—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Wedding Events ↔ relates to ↔ Childcare Family

23 Wikipedia bridge articles confirmed in both vertical ledgers. 293 deterministic cross-vertical edges. 7,662 external source links harvested. Every edge provenance-stamped. Every claim auditable.

23 QID Bridge Articles
293 Cross Edges
7,662 External Sources
341 Wikipedia Articles
24 🌲 Evergreen
209 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Wedding Events
× Childcare Family
QID Bridge Articles
23
confirmed Wikipedia overlap
Total Cross Edges
293
External Sources Harvested
7,662
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise metropolitan area
score: 1.0000  ·  type: exact_title_cross  ·  15 shared tokens
QID Bridge Titles (20)
Boise metropolitan areaBoise, IdahoFire safetyContinuing educationBoise State UniversityFranchisingCollege of Western IdahoNonprofit organizationTreasure ValleyFire preventionHistoric preservationSpecial-use permitAdministrative lawOnline marketplaceApprenticeshipBuilding codeAda County, IdahoNampa, IdahoMeridian, IdahoCustomer review
Shared Semantics (20 tokens)
boiseidahopopulationadacanyoncollegeeducationpublicproductshomenampatreasurevalleycapitaldivisionlocalcitiescountiesmeridianestimated
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-18 00:09:04 UTC
Content Hash
2e69231efdfe0bd2
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
23 BRIDGES
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in wedding_events (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (15): "ada", "boise", "canyon", "cities", "combined", "counties", "home", "idaho", "larger", "meridian", "nampa", "percent", "population", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise metropolitan area".
adaboisecanyoncitiescombinedcountieshomeidaholargermeridiannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in wedding_events (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (19): "ada", "annual", "block", "boise", "capital", "counties", "employers", "estimated", "feet", "home", "idaho", "level", "major", "north", "population", "river", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualblockboisecapitalcountiesemployersestimatedfeethomeidaholevelmajornorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Fire safety
Q2997557 EXACT TITLE 1.000
QID OVERLAP: Q2997557 in wedding_events (tier:evergreen) and childcare_family (tier:branch). | SHARED TOKENS (16): "building", "buildings", "codes", "department", "division", "fire", "increases", "inspections", "intended", "occurs", "practices", "prevention", "results", "safety", "schools", "structures". | EXACT TITLE in wedding_events: "Fire safety".
buildingbuildingscodesdepartmentdivisionfireincreasesinspectionsintendedoccurspracticespreventionresultssafetyschoolsstructures
nded to prevent the ignition of an uncontrolled fire and those that are used to limit the spread and impact of a fire. Fire safety measures include those that are planned during the construction of a building or implemented in structures that are already standing and those that are taught or provided to occupants of the building. Threats to fire safety are commonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
e safety measures include those that are planned during the construction of a building or implemented in structures that are already standing and those that are taught or provided to occupants of the building. Threats to fire safety are commonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
ommonly referred to as fire hazards. A fire hazard may include a situation that increases the likelihood of a fire or may impede escape in the event a fire occurs. Fire safety is often a component of building safety. Those who inspect buildings for violations of the fire codes, and visit schools to educate children on fire safety topics, are fire department members known as Fire Prevention Officers.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in wedding_events (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (37): "activities", "age", "agencies", "beyond", "college", "continuing", "curriculum", "development", "different", "division", "due", "economic", "education", "formal", "frequently", "general", "institutional", "intended", "learning", "least".... | EXACT TITLE in wedding_events: "Continuing education". | EXACT TITLE in childcare_family: "Continuing education".
activitiesageagenciesbeyondcollegecontinuingcurriculumdevelopmentdifferentdivisiondueeconomiceducationformalfrequentlygeneralinstitutionalintendedlearningleastoperationpartnershipspersonalprofessionalprogramsprovisionratherrevenueschoolseparate+7
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
n". Georgetown University, Michigan State University, and the University of Denver have benefited from non-credit programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in wedding_events (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "church", "college", "division", "education", "engineering", "health", "idaho", "independent", "program", "programs", "public", "reported", "research", "school", "universities", "university". | EXACT TITLE in wedding_events: "Boise State University". | EXACT TITLE in childcare_family: "Boise State University".
activityamongboisebusinesschurchcollegedivisioneducationengineeringhealthidahoindependentprogramprogramspublicreportedresearchschooluniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Franchising
Q171947 EXACT TITLE 1.000
QID OVERLAP: Q171947 in wedding_events (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (35): "brand", "branded", "business", "capital", "chain", "comply", "conditions", "corporate", "direct", "economic", "expansion", "explicitly", "financial", "franchise", "growth", "individual", "intellectual", "investment", "legal", "licenses".... | EXACT TITLE in childcare_family: "Franchising".
brandbrandedbusinesscapitalchaincomplyconditionscorporatedirecteconomicexpansionexplicitlyfinancialfranchisegrowthindividualintellectualinvestmentlegallicenseslicensingmarketmodelobligationsownedpracticeproductspropertyresearchrights+5
ice where a company licenses its business model to another company. It can involve the franchisor licensing some or part of its knowhow, procedures, intellectual property and other rights to sell its branded products and services to a franchisee. In return, the franchisee pays certain fees and agrees to comply with certain obligations, typically set out in a franchise agreement. For the franchisor, use of a franchise system is an alternative business growth strategy, compared to expansion through corporate owned outlets or "chain stores". Adopting a franchise system is a business growth strategy that minimizes the franchisor's capital investment and liability risk. Franchising is rarely an equal partnership, especially in the typical arrangement where the franchisee is an individual, unincorporated partnership or small privately-held corporation, as this ensures the franchisor has substantial legal and/or economic advantages over the franchisee. The usual exception to this rule is when the prospective franchisee is also a powerful corporate entity controlling a highly lucrative location, and/or captive market. For example, a large sports stadium for which prospective franchisors must compete to exclude one another.
Rationale and risk shift Franchising is one of the few means available to access venture capital without the need to give up control of the operation of the chain and build a distribution system for servicing it. After the brand and formula are carefully designed and properly executed, franchisors are able to sell franchises and expand rapidly across countries and continents using the capital and resources of their franchisees while reducing their own risk. There is also risk for the people buying the franchises. However, failure rates are much lower for franchise businesses than independent business startups. Franchisor rules imposed by the franchising authority are becoming increasingly strict.
Advantages and disadvantages of franchising as an entry mode Franchising brings with it several advantages and disadvantages for firms looking to expand into new areas and foreign markets. The primary advantage is that the firm does not have to bear the development cost and risks of opening a foreign market on its own, as the franchisee is typically responsible for those costs and risks, putting the onus on them to build a profitable operation as quickly as possible. Through franchising, a firm has the potential of building a global presence quickly and also at a low cost and risk. For the franchisee, the primary advantages are access to a well-known brand, support in setting up the business using operating manuals, and ongoing operational support including access to suppliers and employee training. A primary disadvantage to franchising from the franchisor’s viewpoint is quality control, as the franchisor wants the firm's brand name to convey a message to consumers about the quality and consistency of the firm's product. They want the consumer to experience the same quality regardless of location or franchise status. This can prove to be an issue with franchising, as a customer who had a bad experience at one franchise may assume that they will have the same experience at other locations with other services. Distance can make it difficult for firms to detect whether or not the franchises are of poor quality. One way around this disadvantage is to set up extra subsidiaries in each country or state in which the firm expands.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in wedding_events (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (30): "ada", "boise", "campus", "canyon", "college", "community", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "reported".... | EXACT TITLE in wedding_events: "College of Western Idaho". | EXACT TITLE in childcare_family: "College of Western Idaho".
adaboisecampuscanyoncollegecommunitycomprehensivecountiescwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicreportedresidentsservedsouthweststudentsthroughouttransfertreasurevalleywesternworkforce
ommunity colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
N
Q163740 EXACT TITLE 1.000
QID OVERLAP: Q163740 in wedding_events (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (23): "business", "clubs", "community", "entities", "finance", "local", "mission", "nonprofit", "operated", "operates", "operations", "organization", "owners", "private", "program", "public", "rather", "receive", "revenue", "schools".... | EXACT TITLE in childcare_family: "Nonprofit organization".
businessclubscommunityentitiesfinancelocalmissionnonprofitoperatedoperatesoperationsorganizationownersprivateprogrampublicratherreceiverevenueschoolssocialstatussubject
A nonprofit organization (NPO), also known as a nonbusiness entity, nonprofit institution, not-for-profit organization (NFPO), or simply nonprofit, is a non-governmental entity that operates for a collective, public, or social benefit, rather than to generate profit for private owners. Nonprofit organizations are subject to a non-distribution constraint, meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
meaning that any revenue exceeding expenses must be used to further the organization’s purpose. Depending on local laws, nonprofits may include charities, political organizations, schools, hospitals, business associations, churches, foundations, social clubs, and cooperatives. In some countries nonprofit entities can obtain tax-exempt status and may also qualify to receive tax-deductible contributions; however, an organization can still be a nonprofit without having tax exemption. Key aspects of nonprofit organizations are their ability to fulfill their mission with respect to accountability, integrity, trustworthiness, honesty, and openness to every person who has invested time, money, and faith into the organization. Nonprofit organizations are accountable to the donors, founders, volunteers, program recipients, and the public community. Theoretically, for a nonprofit that seeks to finance its operations through donations, public confidence is a factor in the amount of money that a nonprofit organization is able to raise. Presumably, the more a nonprofit focuses on their mission, the more public confidence they will gain.
Management Most nonprofits have staff that work for the organization, possibly using volunteers to perform the nonprofit's services under the direction of the paid staff. Nonprofits must be careful to balance the salaries paid to staff against the money paid to provide services to the nonprofit's beneficiaries. Organizations whose salary expenses are too high relative to their program expenses may face regulatory scrutiny. Some have the misconception that nonprofit organizations may not make a profit. Although the goal of nonprofits is not specifically to maximize profits, they still have to operate as a fiscally responsible business. They must manage their income (grants, donations, and income from services) and expenses so as to remain a fiscally viable entity. Nonprofits have the responsibility of focusing on being professional and financially responsible, replacing self-interest and profit motive with mission motive. Though nonprofits are managed differently from for-profit businesses, they have felt pressure to be more businesslike. To combat private and public business growth in the public service industry, some nonprofits have modeled their business management and mission, shifting their reason of existing to establish sustainability and growth. Setting effective missions is a key for the successful management of nonprofit organizations. There are three important conditions for effective mission: opportunity, competence, and commitment. One way of managing the sustainability of nonprofit organizations is to establish strong relations with donor groups. This requires a donor marketing strategy, something many nonprofits lack. Nonprofit organizations need to motivate staff, maintain and communicate a vision, set a strategic direction, manage change effectively, and provide a safe working environment for employees, volunteers, and visitors.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in wedding_events (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "historically", "idaho", "land", "local", "lower", "region", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in wedding_events: "Treasure Valley". | EXACT TITLE in childcare_family: "Treasure Valley".
associationboisehistoricallyidaholandlocallowerregionresourcesriverruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
F
Q5451640 EXACT TITLE 0.920
QID OVERLAP: Q5451640 in wedding_events (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (11): "conditions", "education", "enforcement", "engineering", "fire", "knowledge", "practices", "prevention", "response", "surrounding", "them". | EXACT TITLE in childcare_family: "Fire prevention".
conditionseducationenforcementengineeringfireknowledgepracticespreventionresponsesurroundingthem
based emergencies and minimize the damage caused to the surrounding environment by them. There are two priority focuses of fire prevention: eliminating the factors that cause them, or controlling the conditions at which a fire can be born. These methods aim to significantly reduce the frequency or extremity of a fire. The prevention of fires relies heavily on Fire education as knowledge is a fundamental component to executing fire preventing/ controlling measures safely and effectively. Key aspects of fire prevention: Education/practices, Engineering, Enforcement, and Emergency Response.
Reduction of false alarms Much of fire prevention education also involves advice on how to reduce false alarms. False alarms have the potential to waste manpower and resources, which may be needed desperately during a real emergency. In addition, firefighters responding to calls in fire engines are at increased risk of traffic collisions when driving under emergency conditions. In 2008 the state of New York found that 18% of firefighter deaths in the line of duty had occurred whilst responding to calls. Stop, drop and roll Stop, drop and roll is the most taught part of fire protection education efforts as it is both a simple technique and an effective way of extinguishing burning clothing.
Hoarders Hoarding is the disorder in which a person or group of people have a difficulty throwing away things they no longer need or parting away with any kind of possession because they believe that they will need to save them for something. Hoarding can range from mild cases that may not have a very heavy impact on a person’s life to severe cases where the daily function of the person is hindered by their actions Hoarding becomes a great fire hazard in severe cases because of the number of items that may pile up. Often the homes of hoarders will block exits that provide a means of escape for the occupants. Firefighters that are responding to an emergency in the home of hoarders may not be able to get to the occupants as quickly because they are obstructed from entering the building. Because of the increased fire load a hoarding environment creates, those who live in occupancies in close proximity may be affected because of amplified smoke and fire conditions. Smokers According to the world health organization consensus there are around 1.3 billion smokers worldwide, 80 percent of those smokers are identified as those that live in low income area and middle income areas. While smoking is a commonly accepted thing that many people do in their daily lives out in public or in their own home it is important for those that smoke to know the fire risk they present. Approximately 500 smokers as well as nonsmokers are killed in fires that start because of improperly discarded cigarettes and ashes. Fires caused by smoking are the most preventable of all. Most fires that involve smoking start inside the home, when a smoker does not properly dispose of their ashes or cigarette butts, they can fall into things such as couches and chairs which quickly ignite. Smokers who discard their cigarettes and ashes in the trash can start fires that lead to other collateral damage.
Historic preservation
Q914856 EXACT TITLE 0.880
QID OVERLAP: Q914856 in wedding_events (tier:evergreen) and childcare_family (tier:evergreen). | SHARED TOKENS (9): "buildings", "built", "cities", "development", "historic", "landscapes", "maintains", "preservation", "products". | EXACT TITLE in wedding_events: "Historic preservation". | EXACT TITLE in childcare_family: "Historic preservation".
buildingsbuiltcitiesdevelopmenthistoriclandscapesmaintainspreservationproducts
Historic preservation (US), built heritage preservation or built heritage conservation (UK) is an endeavor that seeks to preserve, conserve and protect buildings, objects, landscapes or other artifacts of historical significance. It is a philosophical concept that became popular in the twentieth century, which maintains that cities as products of centuries' development should be obligated to protect their patrimonial legacy.
In 1790, Aubin-Louis Millin submitted a report to the Constituent Assembly regarding the demolition of the Bastille, using the term "monument historique" (transl. historic monument). The idea of preserving sites linked to the Ancien régime and earlier circulated as a result, and under impetus of Talleyrand, the Assembly, on the 13th of October, created the commission des monuments (transl. Commission of Monuments) whose function was to "study the fate of monuments, arts, and sciences." The following year, Alexandre Lenoir was appointed to create the Musée des Monuments français (transl. Museum of French Monuments), which opened in 1795 and exhibited fragments of architecture Lenoir had saved and salvaged from destruction over the previous years. The museum was ultimately closed during the Restoration by Louis XVIII, and its collection was returned to the original owners and their families. The vandalism and widespread destruction which accompanied the French Revolution had inspired several such responses, and the first known register of such buildings was an inventory of the castles begun by Louis XVI by the conseil des bâtiments civils (transl. Council of Civil Buildings), which was completed in 1795. Between 1804 and 1834, several archaeological societies were formed, notably the Société des antiquaires de France in 1804 (originally the Académie celtique), the Société française d'archéologie in 1834, and the Comité des travaux historiques et scientifiques also in 1834. In 1819, the Ministry of the Interior provided an allowance for monuments historiques for the first time, and, on 21 October 1830, François Guizot (then Minister of the Interior) proposed the creation of a post, the Inspector General of Historic Monuments, to classify buildings and distribute funds for their preservation. This post was first assigned to Ludovic Vitet on 25 November 1830, and later to Prosper Mérimée on 27 May 1834. In 1837, Bachasson, in his capacity of Minister of the Interior, officially established the Commission des monuments historiques (transl. Commission for Historic Monuments) to carry out the work of classification and producing an inventory, as well as distributing funding and training architects for restoration work (Eugène Viollet-le-Duc among them). The Commission published its first inventory in 1840, and subsequently continued its inventory work, as well as create visual records for any future restoration. To this end, it created the Mission Héliographique to photograph monuments in 1851. During this period, the combination of reluctance to understand the government's prerogatives and the fact that the classification of private property required the owners' consent resulted in the gradual decrease in the number of registered monuments. On 2 May 1887, a law was passed establishing procedures for the classification of historic monuments as well as establish provisions for a body of Architecte en chef des monuments historiques for their upkeep. In 1906, French law laid down principles of classification of natural sites. Under the 1905 Law of Separation of Church and State, local communities and the government were entrusted with the care and upkeep of religious buildings, however, this led to refusal to care for buildings not of "national interest" by some and the auctioning off of heritage by others. Per consequence, on 13 December 1913, a law was passed which widened the field of protection for classified monuments, including changing "national interest" to "public interest" and allowing the classification of private property without the consent of the owner. During the 1920s and 1930s, classification further opened up to private property; additionally, monuments post-dating the Ancien régime began to be classified. In 1925, a second order of classification was introduced: inscription à l'inventaire supplémentaire des monuments historiques (transl. inscription in the supplementary inventory of historical monuments). In 1930, the classifications were renamed "classé" and "inscrit" (transl. "classified" and "registered") and classification was allowed to include the land immediately surrounding a classified building.
By the mid 19th century, much of Britain's unprotected cultural heritage was being slowly destroyed. Even well-meaning archaeologists like William Greenwell excavated sites with virtually no attempt at their preservation, Stonehenge came under increasing threat by the 1870s. Tourists were chipping off parts of the stones or carving their initials into the rock. The private owners of the monument decided to sell the land to the London and South-Western Railway who stated that the monument was "not the slightest use to anyone now". John Lubbock, an MP and botanist emerged as the champion of the country's national heritage. In 1872 he personally bought private land that housed ancient monuments in Avebury, Silbury Hill and elsewhere, from the owners who were threatening to have them cleared away to make room for housing. Soon, he began campaigning in Parliament for legislation to protect monuments from destruction. This finally led to the legislative milestone under the Liberal government of William Gladstone of the Ancient Monuments Protection Act 1882. The first government appointed inspector for this job was the archaeologist Augustus Pitt-Rivers. This legislation was regarded by conservative political elements as a grave assault on the individual rights of property of the owner, and consequently, the inspector only had the power to identify endangered landmarks and offer to purchase them from the owner with his consent. The Act only covered ancient monuments and explicitly did not cover historic buildings or structures. In 1877 the Society for the Protection of Ancient Buildings was founded by the Arts and Crafts designer William Morris to prevent the destruction of historic buildings, followed by the National Trust in 1895 that bought estates from their owners for preservation. The Ancient Monuments Protection Act 1882 had only given legal protection to prehistoric sites, such as ancient tumuli. The Ancient Monuments Protection Act 1900 took this further by empowering the government's Commissioners of Work and local County Councils to protect a wider range of properties.
S
Q7574442 EXACT TITLE 0.840
QID OVERLAP: Q7574442 in wedding_events (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (7): "applicable", "authorizes", "district", "land", "permit", "uses", "zoning". | EXACT TITLE in childcare_family: "Special-use permit".
applicableauthorizesdistrictlandpermituseszoning
A special-use permit authorizes land uses that are allowed and encouraged by the ordinance and declared harmonious with the applicable zoning district. Purpose Land use is governed by a set of regulations generally known as ordinances or municipal codes, which are authorized by the state's zoning enabling law. Within an ordinance is a list of land use designations commonly known as zoning. Each different type of zone has its own set of allowed uses. These are known as by-right uses. Then there is an extra set of uses known as special uses. To build a use that is listed as a special use, a special-use permit (or conditional-use permit) must be obtained. An example of a special-use permit may be found in a church applying for one to construct a church building in a residential neighborhood. Although the church building is not a residential building, the zoning law may allow for churches in the residential neighborhood if the local zoning authority may review the impact on the neighborhood.
Abuse If the local zoning authority grants a special-use permit that exceeds the discretion allowed to it, then an incidence of spot zoning may arise. Such discretion then may be attacked as ultra vires, and the special-use permit overturned as an unconstitutional violation of equal protection. Special-use permits are also required when a property has been deemed a "nonconforming use." A permit for a nonconforming use will allow the owner of a previously-compliant property to continue the existing use. This often arises when a property has been rezoned or amortized. Amortization is unconstitutional in many states, and is a controversial tool according to many property rights advocacy groups. An example of special-use-permit abuse may be found when a business or other organization is using U.S. Forest Service land for commercial use. Special-use permits may be revoked after the initial period if it is deemed to have not met the proposed public need. This then allows for another operator to apply for the special-use permit which will be evaluated on whether they are likely to succeed and meet the public need as well as follow all other criteria such as proper resource management and respectful public use.
Other uses Special land-use permits are also issued by the U.S. Forest Service for the operation of ski areas and other recreational facilities in national forests. These facilities are operated by commercial providers who help the public in a way that would not otherwise be helped by the U.S. Forest Service. The U.S. Forest Service does not run the facility itself and is not the one providing the benefits that the commercial business provides. Special-use permits have also been issued for other purposes, such as in Alaska during the summer of 2015, when special fishing permits were issued to feed firefighters who had difficulty receiving supplies via land routes due to the forest fires that they were fighting in remote areas. In broadcasting, a restricted service licence (UK) or special temporary authority (US) may be issued by a broadcasting authority for temporary changes or set-ups for a radio station or television station.
A
Q171251 QID OVERLAP 0.800
QID OVERLAP: Q171251 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (34): "activities", "activity", "administration", "administrative", "agencies", "built", "changes", "considered", "control", "coordinate", "courts", "created", "division", "economic", "education", "enforcement", "executive", "expanded", "generally", "governing"....
activitiesactivityadministrationadministrativeagenciesbuiltchangesconsideredcontrolcoordinatecourtscreateddivisioneconomiceducationenforcementexecutiveexpandedgenerallygoverningincreaseinfluenceitselflawlegalmodelopenedpublicreviewrules+4
Administrative law is a division of law governing the activities of executive branch agencies of government. Administrative law includes executive branch rulemaking (executive branch rules are generally referred to as "regulations"), adjudication, and the enforcement of laws.
Scope of administrative law German legal scholarship does not have an agreed-upon definition for public administration. In one sense, administration – more precisely, everything that is subject to administrative law – is conceptualized as being all state activity of a certain type (material definition of public administration). This approach leads to disputes about whether to treat acts of public authority as acts of administration (and therefore executive) even when they are performed by component parts of the state (that is to say, the government) that the law formally classifies as a legislative or a judicial body: For instance, the parliament may impose a fine on one of its members for misbehavior, or a presiding judge may direct a disruptive member of the public to be removed from the viewing gallery. The opposite approach – the formalist definition of public administration – begins its examination by considering all those public authorities intended (judging by their lawful charter, organizational context, internal structure, and performed tasks) to do the work of public administration, and equates their functioning with public administration. There is some danger of circular reasoning, since the formal categorization of the organizational unit may, in turn, derive from some material conception of its function. Some functions that might, in the material view, be seen as not of the executive type, and thus not as belonging to the field of administration (such as the creation of rules with the force of law, which are usually thought of as legislative), would then be held to the standards of administrative law, and not another field of law. This discussion is of seen as being of particular importance when considering the role of administrative law in maintaining the division of government powers. For this purpose, a traditional approach tries negatively to define administration by subtracting those operations of the state which cannot be called administration, namely law-making and adjudication. Using this negative definition, though, requires law-making and adjudication to be defined first, and leaves some activities that are a poor fit for the term "administration", such as the cabinet government's political leadership decisions, within the bounds of the definition. Positive definitions abound, but none has won out over the others, or been entirely convincing to scholars of German administrative law. Nevertheless, certain features may be seen as being characteristic of administration: According to Maurer and Waldhoff, administration is social engineering (exerting influence on the non-state, societal domain) (1), oriented towards some conception of the (ever-changing) public interest (2), that consists of taking action in the present, with a view to engineering the future (3), and that comprises concrete measures to regulate individual cases and to realize particular plans (4). Scholarly treatises of German administrative law are almost always split into two parts: doctrines and rules that can be found across-the-board (allgemeines Verwaltungsrecht); and doctrines and rules that exist only in certain parts of administrative law (German: besonderes Verwaltungsrecht, lit. 'special administrative law') – e.g.
Judicial application The law governing the adjudication of questions of administrative law before the courts of general administrative jurisdiction (German: Verwaltungsgerichte) is the Code on Administrative Courts (German: Verwaltungsgerichtsordnung, abbreviated VwGO), which was enacted in 1960. Though the VwGO was not conceived as a full codification of court process for the courts of general administrative jurisdiction, and VwGO § 173 directs these courts to apply Germany's Code of Civil Procedure wherever the VwGO lacks special rules, proceedings before the courts of general administrative jurisdiction are mostly distinct from civil proceedings before the courts of general jurisdiction. The VwGO also does not apply to the courts of special administrative jurisdiction over tax disputes (German: Finanzgerichte) or over social benefits disputes (German: Sozialgerichte). Italy In Italy, administrative law is known as Diritto amministrativo, a branch of public law whose rules govern the organization of the public administration and the activities of the pursuit of the public interest of the public administration and the relationship between this and the citizens. Its genesis is related to the principle of division of powers of the State.
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (16): "availability", "consumer", "fee", "general", "information", "multiple", "needs", "operator", "primary", "process", "products", "providers", "segment", "single", "site", "type".
availabilityconsumerfeegeneralinformationmultipleneedsoperatorprimaryprocessproductsproviderssegmentsinglesitetype
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
Apprenticeship
Q20773771 QID OVERLAP 0.800
QID OVERLAP: Q20773771 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (19): "certification", "complete", "formal", "found", "labor", "level", "license", "occupation", "outside", "people", "placement", "practice", "professional", "reach", "regulated", "study", "system", "training", "working".
certificationcompleteformalfoundlaborlevellicenseoccupationoutsidepeopleplacementpracticeprofessionalreachregulatedstudysystemtrainingworking
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Length Apprenticeships with a length of 2 years are for persons with weaker school results. The certificate awarded after successfully completing a 2-year apprenticeship is called "Attestation de formation professionnelle" (AFP) in French, "Eidgenössisches Berufsattest" (EBA) in German and "Certificato federale di formazione pratica" (CFP) in Italian. It could be translated as "Attestation of professional formation". Apprenticeship with a length of 3 or 4 years are the most common ones. The certificate awarded after successfully completing a 3 or 4-year apprenticeship is called "Certificat Fédéral de Capacité" (CFC) in French, "Eidgenössisches Fähigkeitszeugnis" (EFZ) in German and "Attestato federale di capacità" (AFC) in Italian. It could be translated as "Federal Certificate of Proficiency". Some crafts, such as electrician, are educated in lengths of 3 and 4 years. In this case, an Electrician with 4 years apprenticeship gets more theoretical background than one with 3 years apprenticeship. Some languages have different names for a craft depending on the length of the apprenticeship; this can be lost in translation. Each of the over 300 nationwide defined vocational profiles has defined framework – conditions as length of education, theoretical and practical learning goals and certification conditions. Age of the apprentices Typically an apprenticeship can commence for individuals once they are aged 15 or 18 after finishing general education. Some apprenticeships have a recommend or required age of 18.
Building code
Q2333573 QID OVERLAP 0.800
QID OVERLAP: Q2333573 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (43): "approved", "authority", "building", "buildings", "code", "codes", "compliance", "control", "departments", "design", "district", "electrical", "estate", "facility", "general", "generally", "health", "insurance", "intended", "jurisdiction"....
approvedauthoritybuildingbuildingscodecodescompliancecontroldepartmentsdesigndistrictelectricalestatefacilitygeneralgenerallyhealthinsuranceintendedjurisdictionlawlevellocalmaterialsmodelnationaloccupancyplanningprivateproducts+13
. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
o consider the effects of soil liquefaction in the design of new buildings. The building code becomes law of a particular jurisdiction when formally enacted by the appropriate governmental or private authority. Building codes are generally intended to be applied by architects, engineers, interior designers, constructors and regulators but are also used for various purposes by safety inspectors, environmental scientists, real estate developers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Ada County, Idaho
Q109820 QID OVERLAP 0.740
QID OVERLAP: Q109820 in wedding_events (tier:branch) and childcare_family (tier:evergreen). | SHARED TOKENS (12): "ada", "boise", "capital", "district", "estimated", "home", "idaho", "jurisdiction", "local", "population", "private", "second".
adaboisecapitaldistrictestimatedhomeidahojurisdictionlocalpopulationprivatesecond
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "population", "principal", "second", "university", "western".
boisecanyoncollegehomeidahomeridiannampapopulationprincipalseconduniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Meridian, Idaho
Q1085274 QID OVERLAP 0.700
QID OVERLAP: Q1085274 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (10): "ada", "among", "boise", "capital", "cities", "considered", "idaho", "meridian", "population", "second".
adaamongboisecapitalcitiesconsideredidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
C
Q5196473 QID OVERLAP 0.660
QID OVERLAP: Q5196473 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (8): "customer", "experience", "form", "products", "professional", "purchasing", "review", "sites".
customerexperienceformproductsprofessionalpurchasingreviewsites
A customer review is an evaluation of a product or service made by someone who has purchased and used, or had experience with, a product or service. Customer reviews are a form of customer feedback on electronic commerce and online shopping sites. There are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users.
here are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines.
or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines. These methods still exist today although internet review sites are used more in recent years. Reliability The reliability of customer reviews has been questioned. Abuses akin to ballot stuffing of favourable reviews by the seller (known as incentivized reviews), or negative reviews by competitors, need to be policed by the review host site. Indeed, gathering fake reviews has become big business. In 2012, for example, fake book reviews have been revealed as significantly affecting ratings on Amazon. In 2016 Amazon banned the practice of reviewing complimentary products, researchers have shown that the process still continued as of 2021, but without any disclosures. Since few sites restrict users to reviewing only items they have actually purchased, it is difficult to know if a customer is real, has actually used the product they are reviewing, and is giving honest, unbiased feedback about the product or services being reviewed. Tools like Fakespot and ReviewMeta can help spot fake reviews on shopping sites like Amazon. Unfortunately, the tools do not work on most other websites that show customer reviews. Public calls have been growing stronger, demanding that review sites be held accountable for publishing fake reviews. Most recently (June 2021), the Competition and Markets Authority (CMA) in the United Kingdom has launched an investigation into whether Amazon and Google are doing enough to prevent fake reviews from being published on their sites. Both businesses claim to have sufficient resources and policies in place to prevent fake reviews from being published. Legal steps could be taken against the giants if CMA determines those claims to be false.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "estimated", "idaho", "nampa", "population".
boisecaldwellcanyonestimatedidahonampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "considered", "idaho", "population".
boisecaldwellcanyoncollegeconsideredidahopopulation
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in wedding_events (tier:branch) and childcare_family (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
270 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP270 edges
🌲 EVERGREEN1 edges
0.610
ageearlyeducationfranchisenetworkoperatedoperatesownedownersprivateprogramsproviderschools
SHARED TOKENS (13): "age", "early", "education", "franchise", "network", "operated", "operates", "owned", "owners", "private", "programs", "provider", "schools". | URL->B (1): https://www.roarkcapital.com/files/Primrose-Press_Release.pdf. | EXACT TITLE in childcare_family: "Primrose Schools".
🌿 BRANCH209 edges
0.590
accommodateboisecentercompleteddistrictexpansionfeetgroupsidahooperatingspacesquare
SHARED TOKENS (12): "accommodate", "boise", "center", "completed", "district", "expansion", "feet", "groups", "idaho", "operating", "space", "square". | URL->A (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.500
agenciesassetsauthoritiesauthoritybusinessesdepartmentsdirectlyeligibilityequipmentexperiencefunctiongenerallygovernedhousingindividualjurisdictionleastlegallicenseslocal
SHARED TOKENS (36): "agencies", "assets", "authorities", "authority", "businesses", "departments", "directly", "eligibility", "equipment", "experience", "function", "generally", "governed", "housing", "individual", "jurisdiction", "least", "legal", "licenses", "local".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturearoundassociatedboisecapitalconsideredcontainsdistinctearlyeconomygeographicidahoisolatedlandnationalnorthofficialpeoplepopulationproducts
SHARED TOKENS (30): "agriculture", "around", "associated", "boise", "capital", "considered", "contains", "distinct", "early", "economy", "geographic", "idaho", "isolated", "land", "national", "north", "official", "people", "population", "products".... | EXACT TITLE in wedding_events: "Idaho". | EXACT TITLE in childcare_family: "Idaho".
0.500
Parenting ↗ Q1217379 EXACT TITLE
affectassociateddevelopmenteducationalexperiencesfamilyhistoryinfluencelegallong-termpersonalphysicalprocessproviderprovidersreceiverelationshipresearchrolesingle
SHARED TOKENS (22): "affect", "associated", "development", "educational", "experiences", "family", "history", "influence", "legal", "long-term", "personal", "physical", "process", "provider", "providers", "receive", "relationship", "research", "role", "single".... | EXACT TITLE in childcare_family: "Parenting".
0.500
Kitchen ↗ Q43164 EXACT TITLE
commercialcompletedesigneducationalequipmentfacilitiesfoodfoundfunctionsgenerallyhealthlargerlawmarketpreparationpublicrelatedrequirementsresidentialsmall
SHARED TOKENS (23): "commercial", "complete", "design", "educational", "equipment", "facilities", "food", "found", "functions", "generally", "health", "larger", "law", "market", "preparation", "public", "related", "requirements", "residential", "small".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
absenceactivitiesaffectaffectsamongbroadercommunitycreatedailydefinesdetermineshealthindividualintellectuallevelmerelyorganizationpeoplepersonalprofessional
SHARED TOKENS (25): "absence", "activities", "affect", "affects", "among", "broader", "community", "create", "daily", "defines", "determines", "health", "individual", "intellectual", "level", "merely", "organization", "people", "personal", "professional".... | EXACT TITLE in childcare_family: "Mental health".
0.500
Family court ↗ Q82749 EXACT TITLE
addressagainstchangescourtscreateddifferentdistinctionfamilyjurisdictionslawlegalmattersrelationshipsrequirementsrulessupportsystem
SHARED TOKENS (17): "address", "against", "changes", "courts", "created", "different", "distinction", "family", "jurisdictions", "law", "legal", "matters", "relationships", "requirements", "rules", "support", "system". | EXACT TITLE in childcare_family: "Family court".
0.500
applicationbrandbuildingbusinesscorporatedesigndevelopmentdifferentdueeventsformalfrequentlygroupsidentifyingindustryknowledgelogisticsmanagementmarketmarketing
SHARED TOKENS (35): "application", "brand", "building", "business", "corporate", "design", "development", "different", "due", "events", "formal", "frequently", "groups", "identifying", "industry", "knowledge", "logistics", "management", "market", "marketing".... | EXACT TITLE in wedding_events: "Event management".
0.500
affectsageamongapprovedcommunitycompensationconditionscreateddatafamiliesfamilygeneralgrouphealthhomelegalparentplacementpopulationprivate
SHARED TOKENS (32): "affects", "age", "among", "approved", "community", "compensation", "conditions", "created", "data", "families", "family", "general", "group", "health", "home", "legal", "parent", "placement", "population", "private".... | EXACT TITLE in childcare_family: "Foster care".
0.500
Food safety ↗ Q909821 EXACT TITLE
affectscannotcertificationchainconsumercreatesdescribingdueenforcementestimatedfoodgrowthhealthindustryinspectionlinemanagementmarketnutritionorganization
SHARED TOKENS (33): "affects", "cannot", "certification", "chain", "consumer", "creates", "describing", "due", "enforcement", "estimated", "food", "growth", "health", "industry", "inspection", "line", "management", "market", "nutrition", "organization".... | EXACT TITLE in wedding_events: "Food safety".
0.500
Living wage ↗ Q543406 EXACT TITLE
additionalauthoritycreateddemanddiscoverydueeconomiceconomyemploymenteventsfamilyfloorfoodhealthhousingincomelaborlegallinemedian
SHARED TOKENS (39): "additional", "authority", "created", "demand", "discovery", "due", "economic", "economy", "employment", "events", "family", "floor", "food", "health", "housing", "income", "labor", "legal", "line", "median".... | EXACT TITLE in childcare_family: "Living wage".
0.500
accessaccountaffectagenciesauthoritiesbeyondcommunitycomprehensivecoordinationcreatecreatingdefinesdesigneddevelopmenteconomiceducationevenfamiliesfamilyfuture
SHARED TOKENS (56): "access", "account", "affect", "agencies", "authorities", "beyond", "community", "comprehensive", "coordination", "create", "creating", "defines", "designed", "development", "economic", "education", "even", "families", "family", "future".... | EXACT TITLE in childcare_family: "Child protection".
0.500
Commissary ↗ Q5152616 EXACT TITLE
administrativeassociatedbuildingcontextfinancialjurisdictionnationalofficeofficialorganizationpolicespecialsuppliestitleuses
SHARED TOKENS (15): "administrative", "associated", "building", "context", "financial", "jurisdiction", "national", "office", "official", "organization", "police", "special", "supplies", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbuiltbusinessescourtsdesignedearlyeventsfloorformalgenerallyhelphistorichistoryhostinsidelevelpeopleprimary
SHARED TOKENS (26): "annual", "building", "buildings", "built", "businesses", "courts", "designed", "early", "events", "floor", "formal", "generally", "help", "historic", "history", "host", "inside", "level", "people", "primary".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
businessescategorycreateeconomicindividualinformationintellectuallandlawlegallimitedlowerownershippeoplepriceprimarypropertyrightsstrongsystems
SHARED TOKENS (23): "businesses", "category", "create", "economic", "individual", "information", "intellectual", "land", "law", "legal", "limited", "lower", "ownership", "people", "price", "primary", "property", "rights", "strong", "systems".... | EXACT TITLE in wedding_events: "Intellectual property". | EXACT TITLE in childcare_family: "Intellectual property".
0.500
beyondcomplianceformgroupidentifiedinfluenceinformationleadmarketingneedsoutsidepeerpeoplepressureprivatepublicresponseresultssharedsocial
SHARED TOKENS (22): "beyond", "compliance", "form", "group", "identified", "influence", "information", "lead", "marketing", "needs", "outside", "peer", "people", "pressure", "private", "public", "response", "results", "shared", "social".... | EXACT TITLE in wedding_events: "Social influence".
0.500
additionalageauthoritycapacitychangesconsideredcontextcourtscreatedatadependencydevelopmentearlygeneralincreasesincreasinglyjurisdictionlegalmodelneeds
SHARED TOKENS (35): "additional", "age", "authority", "capacity", "changes", "considered", "context", "courts", "create", "data", "dependency", "development", "early", "general", "increases", "increasingly", "jurisdiction", "legal", "model", "needs".... | EXACT TITLE in childcare_family: "Juvenile court".
0.500
Marketing ↗ Q39809 EXACT TITLE
advertisingassociationbusinessbusinessescharacteristicscreatingdirectlyfirmsfoodindustrymanagementmarketmarketingmediaplanningpriceprimaryprocessproductsregion
SHARED TOKENS (26): "advertising", "association", "business", "businesses", "characteristics", "creating", "directly", "firms", "food", "industry", "management", "market", "marketing", "media", "planning", "price", "primary", "process", "products", "region".... | EXACT TITLE in wedding_events: "Marketing". | EXACT TITLE in childcare_family: "Marketing".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstconditionsestablishedexperiencesfeefinancialformhealthinsurancemanagementmandatoryownershippolicyprimaryprocessingprotectionreceivesrelationshiprequiredrisk
SHARED TOKENS (22): "against", "conditions", "established", "experiences", "fee", "financial", "form", "health", "insurance", "management", "mandatory", "ownership", "policy", "primary", "processing", "protection", "receives", "relationship", "required", "risk".... | EXACT TITLE in wedding_events: "Insurance". | EXACT TITLE in childcare_family: "Insurance".
0.500
advertisingbusinessbusinessescapacitycommercialcustomerexpandedfamiliesfamilyfloorgenerallyhelphomehouseofficeoperateoperatedoperatesownerparking
SHARED TOKENS (27): "advertising", "business", "businesses", "capacity", "commercial", "customer", "expanded", "families", "family", "floor", "generally", "help", "home", "house", "office", "operate", "operated", "operates", "owner", "parking".... | EXACT TITLE in childcare_family: "Home business".
0.500
Indeed ↗ EXACT TITLE
additionalallowingaroundcentralcomdirectlyemployersemploymentfirmsindependentnovemberrecruitrevenuesearchsinglesitestaffingvertical
SHARED TOKENS (18): "additional", "allowing", "around", "central", "com", "directly", "employers", "employment", "firms", "independent", "november", "recruit", "revenue", "search", "single", "site", "staffing", "vertical". | EXACT TITLE in childcare_family: "Indeed".
0.500
Rodeo ↗ Q207703 EXACT TITLE
animalassociationcategoriesconsidereddesignedequipmenteventsfederalgenerallygovernedgroupsindustrylocalnationalnorthofficialorganizationpracticesprofessionalpublic
SHARED TOKENS (29): "animal", "association", "categories", "considered", "designed", "equipment", "events", "federal", "generally", "governed", "groups", "industry", "local", "national", "north", "official", "organization", "practices", "professional", "public".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesallowingbusinessescollegecurrentemployersemploymentexperiencefuturegroupsindustryinvestmentleadlearninglimitedmedicalnetworkorganizationpracticeprofessional
SHARED TOKENS (37): "agencies", "allowing", "businesses", "college", "current", "employers", "employment", "experience", "future", "groups", "industry", "investment", "lead", "learning", "limited", "medical", "network", "organization", "practice", "professional".... | EXACT TITLE in wedding_events: "Internship".
0.500
Sanitation ↗ Q949149 EXACT TITLE
accessactivitiesapplicablechaincommunitiesconditionsdevelopmenteconomygeneralgrowthhealthlevellimitedmanagedoperatingpeoplepersonalpublicrelatedsafety
SHARED TOKENS (31): "access", "activities", "applicable", "chain", "communities", "conditions", "development", "economy", "general", "growth", "health", "level", "limited", "managed", "operating", "people", "personal", "public", "related", "safety".... | EXACT TITLE in wedding_events: "Sanitation". | EXACT TITLE in childcare_family: "Sanitation".
0.500
activeaffectamongassociationciviccommunitiescommunitycontextcreateddefinesdevelopmenteconomiceducationgroupsidentitylargerlocalmajorpeoplepractice
SHARED TOKENS (34): "active", "affect", "among", "association", "civic", "communities", "community", "context", "created", "defines", "development", "economic", "education", "groups", "identity", "larger", "local", "major", "people", "practice".... | EXACT TITLE in wedding_events: "Community development".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationapplicationapplicationsconditionsdatadefinesdigitaldueeducationevenfacilitiesfundinghealthhomeinformationlimitedlivemanagementmedical
SHARED TOKENS (32): "access", "administration", "application", "applications", "conditions", "data", "defines", "digital", "due", "education", "even", "facilities", "funding", "health", "home", "information", "limited", "live", "management", "medical".... | EXACT TITLE in childcare_family: "Telehealth".
0.500
aroundbuildingcommunitiescommunitydevelopmentdistinctexperiencefunctioninggeographyhealthmodelnetworksoccursoperateoperatingorganizationsharedsocialspacework
SHARED TOKENS (20): "around", "building", "communities", "community", "development", "distinct", "experience", "functioning", "geography", "health", "model", "networks", "occurs", "operate", "operating", "organization", "shared", "social", "space", "work". | EXACT TITLE in childcare_family: "Community organization".
0.500
affectsbusinesscertificationcompensationconsumercreatescustomerdueeconomicentryformfrequentlygeneralgrowthhealthindividualinspectionslawleastlicense
SHARED TOKENS (43): "affects", "business", "certification", "compensation", "consumer", "creates", "customer", "due", "economic", "entry", "form", "frequently", "general", "growth", "health", "individual", "inspections", "law", "least", "license".... | EXACT TITLE in wedding_events: "Occupational licensing".
0.500
Care work ↗ Q5038877 EXACT TITLE
activitiesaddressassociatedcenterscommunitiescompensationconditionscostdatadevelopmentdirectdistributionemploymentfacefamiliesfamilyformformalgroupidentified
SHARED TOKENS (40): "activities", "address", "associated", "centers", "communities", "compensation", "conditions", "cost", "data", "development", "direct", "distribution", "employment", "face", "families", "family", "form", "formal", "group", "identified".... | EXACT TITLE in childcare_family: "Care work".
0.500
activitiesaddagearoundblockbuildingcapacitychangesconsideredcreatesdevelopmentearlyeducationalestablishedidentityimportantincreaseindividuallearningmajor
SHARED TOKENS (33): "activities", "add", "age", "around", "block", "building", "capacity", "changes", "considered", "creates", "development", "early", "educational", "established", "identity", "important", "increase", "individual", "learning", "major".... | EXACT TITLE in childcare_family: "Child development".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
assetsbusinesscentercontroleconomicevenfacilityfunctionslegallimitedmanagementoperationalorganizationotherwiseoutsidepracticeprivateprocessprocessingprovider
SHARED TOKENS (26): "assets", "business", "center", "control", "economic", "even", "facility", "functions", "legal", "limited", "management", "operational", "organization", "otherwise", "outside", "practice", "private", "process", "processing", "provider".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
aloneamongchurchcommunitycostseducationestablishesexecutivefundinggeneralgroupsmajormissionnationalneedsofficialone-timeoperatingoriginspeople
SHARED TOKENS (30): "alone", "among", "church", "community", "costs", "education", "establishes", "executive", "funding", "general", "groups", "major", "mission", "national", "needs", "official", "one-time", "operating", "origins", "people".... | EXACT TITLE in childcare_family: "Salvation Army".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesaffectagricultureannuallyapplicationchangesconditionscontrolcreatingdifferentdistributionduefuturegenerallyhistoryindustrylayerleastlimitedlong-term
SHARED TOKENS (31): "activities", "affect", "agriculture", "annually", "application", "changes", "conditions", "control", "creating", "different", "distribution", "due", "future", "generally", "history", "industry", "layer", "least", "limited", "long-term".... | EXACT TITLE in wedding_events: "Weather".
0.500
YMCA ↗ Q157169 EXACT TITLE
activitiesassociationdeliverdevelopmentfacilitiesindependentlocalnationalorganizationpeoplepracticeprogramsregionalstaffstatedsubjectwork
SHARED TOKENS (17): "activities", "association", "deliver", "development", "facilities", "independent", "local", "national", "organization", "people", "practice", "programs", "regional", "staff", "stated", "subject", "work". | EXACT TITLE in childcare_family: "YMCA".
0.500
amongboisecampusdivisionestablishedidahoopenedoperatesprofessionalpublicresearchruralschoolsspendingstatewidestudentsuniversityuntil
SHARED TOKENS (18): "among", "boise", "campus", "division", "established", "idaho", "opened", "operates", "professional", "public", "research", "rural", "schools", "spending", "statewide", "students", "university", "until". | EXACT TITLE in wedding_events: "University of Idaho".
0.500
Orphanage ↗ Q160645 EXACT TITLE
cannotcenterscommunitiescontrolduefamiliesfamilyfundfundinggenerallygroupgroupshomeincreaselegaloperateparentpopulationrecruitresidential
SHARED TOKENS (25): "cannot", "centers", "communities", "control", "due", "families", "family", "fund", "funding", "generally", "group", "groups", "home", "increase", "legal", "operate", "parent", "population", "recruit", "residential".... | EXACT TITLE in childcare_family: "Orphanage".
0.500
developmentdifferentdirectearlyfamiliesfamilyindividualinfluencelong-termparticipationpeopleproblemrelatedrelationshipsschoolsstudysupportsystemsystemsview
SHARED TOKENS (20): "development", "different", "direct", "early", "families", "family", "individual", "influence", "long-term", "participation", "people", "problem", "related", "relationships", "schools", "study", "support", "system", "systems", "view". | EXACT TITLE in childcare_family: "Family therapy".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbasebusinesscreatecreatingdigitaldirectelectricalexposureformimagesinsidematerialoperatespracticeprocessingproducesrealsciencestudents
SHARED TOKENS (22): "application", "base", "business", "create", "creating", "digital", "direct", "electrical", "exposure", "form", "images", "inside", "material", "operates", "practice", "processing", "produces", "real", "science", "students".... | EXACT TITLE in wedding_events: "Photography".
0.500
agecoordinationdesigneddevelopmentdifferentequipmentfacilitiesgroupshelpinformalpeoplephysicalpublicrecreationsafeschoolssocialstructuressupportingtype
SHARED TOKENS (20): "age", "coordination", "designed", "development", "different", "equipment", "facilities", "groups", "help", "informal", "people", "physical", "public", "recreation", "safe", "schools", "social", "structures", "supporting", "type". | EXACT TITLE in childcare_family: "Playground".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialconsideredfoodgenerallygroupindividualmanagementmodelon-sitepracticesprivaterisksafetyservedservesservingspecialstaff
SHARED TOKENS (19): "business", "commercial", "considered", "food", "generally", "group", "individual", "management", "model", "on-site", "practices", "private", "risk", "safety", "served", "serves", "serving", "special", "staff". | EXACT TITLE in wedding_events: "Catering".
0.500
Waste management ↗ EXACT TITLE
activitiesactivityadditionalcenterscitiescombinedcommercialcreateddifferenteconomicfinalfoodhealthitselfleastmanagementmaterialmaterialsmunicipalpractice
SHARED TOKENS (34): "activities", "activity", "additional", "centers", "cities", "combined", "commercial", "created", "different", "economic", "final", "food", "health", "itself", "least", "management", "material", "materials", "municipal", "practice".... | EXACT TITLE in wedding_events: "Waste management".
0.500
affectsamongaroundconsideredcostdifferenteducationevenexperiencefamilyhealthincomeinvestmentplanningresultingthough
SHARED TOKENS (16): "affects", "among", "around", "considered", "cost", "different", "education", "even", "experience", "family", "health", "income", "investment", "planning", "resulting", "though". | EXACT TITLE in childcare_family: "Maternal health".
0.500
Parking ↗ Q267917 EXACT TITLE
aroundavailabilitybuildingscentersdependencydesignfacilitieslandlocalnorthparkingpercentpriceroadrulessupportthoughurban
SHARED TOKENS (18): "around", "availability", "buildings", "centers", "dependency", "design", "facilities", "land", "local", "north", "parking", "percent", "price", "road", "rules", "support", "though", "urban". | EXACT TITLE in wedding_events: "Parking". | EXACT TITLE in childcare_family: "Parking".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesadjacentagainstagenciesbuildingsbuiltcitiesinsidelandlawlivenationalpermitprotectionrecreationrulesshowsspacesquarestructures
SHARED TOKENS (22): "activities", "adjacent", "against", "agencies", "buildings", "built", "cities", "inside", "land", "law", "live", "national", "permit", "protection", "recreation", "rules", "shows", "space", "square", "structures".... | EXACT TITLE in wedding_events: "Park". | EXACT TITLE in childcare_family: "Park".
0.500
Family ↗ Q8436 EXACT TITLE
attachmentcategoriescommunitycreateeconomicfamiliesfamilygrouphistoricallyhistoryimportantpeopleprimaryrelatedrelationshipsafetysocialstructure
SHARED TOKENS (18): "attachment", "categories", "community", "create", "economic", "families", "family", "group", "historically", "history", "important", "people", "primary", "related", "relationship", "safety", "social", "structure". | EXACT TITLE in wedding_events: "Family". | EXACT TITLE in childcare_family: "Family".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingbuildingsdevelopmentdifferentformgrowthguidelandland-uselocalplanningpolicypropertyregulatoryresidentialrulessinglesize
SHARED TOKENS (24): "activities", "allowing", "building", "buildings", "development", "different", "form", "growth", "guide", "land", "land-use", "local", "planning", "policy", "property", "regulatory", "residential", "rules", "single", "size".... | EXACT TITLE in wedding_events: "Zoning". | EXACT TITLE in childcare_family: "Zoning".
0.500
Floristry ↗ Q637125 EXACT TITLE
arrangementsbusinesschurchconsideredcorporatecreatecreatingdesigndistributioneventsgardengenerallygeographicimportantindustryknowledgelevelmarketmaterialmaterials
SHARED TOKENS (33): "arrangements", "business", "church", "considered", "corporate", "create", "creating", "design", "distribution", "events", "garden", "generally", "geographic", "important", "industry", "knowledge", "level", "market", "material", "materials".... | EXACT TITLE in wedding_events: "Floristry".
0.500
applicablecommunitiescourseworkcredentialsdevelopmenteducationformalfoundincorporatinginformalknowledgelearningmaintainpracticeprofessionalprojectschoolsstudy
SHARED TOKENS (18): "applicable", "communities", "coursework", "credentials", "development", "education", "formal", "found", "incorporating", "informal", "knowledge", "learning", "maintain", "practice", "professional", "project", "schools", "study". | EXACT TITLE in wedding_events: "Professional development".
0.500
applicationapplicationscompleteequipmentfeethouseidentifyingitselfleastlicensedlistoccupationproductsprofessionalsanitationtrainingtreatmentwhosework
SHARED TOKENS (19): "application", "applications", "complete", "equipment", "feet", "house", "identifying", "itself", "least", "licensed", "list", "occupation", "products", "professional", "sanitation", "training", "treatment", "whose", "work". | EXACT TITLE in wedding_events: "Nail technician".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmentdueeconomicestimatedgenerallygrowthincreaselimitedlocalmarketsorganizationoutsidepeoplepractices
SHARED TOKENS (28): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "due", "economic", "estimated", "generally", "growth", "increase", "limited", "local", "markets", "organization", "outside", "people", "practices".... | EXACT TITLE in wedding_events: "Tourism".
0.500
Yelp ↗ Q2299611 EXACT TITLE
advertisingannualbusinessbusinessescomdirectoryexpandedfundingincomeinformationoperatespracticepracticespublicpublishedpublishesrevenuereviewsitesystem
SHARED TOKENS (21): "advertising", "annual", "business", "businesses", "com", "directory", "expanded", "funding", "income", "information", "operates", "practice", "practices", "public", "published", "publishes", "revenue", "review", "site", "system".... | EXACT TITLE in wedding_events: "Yelp".
0.500
activitiesaddedaddressbusinesscompletecreateddesigneddevelopmentdistinctdocumentationestablishedfundinginfluenceinformationmanagementoperationspracticeprimaryprocessproducts
SHARED TOKENS (28): "activities", "added", "address", "business", "complete", "created", "designed", "development", "distinct", "documentation", "established", "funding", "influence", "information", "management", "operations", "practice", "primary", "process", "products".... | EXACT TITLE in wedding_events: "Project management".
0.500
changescitiesdesignedestimatedexperiencefamilyformgenerallyhousehousingidentifyinglegalliveneedspeopleprimaryprivatepublicsafeshelter
SHARED TOKENS (23): "changes", "cities", "designed", "estimated", "experience", "family", "form", "generally", "house", "housing", "identifying", "legal", "live", "needs", "people", "primary", "private", "public", "safe", "shelter".... | EXACT TITLE in childcare_family: "Homelessness".
0.500
agearoundcentralcollegecostscurriculumdevelopmentearlyeducationeducationalentitiesfederalfundinggoverningimportantincreaselearninglong-termmunicipalparticipation
SHARED TOKENS (40): "age", "around", "central", "college", "costs", "curriculum", "development", "early", "education", "educational", "entities", "federal", "funding", "governing", "important", "increase", "learning", "long-term", "municipal", "participation".... | EXACT TITLE in childcare_family: "Early childhood education".
0.500
Accounting ↗ Q4116214 EXACT TITLE
activitiesanalysisbusinessbusinessescostdesignedeconomicentitiesfinancialfirmsfunctionsgenerallyhistoryinformationmajormanagementoperationsorganizationpreparationprocess
SHARED TOKENS (32): "activities", "analysis", "business", "businesses", "cost", "designed", "economic", "entities", "financial", "firms", "functions", "generally", "history", "information", "major", "management", "operations", "organization", "preparation", "process".... | EXACT TITLE in wedding_events: "Accounting".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesaroundconsumercontinuingestablishedeventsfinalgeneralhelpindustrylatestmarketmarketspresentproductspublicshowsstudytherefore
SHARED TOKENS (19): "activities", "around", "consumer", "continuing", "established", "events", "final", "general", "help", "industry", "latest", "market", "markets", "present", "products", "public", "shows", "study", "therefore". | EXACT TITLE in wedding_events: "Trade show".
0.500
agecentercenterscommunitiescommunitycoordinationcountiesdesigneddifferentdistrictsearlyeducationeligibleexperienceexperiencesfamiliesfamilyfederalhealthhome
SHARED TOKENS (40): "age", "center", "centers", "communities", "community", "coordination", "counties", "designed", "different", "districts", "early", "education", "eligible", "experience", "experiences", "families", "family", "federal", "health", "home".... | EXACT TITLE in childcare_family: "Early Head Start".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessannualassetscostcostseconomiceligibilityestablishedexpandedfamiliesfederalfinancialfundinggeneralhealthhomeincomeinsurancelimitedline
SHARED TOKENS (47): "access", "annual", "assets", "cost", "costs", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "funding", "general", "health", "home", "income", "insurance", "limited", "line".... | EXACT TITLE in childcare_family: "Medicaid".
0.500
accountbeyondbusinesschangesconditionsdatademanddueeconomiceconomyemploymentextendsfuturegenerallyhelpincreasesleastmaintenancemarketrelated
SHARED TOKENS (29): "account", "beyond", "business", "changes", "conditions", "data", "demand", "due", "economic", "economy", "employment", "extends", "future", "generally", "help", "increases", "least", "maintenance", "market", "related".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
authoritydocumentissueditselfjurisdictionslegallicenselicensesorganizationotherwisepermitrecordrequirerequiredserve
SHARED TOKENS (15): "authority", "document", "issued", "itself", "jurisdictions", "legal", "license", "licenses", "organization", "otherwise", "permit", "record", "require", "required", "serve". | EXACT TITLE in wedding_events: "Marriage license".
0.500
Disability ↗ Q12131 EXACT TITLE
accessaccessibilityactivitiesactivityagainstaroundcategoriescenterscommunityconsideredcreateddefinesdifferentdueexperienceframeworkhistoricallyhistoryidentityindividual
SHARED TOKENS (48): "access", "accessibility", "activities", "activity", "against", "around", "categories", "centers", "community", "considered", "created", "defines", "different", "due", "experience", "framework", "historically", "history", "identity", "individual".... | EXACT TITLE in childcare_family: "Disability".
0.500
Logistics ↗ Q177777 EXACT TITLE
chaincostsdeliveriesequipmentfacilityfoodinformationlogisticsmanagedmanagementmaterialmaterialsmodelneedsoperationalphysicalplanningproductsprofessionalpublic
SHARED TOKENS (25): "chain", "costs", "deliveries", "equipment", "facility", "food", "information", "logistics", "managed", "management", "material", "materials", "model", "needs", "operational", "physical", "planning", "products", "professional", "public".... | EXACT TITLE in wedding_events: "Logistics". | EXACT TITLE in childcare_family: "Logistics".
0.500
affectagainstcompensationcontractualcostcostscreateddesignedevenexpresslyfinancingfundgeneralgroupindividualinsurancelegalotherwisepolicyprotection
SHARED TOKENS (26): "affect", "against", "compensation", "contractual", "cost", "costs", "created", "designed", "even", "expressly", "financing", "fund", "general", "group", "individual", "insurance", "legal", "otherwise", "policy", "protection".... | EXACT TITLE in wedding_events: "Liability insurance".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativebuiltbusinesscenterclubscostcourtsdepartmentdepartmentsdirectearlyeconomyequipmentexecutivefacilitiesfacilityfoodform
SHARED TOKENS (49): "access", "additional", "administrative", "built", "business", "center", "clubs", "cost", "courts", "department", "departments", "direct", "early", "economy", "equipment", "executive", "facilities", "facility", "food", "form".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstconditionsdirectlydistinctevengenerallyguideindividualinfluenceinformationlimitednetworkoutsidepeoplepositionproblemprocesssecondsocialspace
SHARED TOKENS (22): "against", "conditions", "directly", "distinct", "even", "generally", "guide", "individual", "influence", "information", "limited", "network", "outside", "people", "position", "problem", "process", "second", "social", "space".... | EXACT TITLE in wedding_events: "Information cascade".
0.500
adaadjacentboisedepartmentdistrictdistrictseducationeducationalidahojurisdictionpublicschoolschoolssecondservessquaresystemwestern
SHARED TOKENS (18): "ada", "adjacent", "boise", "department", "district", "districts", "education", "educational", "idaho", "jurisdiction", "public", "school", "schools", "second", "serves", "square", "system", "western". | EXACT TITLE in childcare_family: "Boise School District".
0.500
Child care ↗ Q1455871 EXACT TITLE
accessactivitiesattachmentbackgroundcenterscheckscommunitiescontextdailydevelopmentearlyeconomiceducationeducationalfacilityfamiliesfamilyformhousinglabor
SHARED TOKENS (36): "access", "activities", "attachment", "background", "centers", "checks", "communities", "context", "daily", "development", "early", "economic", "education", "educational", "facility", "families", "family", "form", "housing", "labor".... | EXACT TITLE in childcare_family: "Child care".
0.500
administrationblockcomplycreatesdepartmentdesigneddivisioneducationaleligiblefamiliesfederalhealthhomeleastmaintenancepeoplepreparationprogramrequiredrequirements
SHARED TOKENS (25): "administration", "block", "comply", "creates", "department", "designed", "division", "educational", "eligible", "families", "federal", "health", "home", "least", "maintenance", "people", "preparation", "program", "required", "requirements".... | EXACT TITLE in childcare_family: "Temporary Assistance for Needy Families".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiescommunityconnectioncreatingexperiencefamiliesfoodimportantlocalnationalpracticeservesource
SHARED TOKENS (16): "agriculture", "among", "associated", "communities", "community", "connection", "creating", "experience", "families", "food", "important", "local", "national", "practice", "serve", "source". | EXACT TITLE in wedding_events: "Festival".
0.500
accessadditionalcommunitycurriculumdesigneddifferenteducationeducationalequipmentgeneralhelpindividualintellectuallearninglevelmaterialsneedspersonalphysicalpractice
SHARED TOKENS (29): "access", "additional", "community", "curriculum", "designed", "different", "education", "educational", "equipment", "general", "help", "individual", "intellectual", "learning", "level", "materials", "needs", "personal", "physical", "practice".... | EXACT TITLE in childcare_family: "Special education".
0.500
assetscharacteristicscreatecustomerexperienceguideidentifiedincreaseindustryneedsorganizationpersonnelproductsprovisionqualitystandardsuses
SHARED TOKENS (17): "assets", "characteristics", "create", "customer", "experience", "guide", "identified", "increase", "industry", "needs", "organization", "personnel", "products", "provision", "quality", "standards", "uses". | EXACT TITLE in wedding_events: "Customer service".
0.500
accessactiveaffectsageavailabilitybeyondconsideredcreatedeclinedevelopmentdueearlyeconomicestimatedevenfamilyfoodfuturegrowthhealth
SHARED TOKENS (44): "access", "active", "affects", "age", "availability", "beyond", "considered", "create", "decline", "development", "due", "early", "economic", "estimated", "even", "family", "food", "future", "growth", "health".... | EXACT TITLE in childcare_family: "Food security".
0.500
Tent ↗ Q170544 EXACT TITLE
capablecategoriescitiesexperienceincreasinglyintendedlargermaterialmultiplenearpeoplesecondsheltersizesmallstructuressupportingtemporarytype
SHARED TOKENS (19): "capable", "categories", "cities", "experience", "increasingly", "intended", "larger", "material", "multiple", "near", "people", "second", "shelter", "size", "small", "structures", "supporting", "temporary", "type". | EXACT TITLE in wedding_events: "Tent". | EXACT TITLE in childcare_family: "Tent".
0.500
comprehensivecurrentdepartmentdesignedearlyeducationestablishexpandedfamiliesfamilyfederalhealthnetworknutritionoutsideparentphysicalprogramrelationshipsrequiring
SHARED TOKENS (25): "comprehensive", "current", "department", "designed", "early", "education", "establish", "expanded", "families", "family", "federal", "health", "network", "nutrition", "outside", "parent", "physical", "program", "relationships", "requiring".... | EXACT TITLE in childcare_family: "Head Start (program)".
0.500
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingbuiltconcentrateddifferenteveneventsfoodformformalhostpeoplesocialspecialthem
SHARED TOKENS (16): "additional", "among", "building", "built", "concentrated", "different", "even", "events", "food", "form", "formal", "host", "people", "social", "special", "them". | EXACT TITLE in wedding_events: "Banquet".
0.500
activityaddressagenciesbusinessdepartmentsdeterminesissuedjurisdictionlicenselicenseslocalmultipleoperateoperatingpermitsphysicalrequiredrequiressingle
SHARED TOKENS (19): "activity", "address", "agencies", "business", "departments", "determines", "issued", "jurisdiction", "license", "licenses", "local", "multiple", "operate", "operating", "permits", "physical", "required", "requires", "single". | EXACT TITLE in wedding_events: "Business license".
0.480
Resort ↗ Q875157 EXACT TITLE
activitiescentralcommercialcontainingfoodfrequentlyneedsnorthoperatedownedownershippeoplesingletype
SHARED TOKENS (14): "activities", "central", "commercial", "containing", "food", "frequently", "needs", "north", "operated", "owned", "ownership", "people", "single", "type". | EXACT TITLE in wedding_events: "Resort".
0.480
businessformincreaselong-termmaterialoriginsphilanthropypracticespresentprivateprovisionpublicqualityrather
SHARED TOKENS (14): "business", "form", "increase", "long-term", "material", "origins", "philanthropy", "practices", "present", "private", "provision", "public", "quality", "rather". | EXACT TITLE in wedding_events: "Philanthropy". | EXACT TITLE in childcare_family: "Philanthropy".
0.480
Downtown ↗ Q1050303 EXACT TITLE
businesscentercentralcommercialconcentrateddistrictemploymentgeographiclowernorthofficepopulationpublicsmall
SHARED TOKENS (14): "business", "center", "central", "commercial", "concentrated", "district", "employment", "geographic", "lower", "north", "office", "population", "public", "small". | EXACT TITLE in wedding_events: "Downtown".
0.480
Convention ↗ Q225862 EXACT TITLE
animalcharacteristicsdifferentformalgroupindustrylawlegallinemediaofficepeoplepropertyshare
SHARED TOKENS (14): "animal", "characteristics", "different", "formal", "group", "industry", "law", "legal", "line", "media", "office", "people", "property", "share". | EXACT TITLE in wedding_events: "Convention".
0.480
Signage ↗ Q1211272 EXACT TITLE
buildingsconsideredcreateddesigndesigneddigitaldistinctdocumentedformgroupinformationinsideoutsidesize
SHARED TOKENS (14): "buildings", "considered", "created", "design", "designed", "digital", "distinct", "documented", "form", "group", "information", "inside", "outside", "size". | EXACT TITLE in wedding_events: "Signage".
0.480
activitiesamongbackgroundcheckscompletecomprehensiveeducationemploymenthistoryindividualprocessrecordsearchsecurity
SHARED TOKENS (14): "activities", "among", "background", "checks", "complete", "comprehensive", "education", "employment", "history", "individual", "process", "record", "search", "security". | EXACT TITLE in wedding_events: "Background check". | EXACT TITLE in childcare_family: "Background check".
0.460
Concert ↗ Q182832 EXACT TITLE
equipmentfloorindoorlivelogisticsoutdoorprivateprofessionalrequiresinglesmallspanningsupport
SHARED TOKENS (13): "equipment", "floor", "indoor", "live", "logistics", "outdoor", "private", "professional", "require", "single", "small", "spanning", "support". | EXACT TITLE in wedding_events: "Concert".
0.460
Orchard ↗ Q236371 EXACT TITLE
basecommercialconcentratedfoodgardengenerallymaintenancemakesnearservesingleuntilwater
SHARED TOKENS (13): "base", "commercial", "concentrated", "food", "garden", "generally", "maintenance", "makes", "near", "serve", "single", "until", "water". | EXACT TITLE in wedding_events: "Orchard".
0.440
communitycoordinationcourtsfirmsgeneralhealthlawlegalmanagementmedicalsystemtreatment
SHARED TOKENS (12): "community", "coordination", "courts", "firms", "general", "health", "law", "legal", "management", "medical", "system", "treatment". | EXACT TITLE in childcare_family: "Case management".
0.440
activityamongcampusidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (12): "activity", "among", "campus", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | EXACT TITLE in wedding_events: "Idaho State University". | EXACT TITLE in childcare_family: "Idaho State University".
0.440
applicantsassociatecredentialdevelopmentearlyeducationfamilygrowthhomeprofessionalprogramssupport
SHARED TOKENS (12): "applicants", "associate", "credential", "development", "early", "education", "family", "growth", "home", "professional", "programs", "support". | EXACT TITLE in childcare_family: "Child Development Associate".
0.440
Workforce ↗ Q13440398 EXACT TITLE
cannotemploymentotherwiseparticipationpeoplepopulationresultsstatedtextworkworkforceworking
SHARED TOKENS (12): "cannot", "employment", "otherwise", "participation", "people", "population", "results", "stated", "text", "work", "workforce", "working". | EXACT TITLE in wedding_events: "Workforce". | EXACT TITLE in childcare_family: "Workforce".
0.440
createdcreatingdepartmentenforcementidaholawmunicipalorganizationpolicepresentpublicstatewide
SHARED TOKENS (12): "created", "creating", "department", "enforcement", "idaho", "law", "municipal", "organization", "police", "present", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police".
0.440
commercialconsidereddigitaldirectdistinctionhistoricallyimageslivelocalmedianewswork
SHARED TOKENS (12): "commercial", "considered", "digital", "direct", "distinction", "historically", "images", "live", "local", "media", "news", "work". | EXACT TITLE in wedding_events: "Videography".
0.430
boisecenteridahonampa
SHARED TOKENS (4): "boise", "center", "idaho", "nampa". | URL->A (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.420
businesscostsemployeeemployersknowledgemaintainorganizationretaintrainingturnoverworkforce
SHARED TOKENS (11): "business", "costs", "employee", "employers", "knowledge", "maintain", "organization", "retain", "training", "turnover", "workforce". | EXACT TITLE in childcare_family: "Employee retention".
0.420
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessescitiesdesigneddirectlyfacilityfunctionmaterials
SHARED TOKENS (11): "agriculture", "associated", "building", "buildings", "businesses", "cities", "designed", "directly", "facility", "function", "materials". | EXACT TITLE in wedding_events: "Warehouse".
0.420
accommodatebuildingcentercentersdesignedfloorgroupsleastmajorshareshows
SHARED TOKENS (11): "accommodate", "building", "center", "centers", "designed", "floor", "groups", "least", "major", "share", "shows". | EXACT TITLE in wedding_events: "Convention center".
0.420
activitiesageeducationeducationalhomelearningoutsideschoolservesocialwhose
SHARED TOKENS (11): "activities", "age", "education", "educational", "home", "learning", "outside", "school", "serve", "social", "whose". | EXACT TITLE in childcare_family: "Kindergarten".
0.400
Rose garden ↗ Q291177 EXACT TITLE
alongsidedisplayedgardenindividualleastoriginspresentpublictreatedtype
SHARED TOKENS (10): "alongside", "displayed", "garden", "individual", "least", "origins", "present", "public", "treated", "type". | EXACT TITLE in wedding_events: "Rose garden".
0.400
assetscapitalfinancialfundgrowthinvestmentmakesmanagementprivatetechnology
SHARED TOKENS (10): "assets", "capital", "financial", "fund", "growth", "investment", "makes", "management", "private", "technology". | EXACT TITLE in childcare_family: "Golden Gate Capital".
0.400
Preschool ↗ Q1076052 EXACT TITLE
ageearlyeducationeducationallearningoperatedprimarypublicschoolspace
SHARED TOKENS (10): "age", "early", "education", "educational", "learning", "operated", "primary", "public", "school", "space". | EXACT TITLE in childcare_family: "Preschool".
0.400
designdifferentdocumentationindustrymanagementplanningprofessionalrequireswesternwork
SHARED TOKENS (10): "design", "different", "documentation", "industry", "management", "planning", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.380
Public records ↗ EXACT TITLE
agenciesconsidereddocumenteddocumentsgenerallyinformationjurisdictionpublicrecords
SHARED TOKENS (9): "agencies", "considered", "documented", "documents", "generally", "information", "jurisdiction", "public", "records". | EXACT TITLE in wedding_events: "Public records".
0.380
Cosmetology ↗ EXACT TITLE
applicationcostlicensemedianrequiredschoolstudytreatmentwage
SHARED TOKENS (9): "application", "cost", "license", "median", "required", "school", "study", "treatment", "wage". | EXACT TITLE in wedding_events: "Cosmetology".
0.380
acquisitionbusinesscontextentitiesfinancialgrouplargertransfertreatment
SHARED TOKENS (9): "acquisition", "business", "context", "entities", "financial", "group", "larger", "transfer", "treatment". | EXACT TITLE in wedding_events: "Consolidation (business)".
0.380
departmentdevelopmenteconomicidahoinsurancelabormanagedtechnologyworkforce
SHARED TOKENS (9): "department", "development", "economic", "idaho", "insurance", "labor", "managed", "technology", "workforce". | EXACT TITLE in wedding_events: "Idaho Department of Labor". | EXACT TITLE in childcare_family: "Idaho Department of Labor".
0.380
Prenatal care ↗ EXACT TITLE
availabilitychangesformhealthmedicalnutritionparentthroughouttype
SHARED TOKENS (9): "availability", "changes", "form", "health", "medical", "nutrition", "parent", "throughout", "type". | EXACT TITLE in childcare_family: "Prenatal care".
0.370
aroundassetsbusinesscapitalcentralfoodfranchisegrouphealthmanagementprivate
SHARED TOKENS (11): "around", "assets", "business", "capital", "central", "food", "franchise", "group", "health", "management", "private". | URL->B (1): https://www.roarkcapital.com/portfolio.
0.360
businesscommercialestategroupmanagementprofessionalrealview
SHARED TOKENS (8): "business", "commercial", "estate", "group", "management", "professional", "real", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.360
ageearlyeducationimportantprivateprogramroleschool
SHARED TOKENS (8): "age", "early", "education", "important", "private", "program", "role", "school". | EXACT TITLE in childcare_family: "Pre-kindergarten".
0.360
associationcommunityeventshelpidahonampaprofessionalriver
SHARED TOKENS (8): "association", "community", "events", "help", "idaho", "nampa", "professional", "river". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.360
arrangementscompositionconsideredcreatedesignfoundmarketingmaterial
SHARED TOKENS (8): "arrangements", "composition", "considered", "create", "design", "found", "marketing", "material". | EXACT TITLE in wedding_events: "Floral design".
0.360
Beer garden ↗ Q857909 EXACT TITLE
capitalfoodgardenlocaloutdoorremainservedshared
SHARED TOKENS (8): "capital", "food", "garden", "local", "outdoor", "remain", "served", "shared". | EXACT TITLE in wedding_events: "Beer garden".
0.360
Restaurant ↗ Q11707 EXACT TITLE
businessfamilyfoodgenerallymodelsservedservessingle
SHARED TOKENS (8): "business", "family", "food", "generally", "models", "served", "serves", "single". | EXACT TITLE in wedding_events: "Restaurant".
0.340
equipmentfinalgeneralindividualindustrylimitedtemporary
SHARED TOKENS (7): "equipment", "final", "general", "individual", "industry", "limited", "temporary". | EXACT TITLE in wedding_events: "Equipment rental".
0.340
Barn ↗ Q1303167 EXACT TITLE
activitiesbuildingbuildingsequipmenthousenorthstructures
SHARED TOKENS (7): "activities", "building", "buildings", "equipment", "house", "north", "structures". | EXACT TITLE in wedding_events: "Barn".
0.340
Unemployment ↗ Q41171 EXACT TITLE
addedageemploymentpeopleratherspecifiedwork
SHARED TOKENS (7): "added", "age", "employment", "people", "rather", "specified", "work". | EXACT TITLE in wedding_events: "Unemployment".
0.340
amongcannotfamilylawlegallegallyrequirements
SHARED TOKENS (7): "among", "cannot", "family", "law", "legal", "legally", "requirements". | EXACT TITLE in wedding_events: "Marriage law".
0.340
agenciesbusinessescapitalfinancialnonprofitprocessthough
SHARED TOKENS (7): "agencies", "businesses", "capital", "financial", "nonprofit", "process", "though". | EXACT TITLE in wedding_events: "Fundraising".
0.340
Officiant ↗ Q2015874 EXACT TITLE
facilityhealthlawlegalservespecifiedwork
SHARED TOKENS (7): "facility", "health", "law", "legal", "serve", "specified", "work". | EXACT TITLE in wedding_events: "Officiant".
0.320
businessesissuedlicenseofficialotherwisepermit
SHARED TOKENS (6): "businesses", "issued", "license", "official", "otherwise", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.320
Wedding ↗ Q49836 EXACT TITLE
authorityincorporatedpeoplepublicsocialspecial
SHARED TOKENS (6): "authority", "incorporated", "people", "public", "social", "special". | EXACT TITLE in wedding_events: "Wedding".
0.320
Boise River ↗ Q891080 EXACT TITLE
boiseidahoriversquareurbanwestern
SHARED TOKENS (6): "boise", "idaho", "river", "square", "urban", "western". | EXACT TITLE in wedding_events: "Boise River".
0.320
amongbuildingbuildingsbuiltcostsdesigned
SHARED TOKENS (6): "among", "building", "buildings", "built", "costs", "designed". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.300
Legal guardian ↗ Q157509 KW CROSS HIGH
ageauthoritycannotduefamilyfoundhousingimportantindividuallegalmedicalotherwisepersonalprofessionalpropertypublicrelevantservethough
SHARED TOKENS (19): "age", "authority", "cannot", "due", "family", "found", "housing", "important", "individual", "legal", "medical", "otherwise", "personal", "professional", "property", "public", "relevant", "serve", "though".
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
beyondcontractscontractualcontroldistinctdistinctioneventsgeneralgenerallygoverninggovernsintendeditselflawlegallegallymakesmateriallyobligationsordinary
SHARED TOKENS (32): "beyond", "contracts", "contractual", "control", "distinct", "distinction", "events", "general", "generally", "governing", "governs", "intended", "itself", "law", "legal", "legally", "makes", "materially", "obligations", "ordinary"....
0.300
agricultureanimalassociateddifferentdisplayedequipmenteventsfarmimportantlearningnorthpracticespublicrecreationshowswork
SHARED TOKENS (16): "agriculture", "animal", "associated", "different", "displayed", "equipment", "events", "farm", "important", "learning", "north", "practices", "public", "recreation", "shows", "work".
0.300
activeaddressadvertisingamongcurrentdatadigitalfirmsgenerallevelmanagementmarketingmediaplatformsproductspublicrathersocialstrategic
SHARED TOKENS (19): "active", "address", "advertising", "among", "current", "data", "digital", "firms", "general", "level", "management", "marketing", "media", "platforms", "products", "public", "rather", "social", "strategic".
0.300
aroundconnectedequipmentfacilitiesinfrastructuremunicipaloutdoorrequiresinglesitessmallsystemtreatmenttypeurban
SHARED TOKENS (15): "around", "connected", "equipment", "facilities", "infrastructure", "municipal", "outdoor", "require", "single", "sites", "small", "system", "treatment", "type", "urban".
0.300
changesconditionsconsidereddescribesdistinctearlyfacilityfunctionhealthleastlong-termmedicalorganizationphaseproblemreportreportedsystemthoughuses
SHARED TOKENS (21): "changes", "conditions", "considered", "describes", "distinct", "early", "facility", "function", "health", "least", "long-term", "medical", "organization", "phase", "problem", "report", "reported", "system", "though", "uses"....
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
agreementsamongapplicablebeyondcompletedconsideredcontroldistributioneducationalformformalgroupintellectualintendeditselfjurisdictionjurisdictionslawlegallicense
SHARED TOKENS (33): "agreements", "among", "applicable", "beyond", "completed", "considered", "control", "distribution", "educational", "form", "formal", "group", "intellectual", "intended", "itself", "jurisdiction", "jurisdictions", "law", "legal", "license"....
0.300
arrangementsdrivehomeinfluenceremains
SHARED TOKENS (5): "arrangements", "drive", "home", "influence", "remains". | EXACT TITLE in wedding_events: "Designated driver".
0.300
Adoption ↗ Q180472 KW CROSS HIGH
comprehensivecontractsdesignedformalgovernedgoverninghistoricallyintendedlegalparentprocessrequiresrightsspecifiedstatussystemstransfer
SHARED TOKENS (17): "comprehensive", "contracts", "designed", "formal", "governed", "governing", "historically", "intended", "legal", "parent", "process", "requires", "rights", "specified", "status", "systems", "transfer".
0.300
chaindifferentdirectlydistanceeconomyfinalmanagementmarketownedownershippositionproblemproducesproductsratherrelatedriversuppliessupplyvertical
SHARED TOKENS (20): "chain", "different", "directly", "distance", "economy", "final", "management", "market", "owned", "ownership", "position", "problem", "produces", "products", "rather", "related", "river", "supplies", "supply", "vertical".
0.300
ageallowingannuallybaseclubscommunitycompliancecomplydistributiondistrictfacilityfederalfinalfundinghomeindividualjurisdictionlandlawleast
SHARED TOKENS (48): "age", "allowing", "annually", "base", "clubs", "community", "compliance", "comply", "distribution", "district", "facility", "federal", "final", "funding", "home", "individual", "jurisdiction", "land", "law", "least"....
0.300
applicableassociationauthoritycentralchangescitiescommunitiescommunitycomprehensiveconditionscostscreatingdependdependsdesigndevelopmentdistrictseconomicexposurefacilities
SHARED TOKENS (45): "applicable", "association", "authority", "central", "changes", "cities", "communities", "community", "comprehensive", "conditions", "costs", "creating", "depend", "depends", "design", "development", "districts", "economic", "exposure", "facilities"....
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare". | EXACT TITLE in childcare_family: "Idaho Department of Health and Welfare".
0.300
businesscomconnectconnectscreatesdemanddevelopmentdigitaldirectdistincteconomicfoundgroupgroupshealthmaintenancemarketmarketsmedianetwork
SHARED TOKENS (39): "business", "com", "connect", "connects", "creates", "demand", "development", "digital", "direct", "distinct", "economic", "found", "group", "groups", "health", "maintenance", "market", "markets", "media", "network"....
0.300
Social work ↗ Q205398 KW CROSS HIGH
administrationagenciescommunitiescommunitydevelopmentdirectlyeducationfamiliesfamilyfunctioninggroupgroupshealthindividuallaborlargerlawmanagementneedspeople
SHARED TOKENS (37): "administration", "agencies", "communities", "community", "development", "directly", "education", "families", "family", "functioning", "group", "groups", "health", "individual", "labor", "larger", "law", "management", "needs", "people"....
0.300
acquisitionactivityassetsbusinesscapitalcentralcombinedcontrolcorporatecreatedepartmentdirectentitiesfederalgovernedlawlegalmanagementmarketoccurs
SHARED TOKENS (38): "acquisition", "activity", "assets", "business", "capital", "central", "combined", "control", "corporate", "create", "department", "direct", "entities", "federal", "governed", "law", "legal", "management", "market", "occurs"....
0.300
builtcommunitiesconnectedcontrolcustomerdatadigitalgroupindividualinfluencemanagementmarketingmarketsnetworkspeopleproductsrelatedreputationresultsreview
SHARED TOKENS (24): "built", "communities", "connected", "control", "customer", "data", "digital", "group", "individual", "influence", "management", "marketing", "markets", "networks", "people", "products", "related", "reputation", "results", "review"....
0.300
addressingamongdepartmentdivisioneconomicemployeefinancialgroupgroupshelpidentifiedindividualorganizationrequireresourcesschedulesturnoverworkersworkforce
SHARED TOKENS (19): "addressing", "among", "department", "division", "economic", "employee", "financial", "group", "groups", "help", "identified", "individual", "organization", "require", "resources", "schedules", "turnover", "workers", "workforce".
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activityallowsanimalchainchurchcommercialconditionsdistributionfacefoodformimportantlogisticspeoplepreservationproductsprotectionrathersecuritysolely
SHARED TOKENS (24): "activity", "allows", "animal", "chain", "church", "commercial", "conditions", "distribution", "face", "food", "form", "important", "logistics", "people", "preservation", "products", "protection", "rather", "security", "solely"....
0.300
adjacentaffectagriculturecharacteristicscommunitiesconnectcontroldistinctionecosystemengineeringevenfoodhealthimportantinfluencelandland-uselocalmanagementnational
SHARED TOKENS (35): "adjacent", "affect", "agriculture", "characteristics", "communities", "connect", "control", "distinction", "ecosystem", "engineering", "even", "food", "health", "important", "influence", "land", "land-use", "local", "management", "national"....
0.300
allowingcustomerdesigneddistinctdrivefamilyinfluenceinformationmarketingprimaryprocessreferralreferralssharetype
SHARED TOKENS (15): "allowing", "customer", "designed", "distinct", "drive", "family", "influence", "information", "marketing", "primary", "process", "referral", "referrals", "share", "type".
0.300
Distillation ↗ Q101017 KW CROSS HIGH
applicationscapablechangesidentifiesincreasematerialsmechanismoperateoperatesoperationoperationsphasephysicalpressureprocessproducesproductsrequiresresultingresults
SHARED TOKENS (24): "applications", "capable", "changes", "identifies", "increase", "materials", "mechanism", "operate", "operates", "operation", "operations", "phase", "physical", "pressure", "process", "produces", "products", "requires", "resulting", "results"....
0.300
First aid ↗ Q133981 KW CROSS HIGH
associatedconflictearlyequipmentgenerallyguidancehealthhelpindividuallevelmandatorymedicalmovepeoplepreservationprofessionalprovisionpublicregulationrelationship
SHARED TOKENS (31): "associated", "conflict", "early", "equipment", "generally", "guidance", "health", "help", "individual", "level", "mandatory", "medical", "move", "people", "preservation", "professional", "provision", "public", "regulation", "relationship"....
0.300
aroundcompletedcontainsdifferentdisplayedfrequentlyhistorichistoryhomehousenonprofitorganizationpeoplephysicalplacementpreservedrolesitesocialstandards
SHARED TOKENS (22): "around", "completed", "contains", "different", "displayed", "frequently", "historic", "history", "home", "house", "nonprofit", "organization", "people", "physical", "placement", "preserved", "role", "site", "social", "standards"....
0.300
activitiesaddressingcentercomprehensivedataestablishestablishedfederalfinancialidentifiesinformationlawnationalofficepreventionprogramspublicresearchrolesupporting
SHARED TOKENS (21): "activities", "addressing", "center", "comprehensive", "data", "establish", "established", "federal", "financial", "identifies", "information", "law", "national", "office", "prevention", "programs", "public", "research", "role", "supporting"....
0.300
Food truck ↗ KW CROSS HIGH
amongcommercialdailyeconomicestimatedfoodincreasinglyindustrymajoroperationpeopleregionalservesurroundingthoughwaterworkers
SHARED TOKENS (17): "among", "commercial", "daily", "economic", "estimated", "food", "increasingly", "industry", "major", "operation", "people", "regional", "serve", "surrounding", "though", "water", "workers".
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
compensationcontextcontractscontractualdifferentdueeventsexpresslyforminsuranceitselflawlimitedmedicaloperationownerprincipalrelationshiprelevantspecified
SHARED TOKENS (20): "compensation", "context", "contracts", "contractual", "different", "due", "events", "expressly", "form", "insurance", "itself", "law", "limited", "medical", "operation", "owner", "principal", "relationship", "relevant", "specified".
0.300
accessibilityadaagainstbusinesschangescharacteristicscostsemployersfinalhouseidentitylawnationalprohibitsprotectionpublicrequirementsrequiresrights
SHARED TOKENS (19): "accessibility", "ada", "against", "business", "changes", "characteristics", "costs", "employers", "final", "house", "identity", "law", "national", "prohibits", "protection", "public", "requirements", "requires", "rights".
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscitiescontroldepartmentexperiencesfacilitiesfloorhelpintendedjurisdictionslimitedmajornorthparkingpeoplepermitrequirerequiressuburbanthem
SHARED TOKENS (22): "buildings", "cities", "control", "department", "experiences", "facilities", "floor", "help", "intended", "jurisdictions", "limited", "major", "north", "parking", "people", "permit", "require", "requires", "suburban", "them"....
0.300
accessactivitiesadvertisingbusinessescontextcurrentdatadocumenteddriveevenformgenerallygeographichealthindoorinformationlocalnavigationnetworkpersonal
SHARED TOKENS (31): "access", "activities", "advertising", "businesses", "context", "current", "data", "documented", "drive", "even", "form", "generally", "geographic", "health", "indoor", "information", "local", "navigation", "network", "personal"....
0.300
acquisitionamongbuiltchangescharacteristicscontextdevelopmentdifferenteducationalexecutiveexpandedfunctionsidentityindividualinfluencemajorongoingpersonalphysicalresearch
SHARED TOKENS (24): "acquisition", "among", "built", "changes", "characteristics", "context", "development", "different", "educational", "executive", "expanded", "functions", "identity", "individual", "influence", "major", "ongoing", "personal", "physical", "research"....
0.300
activeadvertisingaffectallowingapplicationsbrandbusinessesconnectcostcreatecreatedcustomerdueentryexperiencesimagesinfluenceinformationmedianews
SHARED TOKENS (33): "active", "advertising", "affect", "allowing", "applications", "brand", "businesses", "connect", "cost", "create", "created", "customer", "due", "entry", "experiences", "images", "influence", "information", "media", "news"....
0.300
Child neglect ↗ Q559562 KW CROSS HIGH
agedependsdifferentdirectdutieseducationalemploymentestablishedfederalformhealthhousinglawlegallegallyneedsnutritionotherwisephysicalrequired
SHARED TOKENS (27): "age", "depends", "different", "direct", "duties", "educational", "employment", "established", "federal", "form", "health", "housing", "law", "legal", "legally", "needs", "nutrition", "otherwise", "physical", "required"....
0.300
changescontinuityexperienceexperiencesinformationlegalmultiplenationalneedsorganizationprocessprovidersremainservespecialsupportssystemthroughoutwelfare
SHARED TOKENS (19): "changes", "continuity", "experience", "experiences", "information", "legal", "multiple", "national", "needs", "organization", "process", "providers", "remain", "serve", "special", "supports", "system", "throughout", "welfare".
0.300
contextcostsdevelopmentdiscoveryfinancialhomeinformationlearningmaintenancemajormediamultiplenewsongoingoperateoperatorsplatformplatformsproductsprovision
SHARED TOKENS (31): "context", "costs", "development", "discovery", "financial", "home", "information", "learning", "maintenance", "major", "media", "multiple", "news", "ongoing", "operate", "operators", "platform", "platforms", "products", "provision"....
0.300
administrationbusinesscapitalcompensationcreatingdepartmentsdesigndevelopmentdocumentingdueearlyemployeelabormanagementorganizationpeopleplanningprogramsresearchresources
SHARED TOKENS (28): "administration", "business", "capital", "compensation", "creating", "departments", "design", "development", "documenting", "due", "early", "employee", "labor", "management", "organization", "people", "planning", "programs", "research", "resources"....
0.300
activitiesadministrationanalysisassociateassociatedcapacitycontrolcreatecustomereducationfamilyhealthhomeidentifiedimageslaborlawmanagementmediaorganization
SHARED TOKENS (35): "activities", "administration", "analysis", "associate", "associated", "capacity", "control", "create", "customer", "education", "family", "health", "home", "identified", "images", "labor", "law", "management", "media", "organization"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
createdigitalequipmenteveneventsfunctionshostleastmediaprivateprogramspublicrealrecordrecordssimultaneouslysmallstationsthemtitle
SHARED TOKENS (21): "create", "digital", "equipment", "even", "events", "functions", "host", "least", "media", "private", "programs", "public", "real", "record", "records", "simultaneously", "small", "stations", "them", "title"....
0.300
arrangementsbrandbusinesscontractscontroldesigndirectentryfeefunctionsindustryinvestmentlicensinglocallowermanagementoperatingoperationoperationalpersonnel
SHARED TOKENS (27): "arrangements", "brand", "business", "contracts", "control", "design", "direct", "entry", "fee", "functions", "industry", "investment", "licensing", "local", "lower", "management", "operating", "operation", "operational", "personnel"....
0.300
activitiesactivityattendancebuildingcenterchurchcommercialcommunitydifferentearlyeducationalexperiencefinalinsideleadoutsidepopulationprimaryprogramprograms
SHARED TOKENS (28): "activities", "activity", "attendance", "building", "center", "church", "commercial", "community", "different", "early", "educational", "experience", "final", "inside", "lead", "outside", "population", "primary", "program", "programs"....
0.300
authoritiesauthoritybuildingbuildingsbusinesscapitalcenterscommercialcontainingestatefarmfloorfunctionshousingincomeintendedinvestmentlandleastlocal
SHARED TOKENS (30): "authorities", "authority", "building", "buildings", "business", "capital", "centers", "commercial", "containing", "estate", "farm", "floor", "functions", "housing", "income", "intended", "investment", "land", "least", "local"....
0.300
agreementsbuildingscenterscommunitiesconnectiondocumentseconomicfuturegroupindustryintellectualknowledgelandscapeslegallocalmajornationalphysicalpreservationpreserved
SHARED TOKENS (26): "agreements", "buildings", "centers", "communities", "connection", "documents", "economic", "future", "group", "industry", "intellectual", "knowledge", "landscapes", "legal", "local", "major", "national", "physical", "preservation", "preserved"....
0.300
Vineyard ↗ Q22715 EXACT TITLE
characteristicsitselfpracticesciencestudy
SHARED TOKENS (5): "characteristics", "itself", "practice", "science", "study". | EXACT TITLE in wedding_events: "Vineyard".
0.300
activitiescommunitydifferenteventsfederalgenerallylocalmanagementneedspreventionprofessionalrequiresresponserisksearch
SHARED TOKENS (15): "activities", "community", "different", "events", "federal", "generally", "local", "management", "needs", "prevention", "professional", "requires", "response", "risk", "search".
0.300
activeagenciesallowsassociatedbusinessescapacitydistributioneconomicemploymententryfirmsfunctionimportantindustrylandlawmarketorganizationpracticeprices
SHARED TOKENS (31): "active", "agencies", "allows", "associated", "businesses", "capacity", "distribution", "economic", "employment", "entry", "firms", "function", "important", "industry", "land", "law", "market", "organization", "practice", "prices"....
0.300
accessaffectsconditionscreatescurriculumdatademonstratesdescribesdocumentdocumentseducationeducationaleligibleexperiencefederalformgeneralhealthhelpidentified
SHARED TOKENS (45): "access", "affects", "conditions", "creates", "curriculum", "data", "demonstrates", "describes", "document", "documents", "education", "educational", "eligible", "experience", "federal", "form", "general", "health", "help", "identified"....
0.300
accountactivitiesaddressadvertisingbrandbroaderbusinessbusinessescentralcreatedirectestablisheventsexecutiveexposurefirmsformindividualinfluenceinformation
SHARED TOKENS (49): "account", "activities", "address", "advertising", "brand", "broader", "business", "businesses", "central", "create", "direct", "establish", "events", "executive", "exposure", "firms", "form", "individual", "influence", "information"....
0.300
groupsinvestigatorslawprivatework
SHARED TOKENS (5): "groups", "investigators", "law", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.300
accessadditionalageassociatedconnectedconsideredcontroldefinesearlyeducationalestimatedexperiencefacehealthincomelaborlegallylowermedicaloccurs
SHARED TOKENS (29): "access", "additional", "age", "associated", "connected", "considered", "control", "defines", "early", "educational", "estimated", "experience", "face", "health", "income", "labor", "legally", "lower", "medical", "occurs"....
0.300
applicationsaroundcategorycombinedconsumercontainingcontrolscreateddigitaldueearlyexposurefinalformfunctionshistoryimagesincorporatedindustrylevel
SHARED TOKENS (38): "applications", "around", "category", "combined", "consumer", "containing", "controls", "created", "digital", "due", "early", "exposure", "final", "form", "functions", "history", "images", "incorporated", "industry", "level"....
0.300
advertisingagenciescreatedigitaldisplayedformfrequentlyhelpincreaseincreasinglyindependentmarketingmediamultipleoperatingplatformspracticesproductsregulationresearch
SHARED TOKENS (27): "advertising", "agencies", "create", "digital", "displayed", "form", "frequently", "help", "increase", "increasingly", "independent", "marketing", "media", "multiple", "operating", "platforms", "practices", "products", "regulation", "research"....
0.300
agenciesarchitectureconditionscontroldesignengineeringestategeneralinfrastructurejurisdictionslicenselicensedlicensesmanagementoutdoorplanningpossessprivateprofessionalprovision
SHARED TOKENS (30): "agencies", "architecture", "conditions", "control", "design", "engineering", "estate", "general", "infrastructure", "jurisdictions", "license", "licensed", "licenses", "management", "outdoor", "planning", "possess", "private", "professional", "provision"....
0.300
activityadministrationagealoneassociationcirculationcombinedconditionscurrentearlyelectricalfunctiongeneralleastmaintainratherrequiressubjecttreatmentuntil
SHARED TOKENS (20): "activity", "administration", "age", "alone", "association", "circulation", "combined", "conditions", "current", "early", "electrical", "function", "general", "least", "maintain", "rather", "requires", "subject", "treatment", "until".
0.300
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciescommunityfoundgenerallyindustrylicensesprofessionalprojectremainrequiredschedulesthemwhosework
SHARED TOKENS (15): "access", "agencies", "community", "found", "generally", "industry", "licenses", "professional", "project", "remain", "required", "schedules", "them", "whose", "work".
0.300
Vocational education ↗ KW CROSS HIGH
collegecommunitydesignedeconomiceducationeducationalformalgeneralindividualinformalknowledgelearningleveloccupationrelatedschoolschoolssocialtechnologytraining
SHARED TOKENS (22): "college", "community", "designed", "economic", "education", "educational", "formal", "general", "individual", "informal", "knowledge", "learning", "level", "occupation", "related", "school", "schools", "social", "technology", "training"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycapablecreateddifferentestatefacilitylandlegallocaloperateotherwiseownerownershippathpeoplephysicalprivaterealretainrights
SHARED TOKENS (25): "authority", "capable", "created", "different", "estate", "facility", "land", "legal", "local", "operate", "otherwise", "owner", "ownership", "path", "people", "physical", "private", "real", "retain", "rights"....
0.300
agecommunitiesdevelopmentearlyeducationalfamilieslimitedmissionphysicalreceiveresourcesrisksocialsupportsupportssystemthem
SHARED TOKENS (17): "age", "communities", "development", "early", "educational", "families", "limited", "mission", "physical", "receive", "resources", "risk", "social", "support", "supports", "system", "them".
0.300
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialdistinctequipmenthomeindustrylargerleastmakesprocessprotectionsizesocialworkers
SHARED TOKENS (15): "built", "business", "commercial", "distinct", "equipment", "home", "industry", "larger", "least", "makes", "process", "protection", "size", "social", "workers".
0.300
clubscodedevelopmenthealthlocalnetworknonprofitoperatesorganizationprogramsregionalsafeservessupporttitle
SHARED TOKENS (15): "clubs", "code", "development", "health", "local", "network", "nonprofit", "operates", "organization", "programs", "regional", "safe", "serves", "support", "title".
0.300
ageeducationfederalgeneralimportantindividualinformationlawlearningleastlevelnationalneedsparentparticipationpracticeprogramprogramsprovisionspublic
SHARED TOKENS (24): "age", "education", "federal", "general", "important", "individual", "information", "law", "learning", "least", "level", "national", "needs", "parent", "participation", "practice", "program", "programs", "provisions", "public"....
0.300
boisebrandconsumercreateddatademandidaholatestmajormarketownedproductsreachservedtechnologyuntil
SHARED TOKENS (16): "boise", "brand", "consumer", "created", "data", "demand", "idaho", "latest", "major", "market", "owned", "products", "reach", "served", "technology", "until".
0.300
additionalallowscategoriesdepartmentdivisioneligibleemployeeemployersfacefamilylaborlawleastmajormedicalpublicrequiringwageweekswork
SHARED TOKENS (21): "additional", "allows", "categories", "department", "division", "eligible", "employee", "employers", "face", "family", "labor", "law", "least", "major", "medical", "public", "requiring", "wage", "weeks", "work"....
0.300
Play therapy ↗ Q1542331 KW CROSS HIGH
accountcodescontextdevelopmentexperiencesgenerallyhealthindividualknowledgeneedspeoplepersonalpracticeprocessprofessionalrelationshipsocialsubjecttrainingwestern
SHARED TOKENS (20): "account", "codes", "context", "development", "experiences", "generally", "health", "individual", "knowledge", "needs", "people", "personal", "practice", "process", "professional", "relationship", "social", "subject", "training", "western".
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
advertisingaloneapplicationassociatedbeyondconsumercreatingcustomerdemanddesigndevelopmentdifferentdigitaldistinctestablishedgroupsgrowthinformationintendedknowledge
SHARED TOKENS (33): "advertising", "alone", "application", "associated", "beyond", "consumer", "creating", "customer", "demand", "design", "development", "different", "digital", "distinct", "established", "groups", "growth", "information", "intended", "knowledge"....
0.300
accountadditionaladdresscomprehensivecontroldifferentestablishedgenerallyjurisdictionslegallevellocalmunicipalnationalpoliceprivatepublicregulationresidentssource
SHARED TOKENS (23): "account", "additional", "address", "comprehensive", "control", "different", "established", "generally", "jurisdictions", "legal", "level", "local", "municipal", "national", "police", "private", "public", "regulation", "residents", "source"....
0.300
accountageallowingbeyondconsideredgeneralincreaseslawleastlegalmedicalrequirerightsstatutethoughuntil
SHARED TOKENS (16): "account", "age", "allowing", "beyond", "considered", "general", "increases", "law", "least", "legal", "medical", "require", "rights", "statute", "though", "until".
0.300
addressbuildingsconnectedconsidereddistinctiondistinguisheventsimportantindustryintendedlargerlivemakesmarketsmultipleprocessingprofessionalpublicsinglesmall
SHARED TOKENS (25): "address", "buildings", "connected", "considered", "distinction", "distinguish", "events", "important", "industry", "intended", "larger", "live", "makes", "markets", "multiple", "processing", "professional", "public", "single", "small"....
0.300
additionalagenciesfamilyhealthhomeindividualinstitutionalintellectuallong-termneedspeopleratherrequiredresidentialsupport
SHARED TOKENS (15): "additional", "agencies", "family", "health", "home", "individual", "institutional", "intellectual", "long-term", "needs", "people", "rather", "required", "residential", "support".
0.300
accessallowingarrangementsassociationauthoritiescoordinationcostsdevelopmentdueeconomicestatefinancialfrequentlyfundinggeneralgeographicindustryinfrastructureintendedinvestment
SHARED TOKENS (51): "access", "allowing", "arrangements", "association", "authorities", "coordination", "costs", "development", "due", "economic", "estate", "financial", "frequently", "funding", "general", "geographic", "industry", "infrastructure", "intended", "investment"....
0.300
againstamongauthorityavailabilitycitiesconcentrateddistrictdistrictsearlyeconomiceconomyexplicitlyhousingincreasejurisdictionlandlocallowermajoroperating
SHARED TOKENS (37): "against", "among", "authority", "availability", "cities", "concentrated", "district", "districts", "early", "economic", "economy", "explicitly", "housing", "increase", "jurisdiction", "land", "local", "lower", "major", "operating"....
0.300
advertisingbusinessbusinessescommercialconditionsduedutiesgeneralgenerallyinsurancelinemarketmedicaloperationspersonalpolicyprofessionalpropertypublicseparate
SHARED TOKENS (21): "advertising", "business", "businesses", "commercial", "conditions", "due", "duties", "general", "generally", "insurance", "line", "market", "medical", "operations", "personal", "policy", "professional", "property", "public", "separate"....
0.300
Respite care ↗ Q7315937 KW CROSS HIGH
amongexperiencefamiliesfamilyfinancialfundhealthhelphomelong-termmaintainpercentpersonalphysicalprimaryprogramsqualityregulatedrelationshipreported
SHARED TOKENS (25): "among", "experience", "families", "family", "financial", "fund", "health", "help", "home", "long-term", "maintain", "percent", "personal", "physical", "primary", "programs", "quality", "regulated", "relationship", "reported"....
0.300
addedadditionalapplicableauthoritydemanddistrictfacegeneralgenerallygovernedidaholevellocalnationalpriceproductsrequireresidentsrulesstatewide
SHARED TOKENS (23): "added", "additional", "applicable", "authority", "demand", "district", "face", "general", "generally", "governed", "idaho", "level", "local", "national", "price", "products", "require", "residents", "rules", "statewide"....
0.300
announcedapprovedcentercreateitselfnetworknorthoperatesoperatingprincipalprojectreachregulatorsreportingroadsystemtransportationwestern
SHARED TOKENS (18): "announced", "approved", "center", "create", "itself", "network", "north", "operates", "operating", "principal", "project", "reach", "regulators", "reporting", "road", "system", "transportation", "western".
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adabaseboisecentercombinedcommercialdepartmentfacilityfirefunctionsgeneralidahoincreasenationaloperatedoperatesprotectionreceiverequiringrights
SHARED TOKENS (24): "ada", "base", "boise", "center", "combined", "commercial", "department", "facility", "fire", "functions", "general", "idaho", "increase", "national", "operated", "operates", "protection", "receive", "requiring", "rights"....
0.300
administrativeagenciesauthoritybuildingscentraldepartmentdevelopmentdifferentdirectlydistinctfamiliesformgenerallyhomehousingindividuallocalmanagednationalneeds
SHARED TOKENS (34): "administrative", "agencies", "authority", "buildings", "central", "department", "development", "different", "directly", "distinct", "families", "form", "generally", "home", "housing", "individual", "local", "managed", "national", "needs"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesassetsbusinesscategoriescodecommercialconsideredconsumercreatedistrictemploymententitiesfinancefinancialfinancingfoodframeworkgeneralgoverninginsurance
SHARED TOKENS (41): "activities", "assets", "business", "categories", "code", "commercial", "considered", "consumer", "create", "district", "employment", "entities", "finance", "financial", "financing", "food", "framework", "general", "governing", "insurance"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesschaincommercialdataindustrymanagementmarketingplatformsprocessingproductssegmentsupplysystemstransactiontransfertype
SHARED TOKENS (17): "activities", "business", "chain", "commercial", "data", "industry", "management", "marketing", "platforms", "processing", "products", "segment", "supply", "systems", "transaction", "transfer", "type".
0.300
accessibilityactivitiesassociatedbroaderbusinesscategoriesdevelopmentdistrictsfrequentlygenerallyimpliesincreaseslinkslocalpeoplepropertyratherrulessafetysingle
SHARED TOKENS (26): "accessibility", "activities", "associated", "broader", "business", "categories", "development", "districts", "frequently", "generally", "implies", "increases", "links", "local", "people", "property", "rather", "rules", "safety", "single"....
0.300
Ridesharing company ↗ KW CROSS HIGH
backgroundcannotchecksconsideredcustomerdemanddueindependentinsuranceissuedjurisdictionlegallylicensinglocalmodeloperateoperationsreceivesrequiredrequirements
SHARED TOKENS (24): "background", "cannot", "checks", "considered", "customer", "demand", "due", "independent", "insurance", "issued", "jurisdiction", "legally", "licensing", "local", "model", "operate", "operations", "receives", "required", "requirements"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
activebusinesscapitalcategorychangescontroldevelopmentexpansionfinancefinancialfinancingfirmsfundgeneralinvestmentlimitedlong-termmanagementoperationalotherwise
SHARED TOKENS (30): "active", "business", "capital", "category", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firms", "fund", "general", "investment", "limited", "long-term", "management", "operational", "otherwise"....
0.300
addressapplicationsbuildingbuildingscommercialdistancedistributionequipmenteventsfacilitiesgenerallyincreasesinstitutionallivemultiplepublicrelatedrequiresschoolschools
SHARED TOKENS (25): "address", "applications", "building", "buildings", "commercial", "distance", "distribution", "equipment", "events", "facilities", "generally", "increases", "institutional", "live", "multiple", "public", "related", "requires", "school", "schools"....
0.300
Kinship care ↗ Q5595400 KW CROSS HIGH
communitiesexperiencefamiliesfamilyformalhomeincreaselegalmaintainplacementrelatedrelationshipschoolssystemunrelated
SHARED TOKENS (15): "communities", "experience", "families", "family", "formal", "home", "increase", "legal", "maintain", "placement", "related", "relationship", "schools", "system", "unrelated".
0.300
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesassociatedchaindistributeddistributionequipmentfoodfunctioninglogisticsmaintainmanagementproductsqualityrequiressafetysensitivesupplyuses
SHARED TOKENS (18): "activities", "associated", "chain", "distributed", "distribution", "equipment", "food", "functioning", "logistics", "maintain", "management", "products", "quality", "requires", "safety", "sensitive", "supply", "uses".
0.300
againstamongcreatedcreatingdeclinedirectearlyestablishedfamiliesfederalinsurancelaborlawmajornationalpeopleprogramprogramssecuritysingle
SHARED TOKENS (25): "against", "among", "created", "creating", "decline", "direct", "early", "established", "families", "federal", "insurance", "labor", "law", "major", "national", "people", "program", "programs", "security", "single"....
0.300
addressageamongcontextdifferentearlyeconomicemployersentryformalfoundfunctionsgeneralindividualjurisdictionslawlegallivelong-termlower
SHARED TOKENS (37): "address", "age", "among", "context", "different", "early", "economic", "employers", "entry", "formal", "found", "functions", "general", "individual", "jurisdictions", "law", "legal", "live", "long-term", "lower"....
0.300
approvalapprovalsapprovedbuildingcommercialcontextcostscreatesdesigndevelopmentdifferenteconomicestatefinancialfinancinggrowthhousingincreaselandlower
SHARED TOKENS (40): "approval", "approvals", "approved", "building", "commercial", "context", "costs", "creates", "design", "development", "different", "economic", "estate", "financial", "financing", "growth", "housing", "increase", "land", "lower"....
0.300
Marquee ↗ Q1621931 KW CROSS HIGH
buildingchainchannelcoveringgenerallyhtmlindoormakesnetworkpageregionalsinglesmallstructuretemporarytexttype
SHARED TOKENS (17): "building", "chain", "channel", "covering", "generally", "html", "indoor", "makes", "network", "page", "regional", "single", "small", "structure", "temporary", "text", "type".
🫐 BERRY60 edges
0.280
administrationbusinesscentersclubscollegedepartmentindustrymanagementmarketingrelevantschoolstudysubjectuniversity
SHARED TOKENS (14): "administration", "business", "centers", "clubs", "college", "department", "industry", "management", "marketing", "relevant", "school", "study", "subject", "university".
0.280
functionshealthjurisdictionrecords
SHARED TOKENS (4): "functions", "health", "jurisdiction", "records". | EXACT TITLE in wedding_events: "Vital statistics".
0.280
controldifferentdocumentationinsurancelogisticsmanagementmaterialsmovepeopleplanningpurchasingroadtrafficworking
SHARED TOKENS (14): "control", "different", "documentation", "insurance", "logistics", "management", "materials", "move", "people", "planning", "purchasing", "road", "traffic", "working".
0.280
Use tax ↗ Q17155766 EXACT TITLE
personalpropertysubjecttype
SHARED TOKENS (4): "personal", "property", "subject", "type". | EXACT TITLE in wedding_events: "Use tax".
0.280
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingbusinessescitiescommunitiesdueeconomicgrowthhousinginfrastructurelandprivateprocesspublicurban
SHARED TOKENS (14): "addressing", "businesses", "cities", "communities", "due", "economic", "growth", "housing", "infrastructure", "land", "private", "process", "public", "urban".
0.280
Quinceañera ↗ EXACT TITLE
agedifferentfoodpractices
SHARED TOKENS (4): "age", "different", "food", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.260
Interior design ↗ KW CROSS HIGH
buildingdesigndevelopmenthelpinspectionsmanagementpeopleplanningprojectresearchsciencesitespace
SHARED TOKENS (13): "building", "design", "development", "help", "inspections", "management", "people", "planning", "project", "research", "science", "site", "space".
0.260
Baker ↗ Q160131 EXACT TITLE
concentratedproductssource
SHARED TOKENS (3): "concentrated", "products", "source". | EXACT TITLE in wedding_events: "Baker". | EXACT TITLE in childcare_family: "Baker".
0.260
activitybusinessbusinessescategoriescategorycodedirectoryduefunctioninformationsearchsizetype
SHARED TOKENS (13): "activity", "business", "businesses", "categories", "category", "code", "directory", "due", "function", "information", "search", "size", "type".
0.260
Child abuse ↗ Q167191 KW CROSS HIGH
communitiesdifferentfamilieshomejurisdictionsmandatoryparentphysicalreportingrequirementsresultsschoolstherefore
SHARED TOKENS (13): "communities", "different", "families", "home", "jurisdictions", "mandatory", "parent", "physical", "reporting", "requirements", "results", "schools", "therefore".
0.260
Trinity Health ↗ KW CROSS HIGH
comprehensivecontinuingfacilitieshealthhomeidahonetworknorthoperatesoperatingpeoplesupportsystem
SHARED TOKENS (13): "comprehensive", "continuing", "facilities", "health", "home", "idaho", "network", "north", "operates", "operating", "people", "support", "system".
0.260
Decoration ↗ Q1232942 EXACT TITLE
houseincreaseintended
SHARED TOKENS (3): "house", "increase", "intended". | EXACT TITLE in wedding_events: "Decoration".
0.260
annuallyapplicableassociatedirectlyeconomicestimatedevenexposurefoodleastrequiringresponseresulting
SHARED TOKENS (13): "annually", "applicable", "associate", "directly", "economic", "estimated", "even", "exposure", "food", "least", "requiring", "response", "resulting".
0.260
applicationscontrolcorporatedifferentequipmenteventsliveoperatepeoplepersonnelshowsspecialwork
SHARED TOKENS (13): "applications", "control", "corporate", "different", "equipment", "events", "live", "operate", "people", "personnel", "shows", "special", "work".
0.260
capitalconsumerprivate
SHARED TOKENS (3): "capital", "consumer", "private". | EXACT TITLE in childcare_family: "Sycamore Partners".
0.260
Pediatrics ↗ Q123028 KW CROSS HIGH
agecentersgeneralinsurancemedicalpeoplepracticerequiresresearchresourcesuniversitiesuntilwork
SHARED TOKENS (13): "age", "centers", "general", "insurance", "medical", "people", "practice", "requires", "research", "resources", "universities", "until", "work".
0.250
currentexecutiveidahoofficeposition
SHARED TOKENS (5): "current", "executive", "idaho", "office", "position". | URL->A (1): https://sos.idaho.gov/.
0.240
activearoundeligiblefundinggrouplistmissionorganizationsocialstafftypewhose
SHARED TOKENS (12): "active", "around", "eligible", "funding", "group", "list", "mission", "organization", "social", "staff", "type", "whose".
0.240
documentsestatemaintainsofficeownerownershippositionpropertypublicrealrecordsrights
SHARED TOKENS (12): "documents", "estate", "maintains", "office", "owner", "ownership", "position", "property", "public", "real", "records", "rights".
0.240
ageduelawlegallymandatorypeoplepolicereportreportingrequiredrisksubject
SHARED TOKENS (12): "age", "due", "law", "legally", "mandatory", "people", "police", "report", "reporting", "required", "risk", "subject".
0.240
Calligraphy ↗ Q12681 KW CROSS HIGH
designdocumentsformimagesindividuallevelpracticerelatedtextthoughtypewestern
SHARED TOKENS (12): "design", "documents", "form", "images", "individual", "level", "practice", "related", "text", "though", "type", "western".
0.240
aroundevenfamiliesfamilyfoodformlineratherreceiveseparatesocialwhose
SHARED TOKENS (12): "around", "even", "families", "family", "food", "form", "line", "rather", "receive", "separate", "social", "whose".
0.220
communitiesfamiliesfederalgovernsjurisdictionlawlivenovemberplacementresultingwelfare
SHARED TOKENS (11): "communities", "families", "federal", "governs", "jurisdiction", "law", "live", "november", "placement", "resulting", "welfare".
0.220
Photo booth ↗ Q494312 EXACT TITLE
containsdigital
SHARED TOKENS (2): "contains", "digital". | EXACT TITLE in wedding_events: "Photo booth".
0.210
floor
SHARED TOKENS (1): "floor". | EXACT TITLE in wedding_events: "Dance floor".
0.210
idaho
SHARED TOKENS (1): "idaho". | EXACT TITLE in childcare_family: "Frank R. Gooding".
0.210
Fairground ↗ Q5430425 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in wedding_events: "Fairground".
0.200
activitieseducationexperiencesgrouplearningoutdoorpracticesprogramsresidentialschool
SHARED TOKENS (10): "activities", "education", "experiences", "group", "learning", "outdoor", "practices", "programs", "residential", "school".
0.200
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricthouseidahopopulationschoolschoolsshared
SHARED TOKENS (10): "ada", "boise", "canyon", "district", "house", "idaho", "population", "school", "schools", "shared".
0.200
consideredfamilygenerallylawliveorganizationoutsidepublicrightsthough
SHARED TOKENS (10): "considered", "family", "generally", "law", "live", "organization", "outside", "public", "rights", "though".
0.200
activitiesbusinessdefineshomelimitedorganizationoutsidepeopleprimaryworking
SHARED TOKENS (10): "activities", "business", "defines", "home", "limited", "organization", "outside", "people", "primary", "working".
0.200
Review site ↗ Q1340449 KW CROSS HIGH
businesseschannelcomearlypeopleproductsprofessionalreviewsitesites
SHARED TOKENS (10): "businesses", "channel", "com", "early", "people", "products", "professional", "review", "site", "sites".
0.200
consideredcreatesemploymentlaborlawpeopleprohibitsstandardswagework
SHARED TOKENS (10): "considered", "creates", "employment", "labor", "law", "people", "prohibits", "standards", "wage", "work".
0.200
Train station ↗ Q55488 KW CROSS HIGH
accommodatebuildingfacilitygenerallyleastlevellineplatformstationssystems
SHARED TOKENS (10): "accommodate", "building", "facility", "generally", "least", "level", "line", "platform", "stations", "systems".
0.180
boisebuildingbuiltfeethistoricidaholevelnationalopened
SHARED TOKENS (9): "boise", "building", "built", "feet", "historic", "idaho", "level", "national", "opened".
0.180
intendedlicensedlicensinglimitedownersrightsseparateuseswork
SHARED TOKENS (9): "intended", "licensed", "licensing", "limited", "owners", "rights", "separate", "uses", "work".
0.180
Hairstyle ↗ Q327496 KW CROSS HIGH
consideredfacefrequentlyhomeinfluenceoutsidepersonalspecialthough
SHARED TOKENS (9): "considered", "face", "frequently", "home", "influence", "outside", "personal", "special", "though".
0.180
Crowd control ↗ Q1872073 KW CROSS HIGH
controleventsmanagedmanagementpeoplepolicepracticepublicsecurity
SHARED TOKENS (9): "control", "events", "managed", "management", "people", "police", "practice", "public", "security".
0.180
boisecitieshomeidaholinemajornearriverserves
SHARED TOKENS (9): "boise", "cities", "home", "idaho", "line", "major", "near", "river", "serves".
0.160
adaboisegardenidahomunicipalpopulationsecondseparate
SHARED TOKENS (8): "ada", "boise", "garden", "idaho", "municipal", "population", "second", "separate".
0.160
Volunteering ↗ Q188844 KW CROSS HIGH
communityeducationgroupindividuallaborresponsetrainingwork
SHARED TOKENS (8): "community", "education", "group", "individual", "labor", "response", "training", "work".
0.160
Wedding cake ↗ Q558133 KW CROSS HIGH
builtcostevenrealservedsharesinglewestern
SHARED TOKENS (8): "built", "cost", "even", "real", "served", "share", "single", "western".
0.160
coveringeducationgeneralindividualparentprogramprogramstraining
SHARED TOKENS (8): "covering", "education", "general", "individual", "parent", "program", "programs", "training".
0.160
caldwellcanyondistrictextendsidaholandnampaschool
SHARED TOKENS (8): "caldwell", "canyon", "district", "extends", "idaho", "land", "nampa", "school".
0.140
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaadditionalboiseidahokunapercentpopulation
SHARED TOKENS (7): "ada", "additional", "boise", "idaho", "kuna", "percent", "population".
0.140
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargermakesproducesproperty
SHARED TOKENS (7): "building", "business", "equipment", "larger", "makes", "produces", "property".
0.140
analysisestablishfireknowledgerequiresciencesecond
SHARED TOKENS (7): "analysis", "establish", "fire", "knowledge", "require", "science", "second".
0.120
Mobile catering ↗ KW CROSS HIGH
businesscorporateeventsfoodpeopleurban
SHARED TOKENS (6): "business", "corporate", "events", "food", "people", "urban".
0.120
Shuttle bus ↗ Q1368498 KW CROSS HIGH
applicationsdesignedgroupspeoplestudentsuniversity
SHARED TOKENS (6): "applications", "designed", "groups", "people", "students", "university".
0.120
categoryestatefoodindustryplanningreal
SHARED TOKENS (6): "category", "estate", "food", "industry", "planning", "real".
0.120
developmentfamiliesinfluencepopulationpreventiontreatment
SHARED TOKENS (6): "development", "families", "influence", "population", "prevention", "treatment".
0.120
additionalbrandchaindevelopmentpipelineresidence
SHARED TOKENS (6): "additional", "brand", "chain", "development", "pipeline", "residence".
0.120
operatesplanningplatformsportfolioresourcestechnology
SHARED TOKENS (6): "operates", "planning", "platforms", "portfolio", "resources", "technology".
0.120
architecturebuildingsfoundratherrelationshipsecond
SHARED TOKENS (6): "architecture", "buildings", "found", "rather", "relationship", "second".
0.120
approvedfamilieslawnovemberpublicsafe
SHARED TOKENS (6): "approved", "families", "law", "november", "public", "safe".
0.120
Equestrianism ↗ KW CROSS HIGH
activitiesdescriptiontransportationwelfareworkworking
SHARED TOKENS (6): "activities", "description", "transportation", "welfare", "work", "working".
0.120
activitiesdifferentdocumenteventsofficialthroughout
SHARED TOKENS (6): "activities", "different", "document", "events", "official", "throughout".
0.100
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainownedpipelineserving
SHARED TOKENS (5): "business", "chain", "owned", "pipeline", "serving".
0.100
Single parent ↗ Q1204559 KW CROSS HIGH
alonefamilyparentsinglesupport
SHARED TOKENS (5): "alone", "family", "parent", "single", "support".
0.100
citiesidaholandmajorriver
SHARED TOKENS (5): "cities", "idaho", "land", "major", "river".
◈ Frequently Asked Questions
Wedding Events × Childcare Family — Treasure Valley
HAIKU · HIGH GATE
Do wedding venues in the Treasure Valley need to comply with fire safety codes when hosting events with children present?
Yes, wedding venues throughout the Boise metropolitan area must follow Idaho fire prevention and fire safety standards regardless of attendee composition. Venues in Boise, Nampa, and Ada County that accommodate families with children during ceremonies or receptions are subject to the same special-use permit requirements and fire code inspections as adult-only events.
Can childcare providers in the Treasure Valley operate from wedding event facilities?
Childcare operations from wedding venues in Boise or Nampa require separate administrative law compliance and licensing distinct from event venue permits. The Treasure Valley's childcare regulations do not prohibit day-of event childcare services, but facility operators must secure appropriate permits from Ada County or Canyon County authorities based on the specific use classification.
What continuing education options exist for wedding planners managing family-focused events in the Treasure Valley?
College of Western Idaho and Boise State University both offer continuing education programs relevant to event management and family services coordination in the Boise metropolitan area. Wedding professionals in the Treasure Valley can pursue apprenticeship or professional development pathways through these institutions to better serve clients organizing family-centered celebrations.
Are there nonprofit organizations in the Treasure Valley that support both wedding planning and childcare services?
Several nonprofit organizations throughout Boise and the Treasure Valley coordinate community resources for family services, including event support and childcare access. These nonprofits often leverage online marketplace platforms and franchise partnerships to connect wedding service providers with family-centered childcare options in Ada County.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Wedding Events × Childcare Family 23 QID bridges 293 edges 7,662 ext links 2026-07-18 00:09:04 UTC f9be5d8040672aeb
Wedding Events corridor ↗ Childcare Family corridor ↗ Childcare Family × Wedding Events ↗ boisestandard.org/standard ↗
Parent Corridors
Wedding Events × All Other Verticals