forms", "group", "identification", "identified", "influence", "information", "marketing", "need", "outside", "people", "pressure", "private", "public", "publicly", "results", "sales".... | EXACT TITLE in wedding_events: "Social influence".
0.500
Marketing ↗ Q39809 EXACT TITLE
agriculturalbusinessbusinesseschannelscharacteristicsconsumerscustomersdedicateddirectlyfirmsfoodgovernmentindustrymanagementmarketmarketingmediaplanningprimaryprocess
SHARED TOKENS (31): "agricultural", "business", "businesses", "channels", "characteristics", "consumers", "customers", "dedicated", "directly", "firms", "food", "government", "industry", "management", "market", "marketing", "media", "planning", "primary", "process".... | EXACT TITLE in wedding_events: "Marketing". | EXACT TITLE in manufacturing_food_processing: "Marketing".
0.500
academicagriculturalappliedappliesapplybroadercombinescontroldesigndevelopmentdistributionelectricalengineeringfieldfoodhandlingknowledgematerialsoperationsphysical
SHARED TOKENS (27): "academic", "agricultural", "applied", "applies", "apply", "broader", "combines", "control", "design", "development", "distribution", "electrical", "engineering", "field", "food", "handling", "knowledge", "materials", "operations", "physical".... | EXACT TITLE in manufacturing_food_processing: "Food engineering".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstconditionscontractestablishedeventfeefinancialformhealthlargemanagementmeansownershippolicypremiumprimaryprocessingprotectionrelationshiprisk
SHARED TOKENS (23): "against", "conditions", "contract", "established", "event", "fee", "financial", "form", "health", "large", "management", "means", "ownership", "policy", "premium", "primary", "processing", "protection", "relationship", "risk".... | EXACT TITLE in wedding_events: "Insurance".
0.500
Food truck ↗ EXACT TITLE
amongbecomebeveragesboothscareercommercialcustomersdevelopedeconomicestimatedfoodindustrykitchenkitchenslargemajormobileoperationpeopleregional
SHARED TOKENS (27): "among", "become", "beverages", "booths", "career", "commercial", "customers", "developed", "economic", "estimated", "food", "industry", "kitchen", "kitchens", "large", "major", "mobile", "operation", "people", "regional".... | EXACT TITLE in manufacturing_food_processing: "Food truck".
0.500
Rodeo ↗ Q207703 EXACT TITLE
animalcategoriesdesignedequipmenteventfederalgenerallygovernedindustrylivestocklocalnationalnorthofficialorganizationpracticesprofessionalpublicregionregulations
SHARED TOKENS (25): "animal", "categories", "designed", "equipment", "event", "federal", "generally", "governed", "industry", "livestock", "local", "national", "north", "official", "organization", "practices", "professional", "public", "region", "regulations".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
alreadybusinessescareercareerscollegecurrentdetermineemployersemploymenteventexperiencefieldfuturegovernmentindustryinvestmentlargelimitednetworkorganization
SHARED TOKENS (36): "already", "businesses", "career", "careers", "college", "current", "determine", "employers", "employment", "event", "experience", "field", "future", "government", "industry", "investment", "large", "limited", "network", "organization".... | EXACT TITLE in wedding_events: "Internship".
0.500
addressaddressingcontaminationcontroldirectlyfederalformgoverninginvolvinglawmaintainmajornameownedphysicalprimaryprotectionprovisionspubliclyquality
SHARED TOKENS (26): "address", "addressing", "contamination", "control", "directly", "federal", "form", "governing", "involving", "law", "maintain", "major", "name", "owned", "physical", "primary", "protection", "provisions", "publicly", "quality".... | EXACT TITLE in manufacturing_food_processing: "Clean Water Act".
0.500
Albertsons ↗ EXACT TITLE
acquisitionboisecapitalchainconsumerscorporatecustomerdifferentearlyfederalgeneralidaholargestlistmanagementnamenorthregionalrequirementssold
SHARED TOKENS (23): "acquisition", "boise", "capital", "chain", "consumers", "corporate", "customer", "different", "early", "federal", "general", "idaho", "largest", "list", "management", "name", "north", "regional", "requirements", "sold".... | EXACT TITLE in manufacturing_food_processing: "Albertsons".
0.500
Convention ↗ Q225862 EXACT TITLE
agreementanimalcharacteristicsdifferentfieldformalgrouphumanindustrylargelawlegallinemediaofficepeoplepropertysharestandardstation
SHARED TOKENS (21): "agreement", "animal", "characteristics", "different", "field", "formal", "group", "human", "industry", "large", "law", "legal", "line", "media", "office", "people", "property", "share", "standard", "station".... | EXACT TITLE in wedding_events: "Convention". | EXACT TITLE in manufacturing_food_processing: "Convention".
0.500
activeagainstagricultureairapplicationsaveragebuildingchainchannelsclimatecoldconditionsconsumercontrolledcoolingdesigneddevelopeddevelopmentdistributionearly
SHARED TOKENS (64): "active", "against", "agriculture", "air", "applications", "average", "building", "chain", "channels", "climate", "cold", "conditions", "consumer", "controlled", "cooling", "designed", "developed", "development", "distribution", "early".... | EXACT TITLE in manufacturing_food_processing: "Refrigeration".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
assetsbusinesscentercontroleconomicevenfacilityfunctionslegallimitedmanagementoperationalorganizationotherwiseoutsidepracticepresenceprivateprocessprocessing
SHARED TOKENS (27): "assets", "business", "center", "control", "economic", "even", "facility", "functions", "legal", "limited", "management", "operational", "organization", "otherwise", "outside", "practice", "presence", "private", "process", "processing".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
administrationagricultureauthoritycommercialdepartmentfederalfoodgovernmenthealthinspectionjurisdictionmeatproductspublicregulatorysafesafetysubjectsupply
SHARED TOKENS (19): "administration", "agriculture", "authority", "commercial", "department", "federal", "food", "government", "health", "inspection", "jurisdiction", "meat", "products", "public", "regulatory", "safe", "safety", "subject", "supply". | EXACT TITLE in manufacturing_food_processing: "Food Safety and Inspection Service".
0.500
Cheese ↗ Q10943 EXACT TITLE
activityanimaldistributionfoodformslayermarketsprocessingproducedproductionpurchasingreceivingsellerstoragethroughouttypewater
SHARED TOKENS (17): "activity", "animal", "distribution", "food", "forms", "layer", "markets", "processing", "produced", "production", "purchasing", "receiving", "seller", "storage", "throughout", "type", "water". | EXACT TITLE in manufacturing_food_processing: "Cheese".
0.500
analysisapplicationcontrolcreatedatadistinguisheffectsengineeringestablisheventevidenceformgenerallygraphidentifyingindustryinputnameoperationsprocess
SHARED TOKENS (24): "analysis", "application", "control", "create", "data", "distinguish", "effects", "engineering", "establish", "event", "evidence", "form", "generally", "graph", "identifying", "industry", "input", "name", "operations", "process".... | EXACT TITLE in manufacturing_food_processing: "Root-cause analysis".
0.500
Signage ↗ Q1211272 EXACT TITLE
buildingsdesigndesigneddistinctdocumentedformgroupinformationinsidemeansnameoutsidesignssmallerstreet
SHARED TOKENS (15): "buildings", "design", "designed", "distinct", "documented", "form", "group", "information", "inside", "means", "name", "outside", "signs", "smaller", "street". | EXACT TITLE in wedding_events: "Signage".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesagricultureairapplicationclimateconditionscontroldifferencesdifferentdistributioneffectsevidencefuturegenerallygreatheatinghistoryhumanindustrylarge
SHARED TOKENS (34): "activities", "agriculture", "air", "application", "climate", "conditions", "control", "differences", "different", "distribution", "effects", "evidence", "future", "generally", "great", "heating", "history", "human", "industry", "large".... | EXACT TITLE in wedding_events: "Weather".
0.500
accessactiveadditionalcategoriescontaminationeconomicencompassingfoodoperationalpersonnelphysicalpreventionproductsprotectionqualityrisksafetysystem
SHARED TOKENS (18): "access", "active", "additional", "categories", "contamination", "economic", "encompassing", "food", "operational", "personnel", "physical", "prevention", "products", "protection", "quality", "risk", "safety", "system". | EXACT TITLE in manufacturing_food_processing: "Food defense".
0.500
Onion ↗ Q23485 EXACT TITLE
annualappliedbasebecomecentralcontainsestablishedfoodformfrequentlymultiplenameproducescaleseparateservedstoragetreateduntil
SHARED TOKENS (19): "annual", "applied", "base", "become", "central", "contains", "established", "food", "form", "frequently", "multiple", "name", "produce", "scale", "separate", "served", "storage", "treated", "until". | EXACT TITLE in manufacturing_food_processing: "Onion".
0.500
Concert ↗ Q182832 EXACT TITLE
equipmenteventfloorlargelargestlogisticsoutdoorparksprivateprofessionalrequireshowsinglesmallsupport
SHARED TOKENS (15): "equipment", "event", "floor", "large", "largest", "logistics", "outdoor", "parks", "private", "professional", "require", "show", "single", "small", "support". | EXACT TITLE in wedding_events: "Concert".
0.500
additionalappliesapprovalauthoritybeyondcategoryconsumerconventionalexistingfoodfunctionsgovernmenthealthmarketingnutritionpracticespreventionprocessprocessingrather
SHARED TOKENS (25): "additional", "applies", "approval", "authority", "beyond", "category", "consumer", "conventional", "existing", "food", "functions", "government", "health", "marketing", "nutrition", "practices", "prevention", "process", "processing", "rather".... | EXACT TITLE in manufacturing_food_processing: "Functional food".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbasebusinesscommunicationcreatedevelopeddirectelectricalexposureforminsidematerialmeansoperatespracticeprocessingproduceproducedproducesproduction
SHARED TOKENS (24): "application", "base", "business", "communication", "create", "developed", "direct", "electrical", "exposure", "form", "inside", "material", "means", "operates", "practice", "processing", "produce", "produced", "produces", "production".... | EXACT TITLE in wedding_events: "Photography".
0.500
Catering ↗ Q777754 EXACT TITLE
beveragesbusinesscleaningcommercialcookingestablishmentseventfoodgenerallygroupmanagementmodelparkspracticesprivaterestaurantrestaurantsrisksafetyserved
SHARED TOKENS (21): "beverages", "business", "cleaning", "commercial", "cooking", "establishments", "event", "food", "generally", "group", "management", "model", "parks", "practices", "private", "restaurant", "restaurants", "risk", "safety", "served".... | EXACT TITLE in wedding_events: "Catering".
0.500
Waste management ↗ EXACT TITLE
activitiesactivityadditionalairapproximatelycentersclimatecommercialcontrolleddevelopeddifferentdisposaleconomiceffectsexistingfoodhealthhumanincreasinginvolving
SHARED TOKENS (44): "activities", "activity", "additional", "air", "approximately", "centers", "climate", "commercial", "controlled", "developed", "different", "disposal", "economic", "effects", "existing", "food", "health", "human", "increasing", "involving".... | EXACT TITLE in wedding_events: "Waste management". | EXACT TITLE in manufacturing_food_processing: "Waste management".
0.500
Parking ↗ Q267917 EXACT TITLE
availabilitybuildingscentersdesignfacilitieslandlocalnorthparkingpercentrestrictionsrulesspacessupportthough
SHARED TOKENS (15): "availability", "buildings", "centers", "design", "facilities", "land", "local", "north", "parking", "percent", "restrictions", "rules", "spaces", "support", "though". | EXACT TITLE in wedding_events: "Parking". | EXACT TITLE in manufacturing_food_processing: "Parking".
0.500
addadministrationauthoritycontrolfederalfoodforminvestigationlawnationalprincipalprovisionsregulationsrequirementssafety
SHARED TOKENS (15): "add", "administration", "authority", "control", "federal", "food", "form", "investigation", "law", "national", "principal", "provisions", "regulations", "requirements", "safety". | EXACT TITLE in manufacturing_food_processing: "Federal Food, Drug, and Cosmetic Act".
0.500
Lactalis ↗ Q1799825 EXACT TITLE
approximatelybrandsbusinessfamilyfarmgrouplargestmarketsnameownedownspeopleproductssalesselleruntil
SHARED TOKENS (16): "approximately", "brands", "business", "family", "farm", "group", "largest", "markets", "name", "owned", "owns", "people", "products", "sales", "seller", "until". | EXACT TITLE in manufacturing_food_processing: "Lactalis".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesagainstbuildingsgovernmenthumaninsidelandlargelargestlawnationalparkspermitprotectionrestrictionsrulesspacespacessquarestructures
SHARED TOKENS (21): "activities", "against", "buildings", "government", "human", "inside", "land", "large", "largest", "law", "national", "parks", "permit", "protection", "restrictions", "rules", "space", "spaces", "square", "structures".... | EXACT TITLE in wedding_events: "Park". | EXACT TITLE in manufacturing_food_processing: "Park".
0.500
activitiesadvancedagriculturalagriculturebusinessescostsdirectdistributioneasteffectsfreshhumanincreasingindustryirrigationmanagementmunicipalnorthpracticeprocess
SHARED TOKENS (35): "activities", "advanced", "agricultural", "agriculture", "businesses", "costs", "direct", "distribution", "east", "effects", "fresh", "human", "increasing", "industry", "irrigation", "management", "municipal", "north", "practice", "process".... | EXACT TITLE in manufacturing_food_processing: "Reclaimed water".
0.500
accuratelyactiveassociatedbusinessescapacityconcentrationdeterminedistributioneconomicemploymententryexistingfirmsfunctionindustryissueslandlawmarketorganization
SHARED TOKENS (36): "accurately", "active", "associated", "businesses", "capacity", "concentration", "determine", "distribution", "economic", "employment", "entry", "existing", "firms", "function", "industry", "issues", "land", "law", "market", "organization".... | EXACT TITLE in manufacturing_food_processing: "Market concentration".
0.500
Floristry ↗ Q637125 EXACT TITLE
businessconsumerscorporatecreatecustomersdesigndistributioneventfreshgenerallyhandlingindustryknowledgelargemarketmaterialmaterialspeopleproductionproducts
SHARED TOKENS (30): "business", "consumers", "corporate", "create", "customers", "design", "distribution", "event", "fresh", "generally", "handling", "industry", "knowledge", "large", "market", "material", "materials", "people", "production", "products".... | EXACT TITLE in wedding_events: "Floristry".
0.500
applicationapplicationsbecomecleaningcoursecoursesequipmentfeetidentifyinglicensedlistproductsprofessionalsafelysanitationsignstrainingtreatmentwhosework
SHARED TOKENS (20): "application", "applications", "become", "cleaning", "course", "courses", "equipment", "feet", "identifying", "licensed", "list", "products", "professional", "safely", "sanitation", "signs", "training", "treatment", "whose", "work". | EXACT TITLE in wedding_events: "Nail technician".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialdefinesdevelopmenteconomiceffectsestimatedgenerallygreatlimitedlocalmarketsorganizationoutsidepeoplepracticesprogramsreal
SHARED TOKENS (24): "activity", "beyond", "business", "commercial", "defines", "development", "economic", "effects", "estimated", "generally", "great", "limited", "local", "markets", "organization", "outside", "people", "practices", "programs", "real".... | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
annualapproximatelybecomebusinessbusinessescomdirectoryinformationmobileoperatespracticepracticespublicpublishesreviewreviewssalessitesystemtable
SHARED TOKENS (22): "annual", "approximately", "become", "business", "businesses", "com", "directory", "information", "mobile", "operates", "practice", "practices", "public", "publishes", "review", "reviews", "sales", "site", "system", "table".... | EXACT TITLE in wedding_events: "Yelp". | EXACT TITLE in manufacturing_food_processing: "Yelp".
0.500
activitiesaddressapplybusinessconstraintscontractorsdesigneddevelopmentdistinctdocumentationestablishedinfluenceinformationmanagementoperationspracticeprimaryprocessproduceproduction
SHARED TOKENS (26): "activities", "address", "apply", "business", "constraints", "contractors", "designed", "development", "distinct", "documentation", "established", "influence", "information", "management", "operations", "practice", "primary", "process", "produce", "production".... | EXACT TITLE in wedding_events: "Project management".
0.500
activityconditionscontroldesigneddevelopedelectricalgeneralhousingindustryinputlargelimitednoiseoperationoperationsprocessproducedprogramsrequiresresults
SHARED TOKENS (24): "activity", "conditions", "control", "designed", "developed", "electrical", "general", "housing", "industry", "input", "large", "limited", "noise", "operation", "operations", "process", "produced", "programs", "requires", "results".... | EXACT TITLE in manufacturing_food_processing: "Programmable logic controller".
0.500
certificationexperiencedextendfieldformalfoundjoblaborlicenseon-the-joboutsidepeopleperiodplacementpracticeprofessionalreachregulatedsystemtrade
SHARED TOKENS (21): "certification", "experienced", "extend", "field", "formal", "found", "job", "labor", "license", "on-the-job", "outside", "people", "period", "placement", "practice", "professional", "reach", "regulated", "system", "trade".... | EXACT TITLE in manufacturing_food_processing: "Apprenticeship".
0.500
Accounting ↗ Q4116214 EXACT TITLE
activitiesanalysisbusinessbusinessesdesigneddevelopedeconomicfinancialfirmsformsfunctionsgenerallyhistoryhumaninformationmajormanagementoperationsorganizationpreparation
SHARED TOKENS (35): "activities", "analysis", "business", "businesses", "designed", "developed", "economic", "financial", "firms", "forms", "functions", "generally", "history", "human", "information", "major", "management", "operations", "organization", "preparation".... | EXACT TITLE in wedding_events: "Accounting".
0.500
designdifferentdocumentationeventindustryjoblargestmanagementnamesplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (15): "design", "different", "documentation", "event", "industry", "job", "largest", "management", "names", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesconsumercontinuingcustomersestablishedeventgeneralhelpindustrylatestmarketmarketsproductsprofessionalspublicshowthereforetrade
SHARED TOKENS (18): "activities", "consumer", "continuing", "customers", "established", "event", "general", "help", "industry", "latest", "market", "markets", "products", "professionals", "public", "show", "therefore", "trade". | EXACT TITLE in wedding_events: "Trade show".
0.500
additionalagriculturalauthorizationbeveragescontaminationcontrolcurrentdocumentedfoodindustrylicensingmanagementpersonnelpracticepracticesproductsqualityregulatoryrelevantrequirements
SHARED TOKENS (23): "additional", "agricultural", "authorization", "beverages", "contamination", "control", "current", "documented", "food", "industry", "licensing", "management", "personnel", "practice", "practices", "products", "quality", "regulatory", "relevant", "requirements".... | EXACT TITLE in manufacturing_food_processing: "Good manufacturing practice".
0.500
accountbeyondbusinessconditionsdatademandeconomiceconomyemploymentexperiencedextendsfallsfuturegenerallyhelpincreasesjobmaintenancemarketneed
SHARED TOKENS (32): "account", "beyond", "business", "conditions", "data", "demand", "economic", "economy", "employment", "experienced", "extends", "falls", "future", "generally", "help", "increases", "job", "maintenance", "market", "need".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
academicactivitiesbeyondcareercollegecontinuingcoursescurriculumdevelopmentdifferentdivisioneconomiceducationextensionfeedformalformsfrequentlygeneralgovernment
SHARED TOKENS (33): "academic", "activities", "beyond", "career", "college", "continuing", "courses", "curriculum", "development", "different", "division", "economic", "education", "extension", "feed", "formal", "forms", "frequently", "general", "government".... | EXACT TITLE in wedding_events: "Continuing education".
0.500
Packaging ↗ Q207822 EXACT TITLE
associatedbrandingbusinesscommunicationcontainsdistributiongoodsgoverninggovernmentinstitutionalintegratedlabelslogisticspreservesprocessproductsprotectionregulationsseparatestorage
SHARED TOKENS (23): "associated", "branding", "business", "communication", "contains", "distribution", "goods", "governing", "government", "institutional", "integrated", "labels", "logistics", "preserves", "process", "products", "protection", "regulations", "separate", "storage".... | EXACT TITLE in manufacturing_food_processing: "Packaging".
0.500
againstcontractcostsdedicateddesignedevengeneralgrouplegalliabilityotherwisepolicypremiumprotectionratherriskrisksrulesystemthough
SHARED TOKENS (21): "against", "contract", "costs", "dedicated", "designed", "even", "general", "group", "legal", "liability", "otherwise", "policy", "premium", "protection", "rather", "risk", "risks", "rule", "system", "though".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativebusinesscenterdepartmentdepartmentsdestinationsdirectearlyeconomyequipmentestablishmentestablishmentseventexecutivefacilitiesfacilityfoodform
SHARED TOKENS (52): "access", "additional", "administrative", "business", "center", "department", "departments", "destinations", "direct", "early", "economy", "equipment", "establishment", "establishments", "event", "executive", "facilities", "facility", "food", "form".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstconditionsdirectlydistinctevengenerallygreatguideinfluenceinformationlimitednetworkoutsidepeopleprocessrestaurantsecondspacesupporttechnology
SHARED TOKENS (20): "against", "conditions", "directly", "distinct", "even", "generally", "great", "guide", "influence", "information", "limited", "network", "outside", "people", "process", "restaurant", "second", "space", "support", "technology". | EXACT TITLE in wedding_events: "Information cascade".
0.500
agriculturalagricultureclassificationclassificationscontainingcookingdifferentfoodformformshomeotherwisephysicalprimaryprocessingproductsresultswaste
SHARED TOKENS (18): "agricultural", "agriculture", "classification", "classifications", "containing", "cooking", "different", "food", "form", "forms", "home", "otherwise", "physical", "primary", "processing", "products", "results", "waste". | EXACT TITLE in manufacturing_food_processing: "Food processing".
0.500
agriculturalappliedcentralconsumersdesigndevelopmentdirectlyearlyextendsfieldfoodlinkedmaterialspracticespreserveprocessingproduceproductionproductssafety
SHARED TOKENS (21): "agricultural", "applied", "central", "consumers", "design", "development", "directly", "early", "extends", "field", "food", "linked", "materials", "practices", "preserve", "processing", "produce", "production", "products", "safety".... | EXACT TITLE in manufacturing_food_processing: "Food science".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiescanyoncentralchannelcommercialcontroldevelopedeastfallsgreathistoryhosthumanidahoirrigationjoinslargelargestlimitedmajor
SHARED TOKENS (39): "activities", "canyon", "central", "channel", "commercial", "control", "developed", "east", "falls", "great", "history", "host", "human", "idaho", "irrigation", "joins", "large", "largest", "limited", "major".... | EXACT TITLE in wedding_events: "Snake River". | EXACT TITLE in manufacturing_food_processing: "Snake River".
0.500
Cattle ↗ Q830 EXACT TITLE
centralcommonlydistributedeventfarmfarmingfoundlargelivestockmeatproductsseparatesmallthemwestern
SHARED TOKENS (15): "central", "commonly", "distributed", "event", "farm", "farming", "found", "large", "livestock", "meat", "products", "separate", "small", "them", "western". | EXACT TITLE in manufacturing_food_processing: "Cattle".
0.500
Retail ↗ Q126793 EXACT TITLE
accessalongsideanalysisboothsbroaderbusinesscenterchainchannelscombinecommonlyconsumerscorecostscustomercustomersdesigndirectlyevidenceexperience
SHARED TOKENS (58): "access", "alongside", "analysis", "booths", "broader", "business", "center", "chain", "channels", "combine", "commonly", "consumers", "core", "costs", "customer", "customers", "design", "directly", "evidence", "experience".... | EXACT TITLE in wedding_events: "Retail". | EXACT TITLE in manufacturing_food_processing: "Retail".
0.500
airapplicationappliedcommonlydevelopeddirectlydistributionearlyfoundgreaterincreasinglargelinemajormunicipaloperateoperationspercentpowerpressure
SHARED TOKENS (27): "air", "application", "applied", "commonly", "developed", "directly", "distribution", "early", "found", "greater", "increasing", "large", "line", "major", "municipal", "operate", "operations", "percent", "power", "pressure".... | EXACT TITLE in manufacturing_food_processing: "Compressed air".
0.500
alreadyassetscharacteristicsconsumerscreatecustomercustomersexperienceguideidentifiedindustryorganizationpersonnelproductsqualitystandardsuses
SHARED TOKENS (17): "already", "assets", "characteristics", "consumers", "create", "customer", "customers", "experience", "guide", "identified", "industry", "organization", "personnel", "products", "quality", "standards", "uses". | EXACT TITLE in wedding_events: "Customer service".
0.500
Tent ↗ Q170544 EXACT TITLE
capablecategoriesexperiencelargelargerlinkedmaterialmultiplenearpeoplesecondsmallsmallerstructuressupportingtemporarytype
SHARED TOKENS (17): "capable", "categories", "experience", "large", "larger", "linked", "material", "multiple", "near", "people", "second", "small", "smaller", "structures", "supporting", "temporary", "type". | EXACT TITLE in wedding_events: "Tent". | EXACT TITLE in manufacturing_food_processing: "Tent".
0.500
Orchard ↗ Q236371 EXACT TITLE
basecommercialconcentratedfoodgenerallylargemaintenancemakesnearproductionscalesinglesmalleruntilwater
SHARED TOKENS (15): "base", "commercial", "concentrated", "food", "generally", "large", "maintenance", "makes", "near", "production", "scale", "single", "smaller", "until", "water". | EXACT TITLE in wedding_events: "Orchard".
0.500
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingconcentratedcoursedifferentevenfoodformformalhostlargepeopleroomthem
SHARED TOKENS (15): "additional", "among", "building", "concentrated", "course", "different", "even", "food", "form", "formal", "host", "large", "people", "room", "them". | EXACT TITLE in wedding_events: "Banquet".
0.500
administrationanimalassociatedauthoritycontrolcurrentdepartmentdirectlyfederalfeedfieldfoodhealthhumanofficesprimaryproductspublicregulatedregulations
SHARED TOKENS (25): "administration", "animal", "associated", "authority", "control", "current", "department", "directly", "federal", "feed", "field", "food", "health", "human", "offices", "primary", "products", "public", "regulated", "regulations".... | EXACT TITLE in manufacturing_food_processing: "Food and Drug Administration".
0.500
Potato ↗ Q10998 EXACT TITLE
becomedifferentexpansionfamilyfoodfoundproduceproductionrapidregionremainssecondshowsinglesupply
SHARED TOKENS (15): "become", "different", "expansion", "family", "food", "found", "produce", "production", "rapid", "region", "remains", "second", "show", "single", "supply". | EXACT TITLE in manufacturing_food_processing: "Potato".
0.500
analysisapplicationsapplycontroldistinctengineeringexistingformfunctionsguidanceindustryinformationinspectionintegratedplanningprocessproductsrealrequirementssystems
SHARED TOKENS (22): "analysis", "applications", "apply", "control", "distinct", "engineering", "existing", "form", "functions", "guidance", "industry", "information", "inspection", "integrated", "planning", "process", "products", "real", "requirements", "systems".... | EXACT TITLE in manufacturing_food_processing: "Machine vision".
0.500
agriculturalagriculturealoneanimalavailabilityclimatecoursedemandeconomiceffecteffectsfeedfoodfrequentlyhumaninputlandlargelivestockmakes
SHARED TOKENS (30): "agricultural", "agriculture", "alone", "animal", "availability", "climate", "course", "demand", "economic", "effect", "effects", "feed", "food", "frequently", "human", "input", "land", "large", "livestock", "makes".... | EXACT TITLE in manufacturing_food_processing: "Animal feed".
0.480
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlyfallshumanissueslandlargemajorrelatedtreatmentwater
SHARED TOKENS (14): "become", "create", "demand", "developed", "directly", "falls", "human", "issues", "land", "large", "major", "related", "treatment", "water". | EXACT TITLE in manufacturing_food_processing: "Stormwater".
0.480
Milk ↗ Q8495 EXACT TITLE
againstagriculturalbasecontainsfarmfoodlargestnutritionpeopleprimaryproducedproductssourcesystem
SHARED TOKENS (14): "against", "agricultural", "base", "contains", "farm", "food", "largest", "nutrition", "people", "primary", "produced", "products", "source", "system". | EXACT TITLE in manufacturing_food_processing: "Milk".
0.480
analysiscommonlydemandfunctionmaterialperiodratherreceivingshort-termtemperaturetreatmentvaluewastewaterwater
SHARED TOKENS (14): "analysis", "commonly", "demand", "function", "material", "period", "rather", "receiving", "short-term", "temperature", "treatment", "value", "wastewater", "water". | EXACT TITLE in manufacturing_food_processing: "Biochemical oxygen demand".
0.480
agreementboisecenterschaincomdistributionfoodidaholargestlistoperatedownedretailuntil
SHARED TOKENS (14): "agreement", "boise", "centers", "chain", "com", "distribution", "food", "idaho", "largest", "list", "operated", "owned", "retail", "until". | EXACT TITLE in manufacturing_food_processing: "WinCo Foods".
0.470
approximatelyboisecenteridahonampawest
SHARED TOKENS (6): "approximately", "boise", "center", "idaho", "nampa", "west". | URL->A (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.460
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalapplicationscommercialcommonlyfreshgeneratedmunicipalpeopleproducedwastewastewaterwater
SHARED TOKENS (13): "activities", "agricultural", "applications", "commercial", "commonly", "fresh", "generated", "municipal", "people", "produced", "waste", "wastewater", "water". | EXACT TITLE in wedding_events: "Wastewater". | EXACT TITLE in manufacturing_food_processing: "Wastewater".
0.460
activityamongcampusfallsidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (13): "activity", "among", "campus", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in wedding_events: "Idaho State University".
0.460
Sausage ↗ Q131419 EXACT TITLE
becomefoodfreshmaterialsmeatnationalpreparationprocessingrefrigeratedregionalsoldtypeuntil
SHARED TOKENS (13): "become", "food", "fresh", "materials", "meat", "national", "preparation", "processing", "refrigerated", "regional", "sold", "type", "until". | EXACT TITLE in manufacturing_food_processing: "Sausage".
0.460
becomecommercialdirectdistinctionfieldhistoricallylocalmediamovingnewsproductionstoragework
SHARED TOKENS (13): "become", "commercial", "direct", "distinction", "field", "historically", "local", "media", "moving", "news", "production", "storage", "work". | EXACT TITLE in wedding_events: "Videography".
0.460
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedconnectioneventexperiencefoodintegratedlocalmeansnationalpracticesource
SHARED TOKENS (13): "agriculture", "among", "associated", "connection", "event", "experience", "food", "integrated", "local", "means", "national", "practice", "source". | EXACT TITLE in wedding_events: "Festival".
0.460
Restaurant ↗ Q11707 EXACT TITLE
beveragesbusinesscustomersestablishmentestablishmentsfamilyfoodgenerallypremisesrestaurantrestaurantsservedsingle
SHARED TOKENS (13): "beverages", "business", "customers", "establishment", "establishments", "family", "food", "generally", "premises", "restaurant", "restaurants", "served", "single". | EXACT TITLE in wedding_events: "Restaurant". | EXACT TITLE in manufacturing_food_processing: "Restaurant".
0.440
administrationeffectfoodhealthinfluencejurisdictionlegalmarketingproductsregulatedregulatorytreatment
SHARED TOKENS (12): "administration", "effect", "food", "health", "influence", "jurisdiction", "legal", "marketing", "products", "regulated", "regulatory", "treatment". | EXACT TITLE in manufacturing_food_processing: "Nutraceutical".
0.440
agreementbeveragescommonlydrivehomeinfluencepersonspracticalremainsrestaurantsafelyselection
SHARED TOKENS (12): "agreement", "beverages", "commonly", "drive", "home", "influence", "persons", "practical", "remains", "restaurant", "safely", "selection". | EXACT TITLE in wedding_events: "Designated driver".
0.440
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialconcentrateddistrictemploymentnorthofficepublicsmallsmaller
SHARED TOKENS (12): "business", "center", "central", "commercial", "concentrated", "district", "employment", "north", "office", "public", "small", "smaller". | EXACT TITLE in wedding_events: "Downtown".
0.440
authoritydocumentissuedlegallicenselicensesorganizationotherwiseperiodpermitrecordrequire
SHARED TOKENS (12): "authority", "document", "issued", "legal", "license", "licenses", "organization", "otherwise", "period", "permit", "record", "require". | EXACT TITLE in wedding_events: "Marriage license".
0.440
Allergen ↗ Q186752 EXACT TITLE
againstanimalcapablehealthmaintainsorganizationotherwiseproducesproductionsensitivetypeunion
SHARED TOKENS (12): "against", "animal", "capable", "health", "maintains", "organization", "otherwise", "produces", "production", "sensitive", "type", "union". | EXACT TITLE in manufacturing_food_processing: "Allergen".
0.430
Simplot ↗ Q3484788 EXACT TITLE
agricultureboisecommonlyidaho
SHARED TOKENS (4): "agriculture", "boise", "commonly", "idaho". | URL->B (1): https://www.simplot.com/company. | EXACT TITLE in manufacturing_food_processing: "Simplot".
0.420
applicableapplicationchaindevelopmentdocumentedhistoryidentificationinformationmeanssupplytype
SHARED TOKENS (11): "applicable", "application", "chain", "development", "documented", "history", "identification", "information", "means", "supply", "type". | EXACT TITLE in manufacturing_food_processing: "Traceability".
0.420
Mozzarella ↗ Q14088 EXACT TITLE
animaldistinctfreshgenerallymakesrefrigeratedresearchriverservedsoldtype
SHARED TOKENS (11): "animal", "distinct", "fresh", "generally", "makes", "refrigerated", "research", "river", "served", "sold", "type". | EXACT TITLE in manufacturing_food_processing: "Mozzarella".
0.420
Barn ↗ Q1303167 EXACT TITLE
activitiesagriculturalappliedbuildingbuildingsequipmentintegratedlivestocknorthstoragestructures
SHARED TOKENS (11): "activities", "agricultural", "applied", "building", "buildings", "equipment", "integrated", "livestock", "north", "storage", "structures". | EXACT TITLE in wedding_events: "Barn".
0.420
controldesignelectricalengineeringfieldnamepeopleproducestandardsystemstechnology
SHARED TOKENS (11): "control", "design", "electrical", "engineering", "field", "name", "people", "produce", "standard", "systems", "technology". | EXACT TITLE in manufacturing_food_processing: "Mechatronics".
0.420
controlcoveringengineeringequipmenthazardslinemeansoperatingoperationsoperatorssafety
SHARED TOKENS (11): "control", "covering", "engineering", "equipment", "hazards", "line", "means", "operating", "operations", "operators", "safety". | EXACT TITLE in manufacturing_food_processing: "Machine guarding".
0.420
accommodatebuildingcentercentersdesignedfloorlargemajorroomssharetrade
SHARED TOKENS (11): "accommodate", "building", "center", "centers", "designed", "floor", "large", "major", "rooms", "share", "trade". | EXACT TITLE in wedding_events: "Convention center".
0.420
Chorizo ↗ Q23374 EXACT TITLE
addbeveragescookingdifferentelsewherenamesnationalproductsregionalrequiringtype
SHARED TOKENS (11): "add", "beverages", "cooking", "different", "elsewhere", "names", "national", "products", "regional", "requiring", "type". | EXACT TITLE in manufacturing_food_processing: "Chorizo".
0.400
Anthocyanin ↗ Q262547 EXACT TITLE
amongbeverageeffectevidencefoodhumanpathwaysafeunionverified
SHARED TOKENS (10): "among", "beverage", "effect", "evidence", "food", "human", "pathway", "safe", "union", "verified". | EXACT TITLE in manufacturing_food_processing: "Anthocyanin".
0.400
activitiesbuildingbusinessequipmentinfrastructuremaintenanceoperationalpracticesresidentialsupporting
SHARED TOKENS (10): "activities", "building", "business", "equipment", "infrastructure", "maintenance", "operational", "practices", "residential", "supporting". | EXACT TITLE in wedding_events: "Maintenance". | EXACT TITLE in manufacturing_food_processing: "Maintenance".
0.400
Forklift ↗ Q41577 EXACT TITLE
becomedevelopeddevelopmentearlyequipmentmaterialsmovesalessoldwarehousing
SHARED TOKENS (10): "become", "developed", "development", "early", "equipment", "materials", "move", "sales", "sold", "warehousing". | EXACT TITLE in manufacturing_food_processing: "Forklift".
0.380
Rose garden ↗ Q291177 EXACT TITLE
alongsidealreadyexistinglargestoriginspublicspecializedtreatedtype
SHARED TOKENS (9): "alongside", "already", "existing", "largest", "origins", "public", "specialized", "treated", "type". | EXACT TITLE in wedding_events: "Rose garden".
0.380
consumerscontractorsequipmentgeneralindustrylimitedperiodshort-termtemporary
SHARED TOKENS (9): "consumers", "contractors", "equipment", "general", "industry", "limited", "period", "short-term", "temporary". | EXACT TITLE in wedding_events: "Equipment rental".
0.380
businessclimatecommercialestategroupmanagementprofessionalrealview
SHARED TOKENS (9): "business", "climate", "commercial", "estate", "group", "management", "professional", "real", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.380
Butcher ↗ Q329737 EXACT TITLE
animalestablishmentsfoodmarketsmeatpreparationretailspecializesstandard
SHARED TOKENS (9): "animal", "establishments", "food", "markets", "meat", "preparation", "retail", "specializes", "standard". | EXACT TITLE in manufacturing_food_processing: "Butcher".
0.380
controlfieldfoundinvolvingoriginsphysicalprocessrelatedsystems
SHARED TOKENS (9): "control", "field", "found", "involving", "origins", "physical", "process", "related", "systems". | EXACT TITLE in manufacturing_food_processing: "Instrumentation".
0.380
Purée ↗ Q636056 EXACT TITLE
broadercommonlycookingfoodgenerallynamesratherservedwater
SHARED TOKENS (9): "broader", "commonly", "cooking", "food", "generally", "names", "rather", "served", "water". | EXACT TITLE in manufacturing_food_processing: "Purée".
0.380
Salami ↗ Q188655 EXACT TITLE
amongcentralfreshhistoricallymeatperiodroomsupplytemperature
SHARED TOKENS (9): "among", "central", "fresh", "historically", "meat", "period", "room", "supply", "temperature". | EXACT TITLE in manufacturing_food_processing: "Salami".
0.380
boisedepartmentfederalgovernmentidahoofficesqualityregionalregulations
SHARED TOKENS (9): "boise", "department", "federal", "government", "idaho", "offices", "quality", "regional", "regulations". | EXACT TITLE in manufacturing_food_processing: "Idaho Department of Environmental Quality".
0.380
bureaudepartmentenforcementidaholawmunicipalorganizationpublicstatewide
SHARED TOKENS (9): "bureau", "department", "enforcement", "idaho", "law", "municipal", "organization", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police".
0.380
amongbuildingbuildingsconversioncostsdesignedexistingreusesustainability
SHARED TOKENS (9): "among", "building", "buildings", "conversion", "costs", "designed", "existing", "reuse", "sustainability". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.360
beveragesbusinessesformsissuedlicenseofficialotherwisepermit
SHARED TOKENS (8): "beverages", "businesses", "forms", "issued", "license", "official", "otherwise", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.360
Boiler ↗ EXACT TITLE
applicationscentralcookinggenerallyheatingpowersanitationwater
SHARED TOKENS (8): "applications", "central", "cooking", "generally", "heating", "power", "sanitation", "water". | EXACT TITLE in manufacturing_food_processing: "Boiler".
0.360
aircommonlyevenfoodgenerallyrestaurantsservedthem
SHARED TOKENS (8): "air", "commonly", "even", "food", "generally", "restaurants", "served", "them". | EXACT TITLE in manufacturing_food_processing: "French fries".
0.360
Public records ↗ EXACT TITLE
documentedgenerallygovernmentinformationjurisdictionpublicrecordstransactions
SHARED TOKENS (8): "documented", "generally", "government", "information", "jurisdiction", "public", "records", "transactions". | EXACT TITLE in wedding_events: "Public records".
0.360
amongcannotdeterminefamilylawlegallegallyrequirements
SHARED TOKENS (8): "among", "cannot", "determine", "family", "law", "legal", "legally", "requirements". | EXACT TITLE in wedding_events: "Marriage law".
0.360
Officiant ↗ Q2015874 EXACT TITLE
commonlyfacilityhealthhumanlawlegalpersonswork
SHARED TOKENS (8): "commonly", "facility", "health", "human", "law", "legal", "persons", "work". | EXACT TITLE in wedding_events: "Officiant".
0.340
functionsgovernmenthealthjurisdictionprofessionalsrecordssigns
SHARED TOKENS (7): "functions", "government", "health", "jurisdiction", "professionals", "records", "signs". | EXACT TITLE in wedding_events: "Vital statistics".
0.340
Cosmetology ↗ EXACT TITLE
applicationaveragelicenseoccupationalspecialtytreatmentwage
SHARED TOKENS (7): "application", "average", "license", "occupational", "specialty", "treatment", "wage". | EXACT TITLE in wedding_events: "Cosmetology".
0.340
boiseeaglefoodidaholargestprocessingproducts
SHARED TOKENS (7): "boise", "eagle", "food", "idaho", "largest", "processing", "products". | EXACT TITLE in manufacturing_food_processing: "Lamb Weston".
0.340
Use tax ↗ Q17155766 EXACT TITLE
appliedpropertysalessoldstoragesubjecttype
SHARED TOKENS (7): "applied", "property", "sales", "sold", "storage", "subject", "type". | EXACT TITLE in wedding_events: "Use tax".
0.340
businessescapitalfinancialformsidentificationprocessthough
SHARED TOKENS (7): "businesses", "capital", "financial", "forms", "identification", "process", "though". | EXACT TITLE in wedding_events: "Fundraising".
0.340
freshhistoricallyopenedproducedretailerssolduntil
SHARED TOKENS (7): "fresh", "historically", "opened", "produced", "retailers", "sold", "until". | EXACT TITLE in manufacturing_food_processing: "Summer sausage".
0.340
Beer garden ↗ Q857909 EXACT TITLE
capitalfoodlocaloutdoorremainrestaurantserved
SHARED TOKENS (7): "capital", "food", "local", "outdoor", "remain", "restaurant", "served". | EXACT TITLE in wedding_events: "Beer garden".
0.340
containingfacilityfoodpeopleproducesproductswater
SHARED TOKENS (7): "containing", "facility", "food", "people", "produces", "products", "water". | EXACT TITLE in manufacturing_food_processing: "Dairy product".
0.340
businessdevelopmentestateindustryofficeofficesrather
SHARED TOKENS (7): "business", "development", "estate", "industry", "office", "offices", "rather". | EXACT TITLE in manufacturing_food_processing: "Industrial park".
0.320
helpidahonampaprofessionalriversnake
SHARED TOKENS (6): "help", "idaho", "nampa", "professional", "river", "snake". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.320
createdesignevidencefoundmarketingmaterial
SHARED TOKENS (6): "create", "design", "evidence", "found", "marketing", "material". | EXACT TITLE in wedding_events: "Floral design".
0.320
buildingsdevelopmentlegacymaintainspreserveproducts
SHARED TOKENS (6): "buildings", "development", "legacy", "maintains", "preserve", "products". | EXACT TITLE in wedding_events: "Historic preservation".
0.320
Raspberry ↗ Q13179 EXACT TITLE
appliesfamilynamenorthpreservesproduction
SHARED TOKENS (6): "applies", "family", "name", "north", "preserves", "production". | EXACT TITLE in manufacturing_food_processing: "Raspberry".
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
agreementappliesbeyondconstitutescontractcontractscontrolcontrolleddistinctdistinctioneffecteventgeneralgenerallygoverninggovernslawlegallegallyliability
SHARED TOKENS (37): "agreement", "applies", "beyond", "constitutes", "contract", "contracts", "control", "controlled", "distinct", "distinction", "effect", "event", "general", "generally", "governing", "governs", "law", "legal", "legally", "liability"....
0.300
agriculturalagricultureairanimalcontrolcoolingdevelopeddirectdisposalearlyexpansionfarmfarminggeneralgenerallyhealthhistoryindustryissueslarge
SHARED TOKENS (32): "agricultural", "agriculture", "air", "animal", "control", "cooling", "developed", "direct", "disposal", "early", "expansion", "farm", "farming", "general", "generally", "health", "history", "industry", "issues", "large"....
0.300
agriculturalagricultureanimalassociateddifferentequipmenteventfarmlargestlivestocknorthpracticespublicshowtradework
SHARED TOKENS (16): "agricultural", "agriculture", "animal", "associated", "different", "equipment", "event", "farm", "largest", "livestock", "north", "practices", "public", "show", "trade", "work".
0.300
amongcommercialeducationevidencefoodfoundgreaterhumanmeatnutritionpeopleplanproductsremainsselectionshowsmalltreatment
SHARED TOKENS (18): "among", "commercial", "education", "evidence", "food", "found", "greater", "human", "meat", "nutrition", "people", "plan", "products", "remains", "selection", "show", "small", "treatment".
0.300
activeaddressamongcurrentcustomersdatadominantestablishmentfirmsgeneralmanagementmarketingmediaplatformsproductspublicratherreviewsstrategic
SHARED TOKENS (19): "active", "address", "among", "current", "customers", "data", "dominant", "establishment", "firms", "general", "management", "marketing", "media", "platforms", "products", "public", "rather", "reviews", "strategic".
0.300
connectedequipmentfacilitieshumaninfrastructurelargemobilemunicipaloutdoorrequireroomssinglesitessmallsystemtreatmenttype
SHARED TOKENS (17): "connected", "equipment", "facilities", "human", "infrastructure", "large", "mobile", "municipal", "outdoor", "require", "rooms", "single", "sites", "small", "system", "treatment", "type".
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
amongapplicablebeyondcommonlycompletedcontroldistributionestablishingextendformformalgroupjurisdictionlargelawlegallicenselimitedmeansmultiple
SHARED TOKENS (29): "among", "applicable", "beyond", "commonly", "completed", "control", "distribution", "establishing", "extend", "form", "formal", "group", "jurisdiction", "large", "law", "legal", "license", "limited", "means", "multiple"....
0.300
academicadministrationbusinesscenterscollegecoursededicateddepartmentfieldindustrymanagementmarketingparksrelevantrestaurantssubjectuniversity
SHARED TOKENS (17): "academic", "administration", "business", "centers", "college", "course", "dedicated", "department", "field", "industry", "management", "marketing", "parks", "relevant", "restaurants", "subject", "university".
0.300
activitiesactivityadministrationadministrativecontrolcoordinatedivisioneconomiceducationenforcementexecutivegenerallygoverninggovernmenthumaninfluencelawlegalmodelopened
SHARED TOKENS (29): "activities", "activity", "administration", "administrative", "control", "coordinate", "division", "economic", "education", "enforcement", "executive", "generally", "governing", "government", "human", "influence", "law", "legal", "model", "opened"....
0.300
Slaughterhouse ↗ Q385557 KW CROSS HIGH
agricultureanimaldifferentfacilityfarmfoodfrequentlyhealthhumanindustryissueslargelivestocklogisticsmeatpreparationprocessproducepublicrequirements
SHARED TOKENS (24): "agriculture", "animal", "different", "facility", "farm", "food", "frequently", "health", "human", "industry", "issues", "large", "livestock", "logistics", "meat", "preparation", "process", "produce", "public", "requirements"....
0.300
appliesapplyauthorizedbasebeveragescompliancecomplydistributiondistricteffectexemptfacilityfederalgovernmenthomejurisdictionlandlawlegallist
SHARED TOKENS (44): "applies", "apply", "authorized", "base", "beverages", "compliance", "comply", "distribution", "district", "effect", "exempt", "facility", "federal", "government", "home", "jurisdiction", "land", "law", "legal", "list"....
0.300
applicableappliedauthoritycentralconditionscostsdependsdesigndevelopmentdistrictseconomicexposurefacilitiesfunctionfuturegoalhealthhumanlandland-use
SHARED TOKENS (36): "applicable", "applied", "authority", "central", "conditions", "costs", "depends", "design", "development", "districts", "economic", "exposure", "facilities", "function", "future", "goal", "health", "human", "land", "land-use"....
0.300
businesscomcommunicationconnectconnectsconsumerscreatescustomersdemanddevelopeddevelopmentdirectdistincteconomicexplainingfoundgrouphealthjobmaintenance
SHARED TOKENS (40): "business", "com", "communication", "connect", "connects", "consumers", "creates", "customers", "demand", "developed", "development", "direct", "distinct", "economic", "explaining", "found", "group", "health", "job", "maintenance"....
0.300
applicationschainconsumercustomersdifferentequipmentfloorfoundhandlinginvolvingmaterialmaterialsmovespowersystemsystemsthem
SHARED TOKENS (17): "applications", "chain", "consumer", "customers", "different", "equipment", "floor", "found", "handling", "involving", "material", "materials", "moves", "power", "system", "systems", "them".
0.300
activityamongcontrolcontrolleddescribeseconomiceffectevenfederalfoundgoodsgovernmentinterstatejurisdictionmatterspowerseparatesoldsource
SHARED TOKENS (19): "activity", "among", "control", "controlled", "describes", "economic", "effect", "even", "federal", "found", "goods", "government", "interstate", "jurisdiction", "matters", "power", "separate", "sold", "source".
0.300
Water pollution ↗ KW CROSS HIGH
activitiesagriculturalconditionscontaminationcontroleffectformformshumaninfrastructureirrigationmanagementpeoplepowerproductsrequiresresultssanitationtechnologytreatment
SHARED TOKENS (23): "activities", "agricultural", "conditions", "contamination", "control", "effect", "form", "forms", "human", "infrastructure", "irrigation", "management", "people", "power", "products", "requires", "results", "sanitation", "technology", "treatment"....
0.300
agriculturalagriculturebeveragedifferenteconomyfoodgeneratedidaholandlargestlivestockprocessingproducesproductionproductsrepresentsrolesalessecond
SHARED TOKENS (19): "agricultural", "agriculture", "beverage", "different", "economy", "food", "generated", "idaho", "land", "largest", "livestock", "processing", "produces", "production", "products", "represents", "role", "sales", "second".
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activityanimalchaincoldcommercialconditionsconsumerscookingdistributionfoodformhumanlogisticspeopleproduceproductsprotectionratherstagesstorage
SHARED TOKENS (24): "activity", "animal", "chain", "cold", "commercial", "conditions", "consumers", "cooking", "distribution", "food", "form", "human", "logistics", "people", "produce", "products", "protection", "rather", "stages", "storage"....
0.300
agriculturalagriculturecharacteristicsclimateconnectcontaminationcontroldistinctionengineeringevenfoodhealthhumaninfluencelandland-uselandscapelargelocalmanagement
SHARED TOKENS (36): "agricultural", "agriculture", "characteristics", "climate", "connect", "contamination", "control", "distinction", "engineering", "even", "food", "health", "human", "influence", "land", "land-use", "landscape", "large", "local", "management"....
0.300
basebrandcontractdesigngoodsindependentnameoperationsphysicalprocessproducesproductsrathersalessuppliers
SHARED TOKENS (15): "base", "brand", "contract", "design", "goods", "independent", "name", "operations", "physical", "process", "produces", "products", "rather", "sales", "suppliers".
0.300
Distillation ↗ Q101017 KW CROSS HIGH
airapplicationsapproximatelybeveragescapabledifferencesfeedheatingidentifiesissuelargelivestockmaterialsoperateoperatesoperationoperationsphysicalpressureprocess
SHARED TOKENS (31): "air", "applications", "approximately", "beverages", "capable", "differences", "feed", "heating", "identifies", "issue", "large", "livestock", "materials", "operate", "operates", "operation", "operations", "physical", "pressure", "process"....
0.300
completedcontainsdifferentfrequentlyhistoryhomeorganizationpeopleperiodphysicalplacementrolesitestandardssupporttracesvalue
SHARED TOKENS (17): "completed", "contains", "different", "frequently", "history", "home", "organization", "people", "period", "physical", "placement", "role", "site", "standards", "support", "traces", "value".
0.300
Food allergy ↗ KW CROSS HIGH
againstamongcommonlyconditionsdevelopeddevelopmentearlyexposurefamilyfoodhistoryincreasingmanagementoccurspeopleplanpressureriskseparatesystem
SHARED TOKENS (22): "against", "among", "commonly", "conditions", "developed", "development", "early", "exposure", "family", "food", "history", "increasing", "management", "occurs", "people", "plan", "pressure", "risk", "separate", "system"....
0.300
Barley ↗ Q11577 KW CROSS HIGH
amonganimalbeveragescommonlyfamilyfeedmajormaterialnamespreparationproducedproductionrolesourcethroughout
SHARED TOKENS (15): "among", "animal", "beverages", "commonly", "family", "feed", "major", "material", "names", "preparation", "produced", "production", "role", "source", "throughout".
0.300
accountadvancedapplicationapproximatelyavailabilityaveragebusinessesconnectedcontainscostsdemanddesigndevelopeddifferentestimatedevenfieldhumanincorporatesinvolving
SHARED TOKENS (47): "account", "advanced", "application", "approximately", "availability", "average", "businesses", "connected", "contains", "costs", "demand", "design", "developed", "different", "estimated", "even", "field", "human", "incorporates", "involving"....
0.300
alongsideauthorityconsumerconsumersdevelopedearlyeastevenfoodgreaterhealthinformationlabelslistlistingslocalmarketsnamesnorthproduction
SHARED TOKENS (32): "alongside", "authority", "consumer", "consumers", "developed", "early", "east", "even", "food", "greater", "health", "information", "labels", "list", "listings", "local", "markets", "names", "north", "production"....
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscontroldedicateddepartmentdominantfacilitiesfloorhelplimitedmajornorthparkingpeoplepermitrequirerequiresspacesthemtransportationwater
SHARED TOKENS (20): "buildings", "control", "dedicated", "department", "dominant", "facilities", "floor", "help", "limited", "major", "north", "parking", "people", "permit", "require", "requires", "spaces", "them", "transportation", "water".
0.300
accessactivitiesbusinessescommonlyconstraintsconsumerscontrolledcurrentcustomersdatadocumenteddriveevenformgenerallygovernmenthealthinformationissueslocal
SHARED TOKENS (29): "access", "activities", "businesses", "commonly", "constraints", "consumers", "controlled", "current", "customers", "data", "documented", "drive", "even", "form", "generally", "government", "health", "information", "issues", "local"....
0.300
administrationconditionscostsdepartmenteducationeffectsemploymentestablishedfederalhealthinspectlaborlawoccupationalregulationsregulatorysafesafetysalesstandards
SHARED TOKENS (21): "administration", "conditions", "costs", "department", "education", "effects", "employment", "established", "federal", "health", "inspect", "labor", "law", "occupational", "regulations", "regulatory", "safe", "safety", "sales", "standards"....
0.300
activeapplicationsbrandbrandsbusinesseschannelsconnectconsumerscreatecustomercustomersdevelopedentryeventgeneratedincreasinginfluenceinformationmedianews
SHARED TOKENS (34): "active", "applications", "brand", "brands", "businesses", "channels", "connect", "consumers", "create", "customer", "customers", "developed", "entry", "event", "generated", "increasing", "influence", "information", "media", "news"....
0.300
airconsolidationcontroldifferentdocumentationjoblogisticsmanagementmaterialsmovepeopleplanningpurchasingrailtraffic
SHARED TOKENS (15): "air", "consolidation", "control", "different", "documentation", "job", "logistics", "management", "materials", "move", "people", "planning", "purchasing", "rail", "traffic".
0.300
academicbecomecommonlycompetecostsdedicateddevelopeddevelopmentdiscoveryfinancialformshomeinformationinputlargemaintenancemajormediamobilemultiple
SHARED TOKENS (36): "academic", "become", "commonly", "compete", "costs", "dedicated", "developed", "development", "discovery", "financial", "forms", "home", "information", "input", "large", "maintenance", "major", "media", "mobile", "multiple"....
0.300
administrationbusinesscapitalconsolidationdepartmentsdesigndevelopmentdocumentingearlyemployeefieldhumaninvolvinglabormanagementorganizationpeopleplanningprofessionalsprograms
SHARED TOKENS (28): "administration", "business", "capital", "consolidation", "departments", "design", "development", "documenting", "early", "employee", "field", "human", "involving", "labor", "management", "organization", "people", "planning", "professionals", "programs"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
commonlycreateeffectsequipmentevenfunctionshostmediamobilenamespersonsprivateprogramspublicrealrecordrecordssimultaneouslysmallspecialized
SHARED TOKENS (23): "commonly", "create", "effects", "equipment", "even", "functions", "host", "media", "mobile", "names", "persons", "private", "programs", "public", "real", "record", "records", "simultaneously", "small", "specialized"....
0.300
brandbusinesscontractcontractscontroldesigndirectentryfeefunctionsgovernmentindustryinvestmentlargelicensinglocalmanagementoperatingoperationoperational
SHARED TOKENS (29): "brand", "business", "contract", "contracts", "control", "design", "direct", "entry", "fee", "functions", "government", "industry", "investment", "large", "licensing", "local", "management", "operating", "operation", "operational"....
0.300
agricultureapplicationconcentrationcontroldesigndevelopmentengineeringfieldfoodlargelawmaterialmaterialsoperationphysicalpressureprocessprocessingproductionproducts
SHARED TOKENS (22): "agriculture", "application", "concentration", "control", "design", "development", "engineering", "field", "food", "large", "law", "material", "materials", "operation", "physical", "pressure", "process", "processing", "production", "products"....
0.300
Wedding ↗ Q49836 EXACT TITLE
authoritycommonlyincorporatedpeoplepublic
SHARED TOKENS (5): "authority", "commonly", "incorporated", "people", "public". | EXACT TITLE in wedding_events: "Wedding".
0.300
appliesattributebecomebuildingscentersconnectioneconomicfuturegroupindustryissuesknowledgelegacylegallocalmajornationalphysicalpropertyprotection
SHARED TOKENS (25): "applies", "attribute", "become", "buildings", "centers", "connection", "economic", "future", "group", "industry", "issues", "knowledge", "legacy", "legal", "local", "major", "national", "physical", "property", "protection"....
0.300
Wheat ↗ Q15645384 KW CROSS HIGH
demandfoodgeneralgreatergrouphumanincreasingindustrylandlargermajormultiplenorthproductionqualityrecordsecondsmallsourcetrade
SHARED TOKENS (21): "demand", "food", "general", "greater", "group", "human", "increasing", "industry", "land", "larger", "major", "multiple", "north", "production", "quality", "record", "second", "small", "source", "trade"....
0.300
controlcontrolscorporatedistinguishfinancialgoodshomeinvestmentlargestmultipleoperatingorganizationownsportfolioproductionpubliclyrisks
SHARED TOKENS (17): "control", "controls", "corporate", "distinguish", "financial", "goods", "home", "investment", "largest", "multiple", "operating", "organization", "owns", "portfolio", "production", "publicly", "risks".
0.300
administrationagricultureanalysischaincontrolcontrolsdepartmentdesigndistributioneffectsestablishedestablishingfirmsfoodgovernmenthazardshealthindustryinspectinspection
SHARED TOKENS (42): "administration", "agriculture", "analysis", "chain", "control", "controls", "department", "design", "distribution", "effects", "established", "establishing", "firms", "food", "government", "hazards", "health", "industry", "inspect", "inspection"....
0.300
accountactivitiesaddressbrandbroaderbusinessbusinessescentralcommunicationcommunicationscontrolledcorecreatecustomersdirectestablisheventexecutiveexposurefield
SHARED TOKENS (54): "account", "activities", "address", "brand", "broader", "business", "businesses", "central", "communication", "communications", "controlled", "core", "create", "customers", "direct", "establish", "event", "executive", "exposure", "field"....
0.300
availabilityconsumerconsumersfeegeneralinformationmultipleoperatorprimaryprocessproductionproductsretailretailerssegmentselectionsinglesitetransactionstype
SHARED TOKENS (21): "availability", "consumer", "consumers", "fee", "general", "information", "multiple", "operator", "primary", "process", "production", "products", "retail", "retailers", "segment", "selection", "single", "site", "transactions", "type"....
0.300
advancedapplicationscategoryconsumercontainingcontrolsconventionalearlyexposurefabricationfieldformfunctionshistoryincorporatedindustrymarketsmediaprocessingproduce
SHARED TOKENS (32): "advanced", "applications", "category", "consumer", "containing", "controls", "conventional", "early", "exposure", "fabrication", "field", "form", "functions", "history", "incorporated", "industry", "markets", "media", "processing", "produce"....
0.300
Sugar industry ↗ Q227870 KW CROSS HIGH
beverageseconomicfoodindustrymarketmarketingprocessingproduceproducedproducesproductionproductsrolesupportingtable
SHARED TOKENS (15): "beverages", "economic", "food", "industry", "market", "marketing", "processing", "produce", "produced", "produces", "production", "products", "role", "supporting", "table".
0.300
becomecreateformfrequentlyhelpindependentmarketingmediamobilemultipleoperatingplatformspracticesproductsregulationresearchsubjectsystemsuseswork
SHARED TOKENS (20): "become", "create", "form", "frequently", "help", "independent", "marketing", "media", "mobile", "multiple", "operating", "platforms", "practices", "products", "regulation", "research", "subject", "systems", "uses", "work".
0.300
architectsconditionscontroldesignengineeringestateexistinggeneralhumaninfrastructureinvestigationlandscapelicenselicensedlicensesmanagementoutdoorparksplanningprivate
SHARED TOKENS (26): "architects", "conditions", "control", "design", "engineering", "estate", "existing", "general", "human", "infrastructure", "investigation", "landscape", "license", "licensed", "licenses", "management", "outdoor", "parks", "planning", "private"....
0.300
Make-up artist ↗ Q935666 KW CROSS HIGH
accessappliesfoundgenerallyhumanindustrylargelicensesproductionprofessionalremainschedulesthemwhosework
SHARED TOKENS (15): "access", "applies", "found", "generally", "human", "industry", "large", "licenses", "production", "professional", "remain", "schedules", "them", "whose", "work".
0.300
Vocational education ↗ KW CROSS HIGH
careercollegedesignedeconomiceducationformalformsgeneralknowledgenamesrelatedschoolsspecializedtechnologytradetrainingtypeunderlyinguniversities
SHARED TOKENS (19): "career", "college", "designed", "economic", "education", "formal", "forms", "general", "knowledge", "names", "related", "schools", "specialized", "technology", "trade", "training", "type", "underlying", "universities".
0.300
Right of way ↗ KW CROSS HIGH
authoritycapabledifferentestatefacilitygovernmentlandlegallocaloperateotherwiseownershippeoplephysicalprivaterealroutesstatusthemtraffic
SHARED TOKENS (21): "authority", "capable", "different", "estate", "facility", "government", "land", "legal", "local", "operate", "otherwise", "ownership", "people", "physical", "private", "real", "routes", "status", "them", "traffic"....
0.300
addressaddressingadministrationauthorityfederalfoodguidancehostindustryissuelawlegalmajorreportedreportsrequiressafetysalesstandards
SHARED TOKENS (19): "address", "addressing", "administration", "authority", "federal", "food", "guidance", "host", "industry", "issue", "law", "legal", "major", "reported", "reports", "requires", "safety", "sales", "standards".
0.300
describesdevelopmenteconomicfrequentlyhistoricallyincreasesinfrastructurelocalmarketpeoplepolicyprocessqualityregionwest
SHARED TOKENS (15): "describes", "development", "economic", "frequently", "historically", "increases", "infrastructure", "local", "market", "people", "policy", "process", "quality", "region", "west".
0.300
Brewery ↗ Q131734 KW CROSS HIGH
businesscommercialdedicateddistinctequipmenthomeindustrylargermakesprocessproduceproducedproductionprotectionscaleworkers
SHARED TOKENS (16): "business", "commercial", "dedicated", "distinct", "equipment", "home", "industry", "larger", "makes", "process", "produce", "produced", "production", "protection", "scale", "workers".
0.300
Supply chain ↗ Q1824206 KW CROSS HIGH
chainchannelsconsumerconsumerscustomersdirectdirectlydistributionfacilitiesgoodsindependentlinkedlogisticsmanagementmaterialsnetworkproductsstructuresupplierssupply
SHARED TOKENS (24): "chain", "channels", "consumer", "consumers", "customers", "direct", "directly", "distribution", "facilities", "goods", "independent", "linked", "logistics", "management", "materials", "network", "products", "structure", "suppliers", "supply"....
0.300
agriculturalagriculturebusinesscertificationcertifiedclimatecodecombinesconditionsconventionalconversioncreateeffectsfarmfarmingfeedfoodformhumanland
SHARED TOKENS (34): "agricultural", "agriculture", "business", "certification", "certified", "climate", "code", "combines", "conditions", "conventional", "conversion", "create", "effects", "farm", "farming", "feed", "food", "form", "human", "land"....
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicaloneapplicationappliedassociatedbeyondcommunicationcommunicationsconsolidationconsumercustomerdemanddesigndevelopmentdifferentdistinctestablishedexperiencedfieldgreater
SHARED TOKENS (39): "academic", "alone", "application", "applied", "associated", "beyond", "communication", "communications", "consolidation", "consumer", "customer", "demand", "design", "development", "different", "distinct", "established", "experienced", "field", "greater"....
0.300
accountadditionaladdressaveragecontroldifferentestablishedexemptgenerallygovernmentlegallocalmunicipalnationalnoiseprivatepublicregulationregulationsrestrictions
SHARED TOKENS (26): "account", "additional", "address", "average", "control", "different", "established", "exempt", "generally", "government", "legal", "local", "municipal", "national", "noise", "private", "public", "regulation", "regulations", "restrictions"....
0.300
applicationsappliescommonlycontrolcorporatedifferenteffectsequipmentoperatepeoplepersonnelproductiontechnicianstradework
SHARED TOKENS (15): "applications", "applies", "commonly", "control", "corporate", "different", "effects", "equipment", "operate", "people", "personnel", "production", "technicians", "trade", "work".
0.300
departmenteducationemployeeenforcementestablishingestablishmentexecutivefederalfinancialgovernmentindependentinformationlegallocalmattersnationalofficesoperationpermittingprevention
SHARED TOKENS (27): "department", "education", "employee", "enforcement", "establishing", "establishment", "executive", "federal", "financial", "government", "independent", "information", "legal", "local", "matters", "national", "offices", "operation", "permitting", "prevention"....
0.300
addressbuildingsconnectedcontrolleddistinctiondistinguisheffectseventindustrylargermakesmarketsmultiplepowerprocessingprofessionalpublicsinglesmallsupport
SHARED TOKENS (26): "address", "buildings", "connected", "controlled", "distinction", "distinguish", "effects", "event", "industry", "larger", "makes", "markets", "multiple", "power", "processing", "professional", "public", "single", "small", "support"....
0.300
acquisitionassociatedconnectionscontroldatadistributedfieldfunctionslargelargerpowerprocessprocessingsmallsystemsystemsthough
SHARED TOKENS (17): "acquisition", "associated", "connections", "control", "data", "distributed", "field", "functions", "large", "larger", "power", "process", "processing", "small", "system", "systems", "though".
0.300
businessbusinessescommercialconditionsgeneralgenerallyliabilitylinemarketoperationspolicypremisesprofessionalpropertypublicrisksseparatetypeunless
SHARED TOKENS (19): "business", "businesses", "commercial", "conditions", "general", "generally", "liability", "line", "market", "operations", "policy", "premises", "professional", "property", "public", "risks", "separate", "type", "unless".
0.300
aloneamongbasebusinessbusinesseschannelsclimateconnectcorecreatecurrentcustomersdefineseconomyexistingextendextensionfirmsfoodgovernment
SHARED TOKENS (41): "alone", "among", "base", "business", "businesses", "channels", "climate", "connect", "core", "create", "current", "customers", "defines", "economy", "existing", "extend", "extension", "firms", "food", "government"....
0.300
additionalapplicableapplyauthoritydemanddistrictgeneralgenerallygoodsgovernedidaholocalnationaloverviewproductsrequireretailrulessalesseller
SHARED TOKENS (26): "additional", "applicable", "apply", "authority", "demand", "district", "general", "generally", "goods", "governed", "idaho", "local", "national", "overview", "products", "require", "retail", "rules", "sales", "seller"....
0.300
Food industry ↗ Q540912 KW CROSS HIGH
academicactivitiesagriculturalagricultureanimalbecomebusinessesconsumersdescribesdevelopmentdirectlydistributiondominanteconomiceducationengineeringequipmentestablishmentsfarmfarming
SHARED TOKENS (64): "academic", "activities", "agricultural", "agriculture", "animal", "become", "businesses", "consumers", "describes", "development", "directly", "distribution", "dominant", "economic", "education", "engineering", "equipment", "establishments", "farm", "farming"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesappliesassetsbusinesscategoriescodecommercialconsumercreatedistrictemploymentestablishingfinancefinancialfoodformationframeworkgeneralgoodsgoverning
SHARED TOKENS (46): "activities", "applies", "assets", "business", "categories", "code", "commercial", "consumer", "create", "district", "employment", "establishing", "finance", "financial", "food", "formation", "framework", "general", "goods", "governing"....
0.300
administersagriculturalagricultureapproximatelycommercialcurrentdepartmentdirectlyexecutivefarmingfederalfoodgovernmentlargestlivestocknationalnutritionproductionprogramprograms
SHARED TOKENS (25): "administers", "agricultural", "agriculture", "approximately", "commercial", "current", "department", "directly", "executive", "farming", "federal", "food", "government", "largest", "livestock", "national", "nutrition", "production", "program", "programs"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesschaincommercialdataindustrylargestmanagementmarketingmobileplatformsprocessingproductsretailsegmentsupplysystemstransactiontype
SHARED TOKENS (19): "activities", "business", "chain", "commercial", "data", "industry", "largest", "management", "marketing", "mobile", "platforms", "processing", "products", "retail", "segment", "supply", "systems", "transaction", "type".
0.300
airbuildingbuildingscontrolcoolingcostsdesigndesignedelectricalheatingmaintenanceoperatingqualitysystemstechnologytemperaturewater
SHARED TOKENS (17): "air", "building", "buildings", "control", "cooling", "costs", "design", "designed", "electrical", "heating", "maintenance", "operating", "quality", "systems", "technology", "temperature", "water".
0.300
analysisbusinesschaincombinesdesigneducationengineeringequipmentfinancehumaninformationintegratedknowledgelaborlogisticsmanagementmaterialsoperationspeoplephysical
SHARED TOKENS (33): "analysis", "business", "chain", "combines", "design", "education", "engineering", "equipment", "finance", "human", "information", "integrated", "knowledge", "labor", "logistics", "management", "materials", "operations", "people", "physical"....
0.300
appliescomplycontaminationdescribesdisposalfacilitiesfoodindustrymaterialsmunicipalpowerprocessproduceproducedproductionregulationssanitaryspecializedsystemtreated
SHARED TOKENS (24): "applies", "comply", "contamination", "describes", "disposal", "facilities", "food", "industry", "materials", "municipal", "power", "process", "produce", "produced", "production", "regulations", "sanitary", "specialized", "system", "treated"....
0.300
activitiesairassociatedbroaderbusinesscategoriesdependencedevelopmentdistrictsfallsfrequentlygenerallygoodsgreatimpliesincreasesinvolvinglinkslocalnoise
SHARED TOKENS (31): "activities", "air", "associated", "broader", "business", "categories", "dependence", "development", "districts", "falls", "frequently", "generally", "goods", "great", "implies", "increases", "involving", "links", "local", "noise"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
agreementbrandbrandedbusinesscapitalchaincompetecomplyconditionscorporatedirecteconomiceffectexpansionexplicitlyfinancialinvestmentlargelegalliability
SHARED TOKENS (37): "agreement", "brand", "branded", "business", "capital", "chain", "compete", "comply", "conditions", "corporate", "direct", "economic", "effect", "expansion", "explicitly", "financial", "investment", "large", "legal", "liability"....
0.300
controlcontrolsdefinesexperienceidentificationinspectionjobknowledgelistsmaintainmajormanagementpersonnelphysicalprocessproductionqualityrecordsrelationshipsrequirements
SHARED TOKENS (23): "control", "controls", "defines", "experience", "identification", "inspection", "job", "knowledge", "lists", "maintain", "major", "management", "personnel", "physical", "process", "production", "quality", "records", "relationships", "requirements"....
0.300
Wholesaling ↗ Q220695 KW CROSS HIGH
businessbusinessescommercialconsumerconsumerscostsdirectlygeneralgoodsincreasinginstitutionalmarketmarketsorganizationproductsprofessionalpurchasingratherrelatedretailers
SHARED TOKENS (22): "business", "businesses", "commercial", "consumer", "consumers", "costs", "directly", "general", "goods", "increasing", "institutional", "market", "markets", "organization", "products", "professional", "purchasing", "rather", "related", "retailers"....
0.300
Ridesharing company ↗ KW CROSS HIGH
cannotcontractorscustomerdemandindependentissuedjurisdictionlegallylicensinglocalmobilemodeloperateoperationspricingregulationsrequirementsstreetsubjectsupply
SHARED TOKENS (22): "cannot", "contractors", "customer", "demand", "independent", "issued", "jurisdiction", "legally", "licensing", "local", "mobile", "model", "operate", "operations", "pricing", "regulations", "requirements", "street", "subject", "supply"....
0.300
addressapplicationsbuildingbuildingscombinecommercialcommonlycommunicationdistributionequipmentfacilitiesgenerallyhumanincreasesinstitutionallargemeansmultiplenamepublic
SHARED TOKENS (30): "address", "applications", "building", "buildings", "combine", "commercial", "commonly", "communication", "distribution", "equipment", "facilities", "generally", "human", "increases", "institutional", "large", "means", "multiple", "name", "public"....
0.300
businessfinancelocaloperatedoperatesoperationsorganizationownersprivateprogrampublicratherschoolsstatussubject
SHARED TOKENS (15): "business", "finance", "local", "operated", "operates", "operations", "organization", "owners", "private", "program", "public", "rather", "schools", "status", "subject".
0.300
Quinceañera ↗ EXACT TITLE
differenteventfoodnamespractices
SHARED TOKENS (5): "different", "event", "food", "names", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.300
addressamongappliedappliesauthorizationbecomebureaudifferentearlyeconomicemployersentryfallsformalfoundfunctionsgeneralissueslawlegal
SHARED TOKENS (35): "address", "among", "applied", "applies", "authorization", "become", "bureau", "different", "early", "economic", "employers", "entry", "falls", "formal", "found", "functions", "general", "issues", "law", "legal"....
0.300
businessbusinessescommercialcreatefamilyfirmsidentifiedinfluencemanagementmultipleorganizationownershiprelatedrelationshipstype
SHARED TOKENS (15): "business", "businesses", "commercial", "create", "family", "firms", "identified", "influence", "management", "multiple", "organization", "ownership", "related", "relationships", "type".
0.300
Marquee ↗ Q1621931 KW CROSS HIGH
buildingchainchannelcommonlycoveringgenerallyhtmllargemakesnetworkpageregionalsinglesmallstationstructuretemporarytype
SHARED TOKENS (18): "building", "chain", "channel", "commonly", "covering", "generally", "html", "large", "makes", "network", "page", "regional", "single", "small", "station", "structure", "temporary", "type".
🫐 BERRY61 edges
0.280
centraldistributionfacilityfoodgenerallygreaterhumanindustrylivestockmeatprocessprocessingproductionproducts
SHARED TOKENS (14): "central", "distribution", "facility", "food", "generally", "greater", "human", "industry", "livestock", "meat", "process", "processing", "production", "products".
0.280
idahonampaprivateuniversity
SHARED TOKENS (4): "idaho", "nampa", "private", "university". | EXACT TITLE in manufacturing_food_processing: "Northwest Nazarene University".
0.280
Vineyard ↗ Q22715 EXACT TITLE
characteristicspracticeproductiontable
SHARED TOKENS (4): "characteristics", "practice", "production", "table". | EXACT TITLE in wedding_events: "Vineyard".
0.280
Whey ↗ Q185009 EXACT TITLE
chaincommercialproductsuses
SHARED TOKENS (4): "chain", "commercial", "products", "uses". | EXACT TITLE in manufacturing_food_processing: "Whey".
0.280
Train station ↗ Q55488 KW CROSS HIGH
accommodatebuildingconnectionsfacilitygenerallylineloadingplatformrailrapidroomssalesstationsystems
SHARED TOKENS (14): "accommodate", "building", "connections", "facility", "generally", "line", "loading", "platform", "rail", "rapid", "rooms", "sales", "station", "systems".
0.260
Baker ↗ Q160131 EXACT TITLE
concentratedproductssource
SHARED TOKENS (3): "concentrated", "products", "source". | EXACT TITLE in wedding_events: "Baker". | EXACT TITLE in manufacturing_food_processing: "Baker".
0.260
floorinputmobile
SHARED TOKENS (3): "floor", "input", "mobile". | EXACT TITLE in wedding_events: "Dance floor".
0.260
beveragesconsumercostsgoodslimitedproductsretailerssalessmallsoldspacespecialtywarehouse
SHARED TOKENS (13): "beverages", "consumer", "costs", "goods", "limited", "products", "retailers", "sales", "small", "sold", "space", "specialty", "warehouse".
0.260
lawprivatework
SHARED TOKENS (3): "law", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.260
createfoodproduce
SHARED TOKENS (3): "create", "food", "produce". | EXACT TITLE in manufacturing_food_processing: "Food microbiology".
0.260
accountappliesapproximatelyauthorizationbeyondcommonlygeneralincreaseslawlegalrequirethoughuntil
SHARED TOKENS (13): "account", "applies", "approximately", "authorization", "beyond", "commonly", "general", "increases", "law", "legal", "require", "though", "until".
0.260
By-product ↗ Q1128255 KW CROSS HIGH
animalcommercialdisposaldistinctionfeedfoodhumanprimaryprocessproducedproductionproductswaste
SHARED TOKENS (13): "animal", "commercial", "disposal", "distinction", "feed", "food", "human", "primary", "process", "produced", "production", "products", "waste".
0.250
currentexecutivegovernmentidahooffice
SHARED TOKENS (5): "current", "executive", "government", "idaho", "office". | URL->A (1): https://sos.idaho.gov/.
0.240
appliedeveneventfamilyfoodformlinenameratherreceivingseparatewhose
SHARED TOKENS (12): "applied", "even", "event", "family", "food", "form", "line", "name", "rather", "receiving", "separate", "whose".
0.240
consumerscustomercustomersdedicatedexperienceformproductsprofessionalpurchasingreviewreviewssites
SHARED TOKENS (12): "consumers", "customer", "customers", "dedicated", "experience", "form", "products", "professional", "purchasing", "review", "reviews", "sites".
0.220
Interior design ↗ KW CROSS HIGH
buildingdesigndevelopmenthelpmanagementpeopleplanningresearchsitespacespaces
SHARED TOKENS (11): "building", "design", "development", "help", "management", "people", "planning", "research", "site", "space", "spaces".
0.220
associatedboisecentercontainsextendsidaholargestmetropolitansouthwesterntribalvalley
SHARED TOKENS (11): "associated", "boise", "center", "contains", "extends", "idaho", "largest", "metropolitan", "southwestern", "tribal", "valley".
0.220
coldstorage
SHARED TOKENS (2): "cold", "storage". | EXACT TITLE in manufacturing_food_processing: "Cold storage".
0.220
Calligraphy ↗ Q12681 KW CROSS HIGH
designeastformincorporatesmovingpracticerelatedsignsthoughtypewestern
SHARED TOKENS (11): "design", "east", "form", "incorporates", "moving", "practice", "related", "signs", "though", "type", "western".
0.220
aircommonlyconditionscontrolleddusteffectsmaterialproducerapidrolesafely
SHARED TOKENS (11): "air", "commonly", "conditions", "controlled", "dust", "effects", "material", "produce", "rapid", "role", "safely".
0.220
conditionseducationenforcementengineeringfireknowledgepracticespreventionsafelysurroundingthem
SHARED TOKENS (11): "conditions", "education", "enforcement", "engineering", "fire", "knowledge", "practices", "prevention", "safely", "surrounding", "them".
0.220
activitiesdifferentfederalgenerallyhazardslocalmanagementpreventionprofessionalrequiresrisk
SHARED TOKENS (11): "activities", "different", "federal", "generally", "hazards", "local", "management", "prevention", "professional", "requires", "risk".
0.220
soldwater
SHARED TOKENS (2): "sold", "water". | EXACT TITLE in manufacturing_food_processing: "Frozen dessert".
0.220
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingbusinesseseconomicgovernmenthousinginfrastructurelandprivateprocesspublicspaces
SHARED TOKENS (11): "addressing", "businesses", "economic", "government", "housing", "infrastructure", "land", "private", "process", "public", "spaces".
0.220
logisticsoperations
SHARED TOKENS (2): "logistics", "operations". | EXACT TITLE in manufacturing_food_processing: "Packaging Corporation of America".
0.220
Photo booth ↗ Q494312 EXACT TITLE
boothscontains
SHARED TOKENS (2): "booths", "contains". | EXACT TITLE in wedding_events: "Photo booth".
0.220
Review site ↗ Q1340449 KW CROSS HIGH
businesseschannelcomearlypeopleproductsprofessionalreviewreviewssitesites
SHARED TOKENS (11): "businesses", "channel", "com", "early", "people", "products", "professional", "review", "reviews", "site", "sites".
0.210
Decoration ↗ Q1232942 EXACT TITLE
room
SHARED TOKENS (1): "room". | EXACT TITLE in wedding_events: "Decoration".
0.210
Fairground ↗ Q5430425 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in wedding_events: "Fairground".
0.210
Bel Group ↗ Q491034 EXACT TITLE
group
SHARED TOKENS (1): "group". | EXACT TITLE in manufacturing_food_processing: "Bel Group".
0.200
analysisconventionaldeterminequalityratherseparatetreatmenttypewastewaterwater
SHARED TOKENS (10): "analysis", "conventional", "determine", "quality", "rather", "separate", "treatment", "type", "wastewater", "water".
0.200
estategovernmentmaintainsofficeownershippersonspropertypublicrealrecords
SHARED TOKENS (10): "estate", "government", "maintains", "office", "ownership", "persons", "property", "public", "real", "records".
0.200
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargelargermakesproducesproductionpropertywineries
SHARED TOKENS (10): "building", "business", "equipment", "large", "larger", "makes", "produces", "production", "property", "wineries".
0.200
beveragecategoryestateeventfoodindustryparksplanningrealrestaurants
SHARED TOKENS (10): "beverage", "category", "estate", "event", "food", "industry", "parks", "planning", "real", "restaurants".
0.200
Indemnity ↗ Q708399 KW CROSS HIGH
contractcontractsdifferentformlawlimitedoperationprincipalrelationshiprelevant
SHARED TOKENS (10): "contract", "contracts", "different", "form", "law", "limited", "operation", "principal", "relationship", "relevant".
0.200
directequipmentidentifyinglawmaintenancepowerrequiressafesafetywork
SHARED TOKENS (10): "direct", "equipment", "identifying", "law", "maintenance", "power", "requires", "safe", "safety", "work".
0.200
activitiesbusinessdefinesgovernmenthomelimitedorganizationoutsidepeopleprimary
SHARED TOKENS (10): "activities", "business", "defines", "government", "home", "limited", "organization", "outside", "people", "primary".
0.180
boisebuildingfeetidahonationalopenedpacificstationunion
SHARED TOKENS (9): "boise", "building", "feet", "idaho", "national", "opened", "pacific", "station", "union".
0.180
analysisdetermineestablishfireinvestigationknowledgerequiresecondstages
SHARED TOKENS (9): "analysis", "determine", "establish", "fire", "investigation", "knowledge", "require", "second", "stages".
0.180
familygenerallylaworganizationoutsidepublicpubliclyrestaurantsthough
SHARED TOKENS (9): "family", "generally", "law", "organization", "outside", "public", "publicly", "restaurants", "though".
0.160
agreementlicensedlicensinglimitedownersseparateuseswork
SHARED TOKENS (8): "agreement", "licensed", "licensing", "limited", "owners", "separate", "uses", "work".
0.160
Natural food ↗ Q6980681 KW CROSS HIGH
assumedfoodgenerallylabelsmarketingprocessingregulatedregulation
SHARED TOKENS (8): "assumed", "food", "generally", "labels", "marketing", "processing", "regulated", "regulation".
0.160
characteristicsdesignlargematerialshippingsourcetypeuntil
SHARED TOKENS (8): "characteristics", "design", "large", "material", "shipping", "source", "type", "until".
0.160
Crowd control ↗ Q1872073 KW CROSS HIGH
controlinvolvinglargemanagementpeoplepracticepublicstreet
SHARED TOKENS (8): "control", "involving", "large", "management", "people", "practice", "public", "street".
0.140
Mobile catering ↗ KW CROSS HIGH
businesscommonlycorporatefoodmobilepeopleretail
SHARED TOKENS (7): "business", "commonly", "corporate", "food", "mobile", "people", "retail".
0.140
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesignedlargepeopleroutesstudentsuniversity
SHARED TOKENS (7): "applications", "designed", "large", "people", "routes", "students", "university".
0.140
applicableauthorizesdistrictlandpermituseszoning
SHARED TOKENS (7): "applicable", "authorizes", "district", "land", "permit", "uses", "zoning".
0.140
Hairstyle ↗ Q327496 KW CROSS HIGH
frequentlyhomehumaninfluenceoutsidepracticalthough
SHARED TOKENS (7): "frequently", "home", "human", "influence", "outside", "practical", "though".
0.140
appliedbuildingsfoundperiodratherrelationshipsecond
SHARED TOKENS (7): "applied", "buildings", "found", "period", "rather", "relationship", "second".
0.140
Equestrianism ↗ KW CROSS HIGH
activitiescommonlydescriptionpracticaltransportationwelfarework
SHARED TOKENS (7): "activities", "commonly", "description", "practical", "transportation", "welfare", "work".
0.120
Wedding cake ↗ Q558133 KW CROSS HIGH
evenrealservedsharesinglewestern
SHARED TOKENS (6): "even", "real", "served", "share", "single", "western".
0.120
additionalbrandchaindevelopmentpipelinerooms
SHARED TOKENS (6): "additional", "brand", "chain", "development", "pipeline", "rooms".
0.120
brandsoperatesplanningplatformsportfoliotechnology
SHARED TOKENS (6): "brands", "operates", "planning", "platforms", "portfolio", "technology".
0.120
activitiesdifferentdocumentofficialspecialtythroughout
SHARED TOKENS (6): "activities", "different", "document", "official", "specialty", "throughout".
0.100
Agritourism ↗ Q1956672 KW CROSS HIGH
activityagriculturefarminvolvingoperation
SHARED TOKENS (5): "activity", "agriculture", "farm", "involving", "operation".
0.100
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainownedpipelinerooms
SHARED TOKENS (5): "business", "chain", "owned", "pipeline", "rooms".
0.100
governmentissuedlawlocalmunicipality
SHARED TOKENS (5): "government", "issued", "law", "local", "municipality".
0.100
certificationjobprofessionalpublictrade
SHARED TOKENS (5): "certification", "job", "professional", "public", "trade".
0.100
J. R. Simplot ↗ Q326178 KW CROSS HIGH
agriculturalboiseestimatedidahoproducts
SHARED TOKENS (5): "agricultural", "boise", "estimated", "idaho", "products".
0.100
beveragebeveragescategoriescontrolgenerally
SHARED TOKENS (5): "beverage", "beverages", "categories", "control", "generally".
0.100
boisehomeidaholargestmetropolitan
SHARED TOKENS (5): "boise", "home", "idaho", "largest", "metropolitan".
◈ Frequently Asked Questions
Wedding Events × Manufacturing Food Processing — Treasure Valley
HAIKU · HIGH GATE
What food safety requirements must catering companies in Boise follow when preparing meals for wedding events?
Catering operations in Boise must comply with Ada County health department food safety protocols that match standards applied to manufacturing food processing facilities. The University of Idaho Extension and Boise State University both provide guidance on temperature control, cross-contamination prevention, and sanitation procedures for events held in the Treasure Valley.
How do Boise wedding venues secure business licenses when they also operate kitchen facilities for food preparation?
Wedding event venues in Boise that include commercial kitchens must obtain separate business licenses from Ada County that specify food service operations, treating the kitchen space under the same zoning and health department oversight as dedicated manufacturing food processing locations. The City of Boise planning department reviews both the event operations and the permanent food production capacity before approval.
What role do Treasure Valley warehouses play in supplying ingredients for both catering and food manufacturing businesses?
Warehouses in the Boise metropolitan area serve as distribution hubs for raw materials destined for wedding catering operations and manufacturing food processing facilities, with logistics coordinated through Boise Airport and local transportation networks. Ada County zoning regulations require these warehouses to maintain separate storage zones for products intended for direct public consumption at events versus industrial-scale processing.
How do fire safety codes differ between wedding event kitchens and food manufacturing facilities in the Treasure Valley?
Fire safety requirements in Boise apply uniformly to commercial kitchens whether they operate for occasional wedding events or continuous manufacturing food processing, with inspections conducted by the city's fire department and Ada County health authorities. College of Western Idaho offers training on suppression systems and emergency protocols required in both settings across the Treasure Valley.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Wedding Events × Manufacturing Food Processing 32 QID bridges 304 edges 7,914 ext links 2026-07-18 00:11:28 UTC 4b25c773b76c3234
Wedding Events corridor ↗ Manufacturing Food Processing corridor ↗ Manufacturing Food Processing × Wedding Events ↗ boisestandard.org/standard ↗
Parent Corridors
Wedding Events × All Other Verticals