—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Land Use Planning ↔ relates to ↔ Tourism Hospitality

29 Wikipedia bridge articles confirmed in both vertical ledgers. 262 deterministic cross-vertical edges. 6,617 external source links harvested. Every edge provenance-stamped. Every claim auditable.

29 QID Bridge Articles
262 Cross Edges
6,617 External Sources
308 Wikipedia Articles
31 🌲 Evergreen
167 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Land Use Planning
× Tourism Hospitality
QID Bridge Articles
29
confirmed Wikipedia overlap
Total Cross Edges
262
External Sources Harvested
6,617
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise Airport
score: 1.1500  ·  type: exact_title_cross  ·  22 shared tokens
QID Bridge Titles (20)
Boise AirportIdahoZoningLand-use planningBoise State UniversityIrrigationCollege of Western IdahoBoise metropolitan areaWater rightWastewaterBoise RiverVertical integrationDeer Flat Upper EmbankmentMergers and acquisitionsBoise National ForestBoise, IdahoPrivate equityNampa, IdahoInterstate 84 in IdahoAda County, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationrivermetropolitancanyonwesterncapitallandlargestwateragriculturalcitiesnampadowntownnationalusesapproximatelydevelopmentcollege
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:44:15 UTC
Content Hash
38e7aca9a31af878
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
29 BRIDGES
Boise Airport
Q1430971 EXACT TITLE 1.150
QID OVERLAP: Q1430971 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (22): "airport", "boise", "center", "commercial", "commission", "department", "downtown", "functions", "general", "idaho", "increase", "million", "national", "operated", "operates", "protection", "receive", "requiring", "rights", "support".... | URL->B (1): http://www.iflyboise.com/about-boi/statistics/. | EXACT TITLE in land_use_planning: "Boise Airport". | EXACT TITLE in tourism_hospitality: "Boise Airport".
airportboisecentercommercialcommissiondepartmentdowntownfunctionsgeneralidahoincreasemillionnationaloperatedoperatesprotectionreceiverequiringrightssupportuseswestern
Boise Airport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
perated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
hts airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
Idaho
EXACT TITLE 1.000
QID OVERLAP: Q1221 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (26): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "distinct", "economy", "idaho", "isolated", "land", "largest", "linked", "million", "national", "official", "population", "products", "restricted", "river".... | EXACT TITLE in land_use_planning: "Idaho". | EXACT TITLE in tourism_hospitality: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitaldistincteconomyidahoisolatedlandlargestlinkedmillionnationalofficialpopulationproductsrestrictedriverseparatesquaresuppliestechnologyuseswestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (29): "activities", "building", "buildings", "combine", "determine", "developed", "development", "different", "form", "government", "governments", "growth", "land", "land-use", "local", "places", "planning", "policy", "property", "regulations".... | EXACT TITLE in land_use_planning: "Zoning". | EXACT TITLE in tourism_hospitality: "Zoning".
activitiesbuildingbuildingscombinedeterminedevelopeddevelopmentdifferentformgovernmentgovernmentsgrowthlandland-uselocalplacesplanningpolicypropertyregulationsregulatoryresidentialrulesscalesinglesystemsurbanuseszoning
s", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
History The origins of zoning districts can be traced back to antiquity. The ancient walled city was the predecessor for classifying and regulating land, based on use. Outside the city walls were the undesirable functions, which were usually based on noise and smell. The space between the walls is where unsanitary and dangerous activities occurred such as butchering, waste disposal, and brick-firing. Within the walls were civic and religious places, and where the majority of people lived. Beyond distinguishing between urban and non-urban land, most ancient cities further classified land types and uses inside their walls. This was practiced in many regions of the world – for example, in China during the Zhou Dynasty (1046 – 256 BC), in India during the Vedic Era (1500 – 500 BC), and in the military camps that spread throughout the Roman Empire (31 BC – 476 AD). Throughout the Age of Enlightenment and Industrial Revolution, cultural and socio-economic shifts led to the rapid increase in the enforcement and invention of urban regulations. The shifts were informed by a new scientific rationality, the advent of mass production and complex manufacturing, and the subsequent onset of urbanisation. Industry leaving the home reshaped modern cities. The definition of home was tied to the definition of economy, which caused a much greater mixing of uses within the residential quarters of cities. Separation between uses is a feature of many planned cities designed before the advent of zoning. A notable example is Adelaide in South Australia, whose city centre, along with the suburb of North Adelaide, is surrounded on all sides by a park, the Adelaide Park Lands. The park was designed by Colonel William Light in 1836 in order to physically separate the city centre from its suburbs. Low density residential areas surround the park, providing a pleasant walk between work in the city within and the family homes outside. Sir Ebenezer Howard, founder of the garden city movement, cited Adelaide as an example of how green open space could be used to prevent cities from expanding beyond their boundaries and coalescing. His design for an ideal city, published in his 1902 book Garden Cities of To-morrow, envisaged separate concentric rings of public buildings, parks, retail space, residential areas and industrial areas, all surrounded by open space and farmland. All retail activity was to be conducted within a single glass-roofed building, an early concept for the modern shopping centre inspired by the Crystal Palace. However, these planned or ideal cities were static designs embodied in a single masterplan. What was lacking was a regulatory mechanism to allow the city to develop over time, setting guidelines to developers and private citizens over what could be built where.
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:branch). | SHARED TOKENS (54): "act", "american", "applicable", "applied", "association", "authority", "central", "change", "cities", "community", "comprehensive", "conditions", "conservation", "costs", "creating", "depend", "depends", "design", "development", "districts".... | EXACT TITLE in land_use_planning: "Land-use planning".
actamericanapplicableappliedassociationauthoritycentralchangecitiescommunitycomprehensiveconditionsconservationcostscreatingdependdependsdesigndevelopmentdistrictseconomicefficiencyenvironmentalexposurefacilitiesfunctiongovernmentshealthinstitutejurisdictions+24
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (23): "activity", "among", "arts", "awards", "boise", "business", "college", "division", "economics", "education", "expenditures", "health", "idaho", "independent", "member", "million", "program", "programs", "public", "reported".... | EXACT TITLE in land_use_planning: "Boise State University". | EXACT TITLE in tourism_hospitality: "Boise State University".
activityamongartsawardsboisebusinesscollegedivisioneconomicseducationexpenditureshealthidahoindependentmembermillionprogramprogramspublicreportedresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Irrigation
Q11453 EXACT TITLE 1.000
QID OVERLAP: Q11453 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (41): "agricultural", "agriculture", "application", "applies", "central", "conditions", "consolidation", "control", "controlled", "developed", "directly", "distributed", "distribution", "effects", "environmental", "form", "growth", "irrigation", "land", "landscape".... | EXACT TITLE in land_use_planning: "Irrigation". | EXACT TITLE in tourism_hospitality: "Irrigation".
agriculturalagricultureapplicationappliescentralconditionsconsolidationcontrolcontrolleddevelopeddirectlydistributeddistributioneffectsenvironmentalformgrowthirrigationlandlandscapemaintainmanagementnetworkoperationoperationsoutsideproductionprotectreducerequired+11
Surface irrigation, also known as gravity irrigation, is the oldest form of irrigation and has been in use for thousands of years. In surface (furrow, flood, or level basin) irrigation systems, water moves across the surface of agricultural lands to wet it and infiltrate into the soil. Water moves by following gravity or the slope of the land. Surface irrigation can be subdivided into furrow, border strip, or basin irrigation. It is often called flood irrigation when irrigation results in flooding or near-flooding of the cultivated land. Historically, surface irrigation has been the most common method for irrigating agricultural land in most parts of the world. The water application efficiency of surface irrigation is typically lower than that of other irrigation methods, due in part to limited control over applied depths. Surface irrigation involves significantly lower capital costs and energy requirements than pressurized irrigation systems. Hence, it is often the irrigation choice for developing nations, for low-value crops, and for large fields. Where water levels from the irrigation source permit, they are controlled by dikes (levees), usually plugged with soil. This is often seen in terraced rice fields (rice paddies), where the method is used to flood or control water levels in each distinct field.
Field Water Efficiency (%) = (Water Transpired by Crop ÷ Water Applied to Field) x 100 Increased irrigation efficiency has several positive outcomes for the farmer, the community, and the wider environment. Low application efficiency indicates that the amount of water applied to the field exceeds the crop or field requirements. Increasing the application efficiency means that the amount of crop produced per unit of water increases. Improved efficiency may be achieved by applying less water to an existing field or by using water more wisely, thereby achieving higher yields in the same area of land. In some parts of the world, farmers are charged for irrigation water; hence, over-application has a direct financial cost to the farmer. Irrigation often requires pumping energy (electricity or fossil fuels) to deliver water to the field or to supply the required operating pressure. Hence, increased efficiency will reduce both water and energy costs per unit of agricultural production. A reduction in water use on one field may allow the farmer to irrigate a larger area of land, increasing total agricultural production. Low efficiency usually means that excess water is lost through seepage or runoff, both of which can result in loss of crop nutrients or pesticides with potential adverse impacts on the surrounding environment. Improving the efficiency of irrigation is usually achieved in one of two ways: either by improving the system design or by optimizing the irrigation management. Improving system design includes converting from one form of irrigation to another (e.g., from furrow to drip irrigation) and making small changes to the current system (e.g., adjusting flow rates and operating pressures).
Archaeological investigations have found evidence of irrigation in areas lacking sufficient natural rainfall to support rainfed agriculture. Some of the earliest known use of the technology dates to the 6th millennium BCE in Khuzistan in the south-west of Iran. The site of Choga Mami, in present-day Iraq on the border with Iran, is believed to be the earliest to show the first canal irrigation in operation at about 6000 BCE. Irrigation was used to manipulate water in the alluvial plains of the Indus Valley Civilization, with its application estimated to have begun around 4500 BCE and to have drastically increased the size and prosperity of their agricultural settlements. The Indus Valley Civilization developed sophisticated irrigation and water-storage systems, including artificial reservoirs at Girnar dated to 3000 BCE, and an early canal irrigation system from c. 2600 BCE. Large-scale agriculture was practiced, with an extensive network of canals used for irrigation. Farmers in the Mesopotamian plain used irrigation from at least the third millennium BCE. They developed perennial irrigation, regularly watering crops throughout the growing season by coaxing water through a matrix of small channels formed in the field. Ancient Egyptians practiced basin irrigation using the flooding of the Nile to inundate land plots which had been surrounded by dikes. The flood water remained until the fertile sediment had settled before the engineers returned the surplus to the watercourse. There is evidence of the ancient Egyptian pharaoh Amenemhet III in the twelfth dynasty (about 1800 BCE) using the natural lake of the Faiyum Oasis as a reservoir to store surpluses of water for use during dry seasons.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (22): "boise", "canyon", "college", "community", "comprehensive", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported", "southwest", "transfer", "treasure", "valley".... | EXACT TITLE in land_use_planning: "College of Western Idaho". | EXACT TITLE in tourism_hospitality: "College of Western Idaho".
boisecanyoncollegecommunitycomprehensivecwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedsouthwesttransfertreasurevalleywesternworkforce
College of Western Idaho (CWI) is a public community college in Southwest Idaho with its primary campus locations in Boise and Nampa. CWI also offers classes at several community locations throughout the Treasure Valley. It is one of four comprehensive community colleges along with the College of Eastern Idaho, College of Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
e 55% female and 45% male. Idaho residents comprised 98% of CWI's student population and Ada County residents were 49%, while 28% were Canyon County residents. History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Boise metropolitan area
Q4938481 EXACT TITLE 0.940
QID OVERLAP: Q4938481 in land_use_planning (tier:branch) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (12): "boise", "canyon", "cities", "idaho", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley". | EXACT TITLE in tourism_hospitality: "Boise metropolitan area".
boisecanyoncitiesidaholargestmeridianmetropolitannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
ally designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
W
Q7973730 EXACT TITLE 0.920
QID OVERLAP: Q7973730 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:branch). | SHARED TOKENS (11): "different", "generally", "ground", "irrigation", "law", "legal", "physical", "river", "source", "systems", "water". | EXACT TITLE in land_use_planning: "Water right".
differentgenerallygroundirrigationlawlegalphysicalriversourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
Wastewater
Q336191 EXACT TITLE 0.900
QID OVERLAP: Q336191 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (10): "activities", "agricultural", "another", "commercial", "community", "municipal", "produced", "sewer", "wastewater", "water". | EXACT TITLE in land_use_planning: "Wastewater". | EXACT TITLE in tourism_hospitality: "Wastewater".
activitiesagriculturalanothercommercialcommunitymunicipalproducedsewerwastewaterwater
w water, or saline water in a variety of deliberate applications or processes. Another definition of wastewater is "Used water from any combination of domestic, industrial, commercial or agricultural activities, surface runoff / storm water, and any sewer infiltration or sewer inflow".
Domestic wastewater, which encompasses sewage produced by communities and is commonly subdivided into greywater and blackwater. Industrial wastewater: waterborne waste generated from a variety of industrial processes, such as manufacturing operations, mineral extraction, power generation, or water and wastewater treatment. Cooling water, is released with potential thermal pollution after use to condense steam or reduce machinery temperatures by conduction or evaporation. Leachate: precipitation containing pollutants dissolved while percolating through ores, raw materials, products, or solid waste. Return flow: the flow of water carrying suspended soil, pesticide residues, or dissolved minerals and nutrients from irrigated cropland. Surface runoff: the flow of water occurring on the ground surface when excess rainwater, stormwater, meltwater, or other sources, can no longer sufficiently rapidly infiltrate the soil. Urban runoff, including water used for outdoor cleaning activity and landscape irrigation in densely populated areas created by urbanization. Agricultural wastewater: animal husbandry wastewater generated from confined animal operations. Treatment Wastewater treatment refers to processes used to remove contaminants from wastewater. The treated effluent is typically discharged to a receiving water body with the aim of limiting adverse environmental impacts. Sewage is usually treated at sewage treatment plants. Industrial wastewater may be treated at facilities designed for industrial processes or, in some cases, at municipal sewage treatment plants. When the latter occurs, industries generally perform on-site pretreatment before discharge to the municipal system. Other specialized treatment plants exist for agricultural wastewater and leachate. Treatment processes commonly include phase separation, biological and chemical transformation steps, and polishing to improve effluent quality. Sludge is the principal by-product generated during treatment and is further processed at the same facility or at separate sludge treatment plants.
Wastewater treatment refers to processes used to remove contaminants from wastewater. The treated effluent is typically discharged to a receiving water body with the aim of limiting adverse environmental impacts. Sewage is usually treated at sewage treatment plants. Industrial wastewater may be treated at facilities designed for industrial processes or, in some cases, at municipal sewage treatment plants. When the latter occurs, industries generally perform on-site pretreatment before discharge to the municipal system. Other specialized treatment plants exist for agricultural wastewater and leachate. Treatment processes commonly include phase separation, biological and chemical transformation steps, and polishing to improve effluent quality. Sludge is the principal by-product generated during treatment and is further processed at the same facility or at separate sludge treatment plants.
Boise River
Q891080 EXACT TITLE 0.900
QID OVERLAP: Q891080 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (10): "agricultural", "approximately", "boise", "idaho", "lands", "river", "sawtooth", "square", "urban", "western". | EXACT TITLE in land_use_planning: "Boise River". | EXACT TITLE in tourism_hospitality: "Boise River".
agriculturalapproximatelyboiseidaholandsriversawtoothsquareurbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Vertical integration
Q1571520 QID OVERLAP 0.800
QID OVERLAP: Q1571520 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (28): "another", "arrangement", "become", "began", "chain", "combine", "consolidation", "different", "directly", "economy", "final", "integration", "large", "management", "market", "member", "ownership", "political", "position", "produce"....
anotherarrangementbecomebeganchaincombineconsolidationdifferentdirectlyeconomyfinalintegrationlargemanagementmarketmemberownershippoliticalpositionproduceproducedproducesproductsratherrelatedriversuppliessupply
ent product or (market-specific) service, and the products combine to satisfy a common need. It contrasts with horizontal integration, wherein a company produces several items that are related to one another. Vertical integration has also described management styles that bring large portions of the supply chain not only under a common ownership but also into one corporation (as in the 1920s when the Ford River Rouge complex began making much of its own steel rather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
There are many problems and benefits that vertical integration brings to an economic system. Problems that can stem from vertical integration can include large capital investments needed to set up and buy factories and maintain efficient profits. Rapid technology development can increase integration difficulties and further increase costs. The requirement of different business skills venturing into new portions of the supply chain can be challenging for the firm. Another problem that may stem from vertical integration is the collapse of goals among the various firms in a supply chain. With each firm operating under different systems, integration may cause initial problems in management and production. Vertical integration also proves to be dangerous when monopolistic problems arise in a capitalistic economy. When this happens, competition is removed and a corporation has the power to control all firms in its supply chain. Large companies are more likely than smaller companies to employ vertical integration, as they have more resources to manage each stage of production (e.g. major expansion and funding). Vertical integration allows control of production from beginning to end. Vertical integration requires a company to focus not only on its core business, but also on several difficult areas such as sourcing materials and manufacturing partners, distribution, and finally selling the product. One benefit is that the implementation of vertical integration can yield increased profit margins or eliminate the leverage that other firms or buyers may have over the firm. It allows improved coordination between production and distribution firms and decreases the cost of exchange of goods between firms within a supply chain. Operational routines also become more consistent and certain as the management of these firms gradually merge. Vertically integrated firms rarely need to worry about the sufficiency in their supply of materials because they generally control the facilities that provide them. A vertically integrated company also creates high barriers of entry into their respective economy, eliminating most potential competition. Implementing vertical integration can be beneficial in that it reduces the distance that separates the suppliers and customers from the resources or information, which can then boost profits and efficiency. There are internal and external society-wide gains and losses stemming from vertical integration, which vary according to the state of technology in the industries involved, roughly corresponding to the stages of the industry lifecycle. Static technology represents the simplest case, where the gains and losses have been studied extensively.
In microeconomics, management and international political economy, vertical integration, also referred to as vertical consolidation, is an arrangement in which the supply chain of a company is integrated and owned by that company. Usually each member of the supply chain produces a different product or (market-specific) service, and the products combine to satisfy a common need. It contrasts with horizontal integration, wherein a company produces several items that are related to one another. Vertical integration has also described management styles that bring large portions of the supply chain not only under a common ownership but also into one corporation (as in the 1920s when the Ford River Rouge complex began making much of its own steel rather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
Deer Flat Upper Embankment
Q5250747 QID OVERLAP 0.800
QID OVERLAP: Q5250747 in land_use_planning (tier:branch) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (36): "activity", "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "conservation", "created", "creates", "directly", "edge", "february", "federal", "feet", "formation", "idaho", "important"....
activityamongapproximatelyassociationboisebureaucanyoncapacitycenterconservationcreatedcreatesdirectlyedgefebruaryfederalfeetformationidahoimportantlargestlocalnampanationalofficeprojectprovideriversitesouthwest+6
Deer Flat Middle Dike (ID #ID00277), completed 1911, 18 feet (5.5 m) high, 1,262 feet (385 m) long Deer Flat Lower Dike (ID #ID00278), completed 1908, 48 feet (15 m) high, 7,270 feet (2,220 m) long Deer Flat East Dike (ID #ID82902), completed 1911, 18 feet (5.5 m) high, 3,806 feet (1,160 m) long The reservoir it creates, Lake Lowell, has a normal surface area of 16 square miles (41 km2), and a maximum capacity of 169,000 acre-feet (208,000,000 m3). Its surface elevation is approximately 2,520 feet (770 m) above sea level. The Boise Project was among the first undertaken by the Reclamation Service after its formation in 1902. Shortly before leaving office, President Theodore Roosevelt created a national bird refuge at Deer Flat Reservoir, now Lake Lowell, with an executive order on February 25, 1909. The refuge was one of 17 federal reclamation projects referenced in the order, each of which used manmade aquifers to provide safe havens for migratory birds. The effort to include the Canyon County site was spearheaded by James H. Lowell, the president of the local Payette-Boise Water Users Association. The "globally important" Deer Flat National Wildlife Refuge for migratory fowl and other wildlife consists of two sections which contains open water, edge wetlands, grasslands and riparian and forest habitats. The largest portion of the refuge consists of Lake Lowell and its environs. The second portion comprises the Snake River islands located in non-contiguous localities along the river in Canyon, Owyhee, Payette, and Washington counties (Idaho) and Malheur and Baker counties (Oregon).
w U.S. Bureau of Reclamation), with a height of 74 feet (23 m) and a crest length of 4,165 feet (1.27 km). The Upper Embankment is the largest of a set of four dikes here impounding the water of the Boise River in offstream storage. The other dams are: Deer Flat Middle Dike (ID #ID00277), completed 1911, 18 feet (5.5 m) high, 1,262 feet (385 m) long Deer Flat Lower Dike (ID #ID00278), completed 1908, 48 feet (15 m) high, 7,270 feet (2,220 m) long Deer Flat East Dike (ID #ID82902), completed 1911, 18 feet (5.5 m) high, 3,806 feet (1,160 m) long The reservoir it creates, Lake Lowell, has a normal surface area of 16 square miles (41 km2), and a maximum capacity of 169,000 acre-feet (208,000,000 m3). Its surface elevation is approximately 2,520 feet (770 m) above sea level. The Boise Project was among the first undertaken by the Reclamation Service after its formation in 1902. Shortly before leaving office, President Theodore Roosevelt created a national bird refuge at Deer Flat Reservoir, now Lake Lowell, with an executive order on February 25, 1909. The refuge was one of 17 federal reclamation projects referenced in the order, each of which used manmade aquifers to provide safe havens for migratory birds. The effort to include the Canyon County site was spearheaded by James H. Lowell, the president of the local Payette-Boise Water Users Association. The "globally important" Deer Flat National Wildlife Refuge for migratory fowl and other wildlife consists of two sections which contains open water, edge wetlands, grasslands and riparian and forest habitats. The largest portion of the refuge consists of Lake Lowell and its environs. The second portion comprises the Snake River islands located in non-contiguous localities along the river in Canyon, Owyhee, Payette, and Washington counties (Idaho) and Malheur and Baker counties (Oregon).
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (44): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "combine", "commission", "competitive", "consolidated", "consolidation", "control", "create", "department", "direct", "economically", "effects", "federal"....
acquisitionactactivityanotherassetsbusinesscapitalcentralcombinecommissioncompetitiveconsolidatedconsolidationcontrolcreatedepartmentdirecteconomicallyeffectsfederalgovernedgovernmentlawlegalmanagementmarketnoticeoperatingoperationsorganization+14
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Boise National Forest
Q891075 QID OVERLAP 0.800
QID OVERLAP: Q891075 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (19): "boise", "covering", "created", "districts", "facilities", "feet", "idaho", "land", "maintain", "multiple", "national", "percent", "recreation", "resources", "river", "sawtooth", "units", "water", "wildlife".
boisecoveringcreateddistrictsfacilitiesfeetidaholandmaintainmultiplenationalpercentrecreationresourcesriversawtoothunitswaterwildlife
Boise National Forest is a National Forest covering 2,203,703 acres (8,918.07 km2) of the U.S. state of Idaho. Created on July 1, 1908, from part of Sawtooth National Forest, it is managed by the U.S. Forest Service as five units: the Cascade, Emmett, Idaho City, Lowman, and Mountain Home ranger districts. The Idaho Batholith underlies most of Boise National Forest, forming the forest's Boise, Salmon River, and West mountain ranges; the forest reaches a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
70 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
one people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (16): "annual", "block", "boise", "capital", "downtown", "feet", "idaho", "locally", "major", "metropolitan", "population", "river", "sectors", "technology", "treasure", "valley".
annualblockboisecapitaldowntownfeetidaholocallymajormetropolitanpopulationriversectorstechnologytreasurevalley
employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard. The city is home to the Boise Art Museum, Idaho State Capitol, the annual Treefort Music Fest, and the Basque Block. History Etymology The origin of the name is uncertain. One account credits Capt. B. L. E. Bonneville of the U.S. Army as its source. After trekking for weeks through dry and rough terrain, his exploration party reached an overlook with a view of the Boise River Valley. The place where they stood is called Bonneville Point, located on the Oregon Trail east of the city. According to the story, a French-speaking guide, overwhelmed by the sight of the verdant river, yelled "Les bois! Les bois!" ("The woods! The woods!")—and the name stuck. The name may also derive from earlier mountain men who named the river that flows through the city. In the 1820s, French Canadian fur trappers associated with the British-owned Hudson's Bay Company set trap lines in the vicinity. Set in a high-desert area, the tree-lined valley of the Boise River became a distinct landmark, an oasis dominated by cottonwood trees.
Tribes and First Contact The area of Boise valley was inhabited by Boise Valley Shoshone and Bannock tribes, a part of the "Snake Country". According to the City of Boise's "History of Boise" report, "they gathered annually in the valley to participate in trading rendezvous with other tribes and catch salmon in the Boise River runs to help sustain them year-round. They spent winters in the valley where the climate was milder and visited the hot springs for bathing and healing. Castle Rock, called Eagle Rock by the tribes, was and remains a sacred site." Boise Valley Bannock tribes belonged to the "tuuˀagaidɨkaˀa" (black trout eaters). Boise Valley Shoshone belonged to the "Yahandeka" (groundhog eaters) grouping. They were among the early mounted Shoshone bands. They traveled over a considerable range by the beginning of the nineteenth century, with their main hunting lands along the lower Boise River and Payette River. When Donald MacKenzie developed the Snake country fur trade after 1818, the most prominent of the Boise Shoshone, Peiem (a Shoshoni rendition of "Big Jim", their leader's English name), became the most influential leader of the large composite Shoshoni band that white trappers regularly encountered in the Snake Country. In 1811, Wilson Hunt, employed as an agent in the fur trade under John Jacob Astor, organized and led the greater part of a group of about 60 men on an overland expedition to establish a fur trading outpost at the mouth of the Columbia River. This expedition passed through the Boise valley, and was the first ever time a white American has entered the region. Because of the War of 1812 and the lack of U.S. fur trading posts in the Pacific Northwest, most of the route was not used in the following two decades, and thus Snake Country remained free of settler incursions. After the conclusion of the war of 1812, until the 1840s, Oregon, while officially "jointly administered", was solely dominated by the British Hudson's Bay Company (HBC), which had a land connection to the inland of the Canadian Prairies via York Factory Express. Snake Country, including Boise Valley remained independent and relatively free of settler passage and incursion. There were two main reasons for this. Firstly, the general region east of the Cascades and west of the Rockies was described at the time in the media and literature of the eastern US as the "Great American Desert", an arid unproductive region, unsuitable for habitation. This discouraged settlers from traveling to the region of Boise; however, Oregon Country, on the other side of the Cascades, was a desirable destination for them. Nevertheless, the British had an official policy of discouraging American settlers, and settler incursions into Boise Valley along the Oregon Trail remained low until the early 1840s. The HBC established a fort in the region, the Old Fort Boise, 40 miles (64 km) west, near Parma, down the Boise River near its confluence with the Snake River at the Oregon border.
The North End, generally defined as the part of Boise north of State Street, contains many of the city's older homes. It is known for its tree-lined drives such as Harrison Boulevard, and for its quiet neighborhoods near the downtown area. Downtown Boise is visible from Camel's Back Park. On 13th Street, Hyde Park is home to restaurants and other businesses. The North End also hosts events such as the annual Hyde Park Street Fair. In 2008, the American Planning Association designated Boise's North End one of 10 Great Neighborhoods. Boise Highlands The Boise Highlands is just north of the North End; its location is generally defined as north of Hill Road and east of Bogus Basin Road.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (25): "active", "business", "capital", "category", "control", "development", "expansion", "finance", "financial", "financing", "general", "investment", "long-term", "management", "operational", "otherwise", "ownership", "private", "products", "provide"....
activebusinesscapitalcategorycontroldevelopmentexpansionfinancefinancialfinancinggeneralinvestmentlong-termmanagementoperationalotherwiseownershipprivateproductsprovidepublicratherrolespecializedstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "idaho", "interstate", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncollegeidahointerstatemeaningmeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Interstate 84 in Idaho
Q843258 QID OVERLAP 0.720
QID OVERLAP: Q843258 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (11): "away", "boise", "cities", "downtown", "highway", "idaho", "interstate", "major", "metropolitan", "river", "routes".
awayboisecitiesdowntownhighwayidahointerstatemajormetropolitanriverroutes
76 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
state Highway that traverses the state from the Oregon state line in the northwest to Utah state line in the southeast. It primarily follows the Snake River across a plain that includes the cities of Boise, Mountain Home, and Twin Falls. The highway is one of the busiest in Idaho and is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
nd is designated as the Vietnam Veterans Memorial Highway. I-84 runs for 276 miles (444 km) within Idaho, beginning near Ontario, Oregon, and traveling concurrent with several U.S. routes through the Boise metropolitan area and Mountain Home towards Twin Falls. I-84 splits away from US 30 and the Snake River at a junction with I-86 near Declo, where it turns southeast to cross the Sublett Range into northern Utah.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (11): "boise", "capital", "district", "highway", "idaho", "largest", "local", "metropolitan", "population", "private", "streets".
boisecapitaldistricthighwayidaholargestlocalmetropolitanpopulationprivatestreets
94,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise. Canyon County, which originally included Payette County and most of Gem County, was partitioned from western Ada County in 1891. Geography According to the United States Census Bureau, the county has a total area of 1,060 square miles (2,700 km2), of which 1,053 square miles (2,730 km2) is land and 7.9 square miles (20 km2) (0.7%) is water. The Boise River flows through the northern portion of the county, and the northwest border is bounded by the foothills of the Boise Range mountains; the summits are in adjacent Boise County.
Septic tank
Q386300 QID OVERLAP 0.700
QID OVERLAP: Q386300 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (10): "efficiency", "reduce", "rural", "septic", "system", "systems", "therefore", "treatment", "units", "wastewater".
efficiencyreduceruralsepticsystemsystemsthereforetreatmentunitswastewater
concrete, fiberglass, or plastic through which domestic wastewater (sewage) flows for basic sewage treatment. Settling and anaerobic digestion processes reduce solids and organics, but the treatment efficiency is only moderate (referred to as "primary treatment"). Septic tank systems are a type of simple onsite sewage facility. They can be used in areas that are not connected to a sewerage system, such as rural areas. The treated liquid effluent is commonly disposed in a septic drain field, which provides further treatment. Nonetheless, groundwater pollution may occur and is a problem. The term "septic" refers to the anaerobic bacterial environment that develops in the tank that decomposes or mineralizes the waste discharged into the tank. Septic tanks can be coupled with other onsite wastewater treatment units such as biofilters or aerobic systems involving artificially forced aeration. The rate of accumulation of sludge—also called septage or fecal sludge—is faster than the rate of decomposition.
Other factors Roots from trees and shrubbery protruding above the tank or drainfield may clog and/or rupture them. Trees that are directly within the vicinity of a concrete septic tank have the potential to penetrate the tank as the system ages and the concrete begins to develop cracks and small leaks. Tree roots can cause serious flow problems due to plugging and blockage of drain pipes, and the trees themselves tend to expand extremely vigorously due to the ready supply of nutrients from the septic system. Playgrounds and storage buildings may cause damage to a tank and the drainage field. In addition, covering the drainage field with an impermeable surface, such as a driveway or parking area, will seriously affect its efficiency and possibly damage the tank and absorption system. Excessive water entering the system may overload it and cause it to fail. Very high rainfall, rapid snowmelt, and flooding from rivers or the sea can all prevent a drain field from operating, and can cause flow to back up, interfering with the normal operation of the tank. High winter water tables can also result in groundwater flowing back into the septic tank. Over time, biofilms develop on the pipes of the drainage field, which can lead to blockage.
European Union In the European Union the EN 12566 standard provides the general requirements for packaged and site assembled treatment plants used for domestic wastewater treatment. Part 1 (EN 12566-1) is for septic tanks that are prefabricated or factory manufactured and made of polyethylene, glass reinforced polyester, polypropylene, PVC-U, steel or concrete. Part 4 (EN 12566-4) regulates septic tanks that are assembled on site from prefabricated kits, generally of concrete construction. Certified septic tanks of both types must pass a standardized hydraulic test to assess their ability to retain suspended solids within the system. Additionally, their structural adequacy in relevant ground conditions is assessed in terms of water-tightness, treatment efficiency, and structural behaviour. France In France, about 4 million households (or 20% of the population) are using on-site wastewater disposal systems (l’assainissement non collectif), including septic tanks (fosse septique). The legal framework for regulating the construction and maintenance of septic systems was introduced in 1992 and updated in 2009 and 2012 with the intent to establish the technical requirements applicable to individual sewerage systems. Septic tanks in France are subject to inspection by SPANC (Service Public d’Assainissement Non Collectif), a professional body appointed by the respective local authorities to enforce wastewater collection laws, at least once in four years.
Garden City, Idaho
Q1516892 QID OVERLAP 0.680
QID OVERLAP: Q1516892 in land_use_planning (tier:evergreen) and tourism_hospitality (tier:branch). | SHARED TOKENS (9): "boise", "garden", "government", "idaho", "metropolitan", "municipal", "population", "separate", "street".
boisegardengovernmentidahometropolitanmunicipalpopulationseparatestreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
s only main street, Chinden Boulevard, is a portmanteau of the words "China" and "garden." In the second decade of the 21st century, it became a haven for artists' studios. Garden City is part of the Boise metropolitan area. Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Snake River Plain
Q1396049 QID OVERLAP 0.660
QID OVERLAP: Q1396049 in land_use_planning (tier:branch) and tourism_hospitality (tier:evergreen). | SHARED TOKENS (8): "agricultural", "cities", "covers", "idaho", "land", "largest", "major", "river".
agriculturalcitiescoversidaholandlargestmajorriver
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
y within the U.S. state of Idaho. It stretches about 400 miles (640 km) westward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "largest", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Star, Idaho
Q1516815 QID OVERLAP 0.640
QID OVERLAP: Q1516815 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (7): "boise", "canyon", "district", "idaho", "metropolitan", "population", "school".
boisecanyondistrictidahometropolitanpopulationschool
with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
t. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (7): "among", "boise", "capital", "cities", "idaho", "meridian", "population".
amongboisecapitalcitiesidahomeridianpopulation
population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Irrigation (1890– ) Early settlers arriving in the area came with no knowledge of gravity flow irrigation. Their previous homes were in areas where rain provided the needed moisture to raise crops. Irrigation soon became a necessity, since having a water source was a requirement for receiving the patent for the land from the U.S. Land Office. Irrigation districts, such as the Nampa-Meridian and Settlers irrigation districts, continue to serve the immediate Meridian area. The town was established in 1891 on the Onweiler farm north of the present site and was called Hunter. Two years later an I.O.O.F. lodge was organized and called itself Meridian because it was located on the Boise Meridian, and the town was renamed. The Settlers' Irrigation Ditch, 1892, changed the arid region into a productive farming community which was incorporated in 1902. Village (1903–41) The original Meridian town site was filed in 1893 on homestead grant land belonging to Eliza Ann Zenger. Her husband, Christian, filed the plat with county officials and called it Meridian. The early settlers, many of whom were relatives, left their homes in Missouri to go west, either by wagon, train, or immigrant railroad car, bringing their lodge and church preferences with them. They established local institutions soon after arriving and filed for homestead lands. Meridian was incorporated in 1903. Around the start of the 20th century, settlers established fruit orchards and built fruit packing businesses and prune dryers along the railroad tracks. Local orchards produced many varieties of apples and Italian prunes. Production continued through the mid-1940s when it was no longer profitable and the businesses closed.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad.
Kuna, Idaho
Q1515177 QID OVERLAP 0.620
QID OVERLAP: Q1515177 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (6): "additional", "boise", "idaho", "metropolitan", "percent", "population".
additionalboiseidahometropolitanpercentpopulation
metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020. History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in land_use_planning (tier:branch) and tourism_hospitality (tier:branch). | SHARED TOKENS (5): "boise", "downtown", "eagle", "idaho", "population".
boisedowntowneagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District. The portion in the Boise School District is zoned to: Shadow Hills Elementary School, Riverglen Middle School, and Capital High School. In popular culture The 2008 show The Baby Borrowers was filmed in Eagle.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
233 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP233 edges
🌲 EVERGREEN2 edges
0.650
accessboisecapitalconnectscreateddepartmentdowntowngardenhistoricalhistoryidaholandmunicipaloperatedparkparkspedestrianrecreationriverstreet
SHARED TOKENS (22): "access", "boise", "capital", "connects", "created", "department", "downtown", "garden", "historical", "history", "idaho", "land", "municipal", "operated", "park", "parks", "pedestrian", "recreation", "river", "street".... | URL->B (1): https://history.idaho.gov/museum/. | EXACT TITLE in tourism_hospitality: "Julia Davis Park".
0.630
americanboisebureaucanyoncommissiondepartmentestablishedidahoproductionriversquaretaxtradevalley
SHARED TOKENS (14): "american", "boise", "bureau", "canyon", "commission", "department", "established", "idaho", "production", "river", "square", "tax", "trade", "valley". | URL->B (1): https://idahowines.org/idaho-wines/idaho-wine-history/. | EXACT TITLE in tourism_hospitality: "Snake River Valley AVA".
🌿 BRANCH167 edges
0.550
Idaho wine ↗ Q2555765 EXACT TITLE
agriculturalhistoryidahonationalproducedproductionrecognitionrivertowardvalley
SHARED TOKENS (10): "agricultural", "history", "idaho", "national", "produced", "production", "recognition", "river", "toward", "valley". | URL->B (1): https://idahowines.org/idaho-wines/idaho-wine-history/. | EXACT TITLE in tourism_hospitality: "Idaho wine".
0.500
amongapproximatelyboisedivisionestablishedextensionidaholateroperatesparkproductionprofessionalpublicresearchruralstatewideuniversity
SHARED TOKENS (17): "among", "approximately", "boise", "division", "established", "extension", "idaho", "later", "operates", "park", "production", "professional", "public", "research", "rural", "statewide", "university". | EXACT TITLE in land_use_planning: "University of Idaho".
0.500
accessadministrativeartsbuildingscentercommercialdevelopmentdistrictdistrictsevenhistorichistoricalhousingincreasejurisdictionslegalownerspotentialpropertiesprotection
SHARED TOKENS (31): "access", "administrative", "arts", "buildings", "center", "commercial", "development", "district", "districts", "even", "historic", "historical", "housing", "increase", "jurisdictions", "legal", "owners", "potential", "properties", "protection".... | EXACT TITLE in tourism_hospitality: "Historic district".
0.500
Cartography ↗ Q42515 EXACT TITLE
boundariescomplexitydesigninformationlandmapmapsmediamodeledmodernphysicalpoliticalreducespatialstudysystems
SHARED TOKENS (16): "boundaries", "complexity", "design", "information", "land", "map", "maps", "media", "modeled", "modern", "physical", "political", "reduce", "spatial", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.500
activitiesactivityagenciesattachedcommunitydevelopeddistributioneconomicestimatesevenformalgrowthimportantincorporatedinformationintensityland-usemetropolitanmodelorganizations
SHARED TOKENS (34): "activities", "activity", "agencies", "attached", "community", "developed", "distribution", "economic", "estimates", "even", "formal", "growth", "important", "incorporated", "information", "intensity", "land-use", "metropolitan", "model", "organizations".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
analysisanotherattachedbroaderbusinessdatafoundfoundationinformationinstitutionalinsuranceknowledgemanagementmultipleoperationsorganizationsphysicalplanningrealrecorded
SHARED TOKENS (27): "analysis", "another", "attached", "broader", "business", "data", "found", "foundation", "information", "institutional", "insurance", "knowledge", "management", "multiple", "operations", "organizations", "physical", "planning", "real", "recorded".... | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventgenerallygroupindividualmanagementmodelparksplacesprivateproviderestaurantssafetyservingspacesstaff
SHARED TOKENS (17): "business", "commercial", "event", "generally", "group", "individual", "management", "model", "parks", "places", "private", "provide", "restaurants", "safety", "serving", "spaces", "staff". | EXACT TITLE in tourism_hospitality: "Catering".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomecapacitycentralchangecitiesdistributioneffectsenvironmentalformformationgroundinfluencelandlargestmajormultiplemunicipaloperating
SHARED TOKENS (39): "agricultural", "agriculture", "become", "capacity", "central", "change", "cities", "distribution", "effects", "environmental", "form", "formation", "ground", "influence", "land", "largest", "major", "multiple", "municipal", "operating".... | EXACT TITLE in land_use_planning: "Groundwater".
0.500
actapplicationbecomebuildingbuildingsdepartmentdistrictdistrictsestablishedfederalfinancialformsgeneralgovernmenthistorichistoricalhistoryidentifyincentivesindividual
SHARED TOKENS (45): "act", "application", "become", "building", "buildings", "department", "district", "districts", "established", "federal", "financial", "forms", "general", "government", "historic", "historical", "history", "identify", "incentives", "individual".... | EXACT TITLE in tourism_hospitality: "National Register of Historic Places".
0.500
activitiesactivityairportbusinesscombinescomponentscreatedirectlyeconomichotellocaloperatoroperatorsproduceproductspublictransfertransportationtravel
SHARED TOKENS (19): "activities", "activity", "airport", "business", "combines", "components", "create", "directly", "economic", "hotel", "local", "operator", "operators", "produce", "products", "public", "transfer", "transportation", "travel". | EXACT TITLE in tourism_hospitality: "Tour operator".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotcasescertificationchainconsumercreatesdescribingdevelopedenforcementgrowthhealthinspectionmanagementmarketmillionorganizationphysicalpotentialpreparationrelated
SHARED TOKENS (25): "cannot", "cases", "certification", "chain", "consumer", "creates", "describing", "developed", "enforcement", "growth", "health", "inspection", "management", "market", "million", "organization", "physical", "potential", "preparation", "related".... | EXACT TITLE in tourism_hospitality: "Food safety".
0.500
activeagenciesassociatedbusinessescapacitycasescompetitiveconcentrationdeterminedistributioneconomiceconomicsemploymentfunctionimportantlandlawmarketorganizationpower
SHARED TOKENS (30): "active", "agencies", "associated", "businesses", "capacity", "cases", "competitive", "concentration", "determine", "distribution", "economic", "economics", "employment", "function", "important", "land", "law", "market", "organization", "power".... | EXACT TITLE in tourism_hospitality: "Market concentration".
0.500
actappliedbecomebuiltbureaudepartmentdevelopmentestablishedfederalfundinggovernmentirrigationjunelandslargestlawmanagementmillionoperationpotential
SHARED TOKENS (31): "act", "applied", "become", "built", "bureau", "department", "development", "established", "federal", "funding", "government", "irrigation", "june", "lands", "largest", "law", "management", "million", "operation", "potential".... | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
0.500
activitiesadministrativebroadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualinfrastructurelandland-usemanagementnationalnetworkplacementplanningplans
SHARED TOKENS (33): "activities", "administrative", "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "infrastructure", "land", "land-use", "management", "national", "network", "placement", "planning", "plans".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accessagencieschangeclassifycommunitycomponentsconditionscontemporarycreatedculturaldescribedevelopmentdifferentdistincteconomiceconomyemergencyenforcementenvironmentalfacilities
SHARED TOKENS (46): "access", "agencies", "change", "classify", "community", "components", "conditions", "contemporary", "created", "cultural", "describe", "development", "different", "distinct", "economic", "economy", "emergency", "enforcement", "environmental", "facilities".... | EXACT TITLE in land_use_planning: "Infrastructure". | EXACT TITLE in tourism_hospitality: "Infrastructure".
0.500
accessactivitiesactivitycitiescreateddemandfacilitiesgeneralgenerallyindividualoutsideparksphysicalpopulationratherrecreationrivertraining
SHARED TOKENS (18): "access", "activities", "activity", "cities", "created", "demand", "facilities", "general", "generally", "individual", "outside", "parks", "physical", "population", "rather", "recreation", "river", "training". | EXACT TITLE in tourism_hospitality: "Outdoor recreation".
0.500
accessaccessibilityamongbegancasescommunitycomprehensivecontroldevelopeddevelopmentdifferentdistributioneconomicseducationenvironmentalevenhealthhealthcareimplementationimportant
SHARED TOKENS (42): "access", "accessibility", "among", "began", "cases", "community", "comprehensive", "control", "developed", "development", "different", "distribution", "economics", "education", "environmental", "even", "health", "healthcare", "implementation", "important".... | EXACT TITLE in land_use_planning: "Public health". | EXACT TITLE in tourism_hospitality: "Public health".
0.500
businesscurrentestablishedformhistoricidahoincreasinglyinterstatemodernownersriverroutesseparatetraffictrailvalleywestern
SHARED TOKENS (17): "business", "current", "established", "form", "historic", "idaho", "increasingly", "interstate", "modern", "owners", "river", "routes", "separate", "traffic", "trail", "valley", "western". | EXACT TITLE in tourism_hospitality: "Oregon Trail".
0.500
Tourism ↗ EXACT TITLE
activitybeyondbusinesscommercialdevelopmenteconomiceffectsenvironmentalgenerallygrewgrowthincreaselocalmarketsorganizationorganizationsoutsideplacespotentialprograms
SHARED TOKENS (24): "activity", "beyond", "business", "commercial", "development", "economic", "effects", "environmental", "generally", "grew", "growth", "increase", "local", "markets", "organization", "organizations", "outside", "places", "potential", "programs".... | EXACT TITLE in tourism_hospitality: "Tourism".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecitiescreatedemanddevelopeddirectlyeventsimportantlandlargemajorpopulationpotentialreducerelatedresourcetreatmenturbanvolumewater
SHARED TOKENS (20): "become", "cities", "create", "demand", "developed", "directly", "events", "important", "land", "large", "major", "population", "potential", "reduce", "related", "resource", "treatment", "urban", "volume", "water". | EXACT TITLE in land_use_planning: "Stormwater".
0.500
activityanalysisanotherassociatedbuildingbuildingscentralcitiescomplexitycontroldesigndevelopmentdifferentembeddedenvironmentalformformationformsfunctionshistoric
SHARED TOKENS (42): "activity", "analysis", "another", "associated", "building", "buildings", "central", "cities", "complexity", "control", "design", "development", "different", "embedded", "environmental", "form", "formation", "forms", "functions", "historic".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
appropriatebeganbureaucreatedcreatingdepartmentenforcementfebruaryidaholawmunicipalorganizationpolicepublicstatewide
SHARED TOKENS (15): "appropriate", "began", "bureau", "created", "creating", "department", "enforcement", "february", "idaho", "law", "municipal", "organization", "police", "public", "statewide". | EXACT TITLE in tourism_hospitality: "Idaho State Police".
0.500
agenciesconditionsconstructioncontroldesignenvironmentalestategeneralinfrastructurejurisdictionslandscapelicenselicensedlicensesmanagementparksplanningpossessprivateproduce
SHARED TOKENS (29): "agencies", "conditions", "construction", "control", "design", "environmental", "estate", "general", "infrastructure", "jurisdictions", "landscape", "license", "licensed", "licenses", "management", "parks", "planning", "possess", "private", "produce".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
addressingbusinessescitiesconstructioneconomicgovernmentgrowthhousinginfrastructurelandneighborhoodsprivateprocesspublicredevelopmentspacesurban
SHARED TOKENS (17): "addressing", "businesses", "cities", "construction", "economic", "government", "growth", "housing", "infrastructure", "land", "neighborhoods", "private", "process", "public", "redevelopment", "spaces", "urban". | EXACT TITLE in land_use_planning: "Urban renewal".
0.500
boundariescasescertificationformalfoundlicenseoutsideplacementpotentialprofessionalregulatedsectorsstudysystemtradetraining
SHARED TOKENS (16): "boundaries", "cases", "certification", "formal", "found", "license", "outside", "placement", "potential", "professional", "regulated", "sectors", "study", "system", "trade", "training". | EXACT TITLE in tourism_hospitality: "Apprenticeship".
0.500
activityamericancanyoncenterconservationedgeidahoimportantlandlargestnampanationaloutsideriversitesurroundingwaterwildlife
SHARED TOKENS (18): "activity", "american", "canyon", "center", "conservation", "edge", "idaho", "important", "land", "largest", "nampa", "national", "outside", "river", "site", "surrounding", "water", "wildlife". | EXACT TITLE in tourism_hospitality: "Deer Flat National Wildlife Refuge".
0.500
americancapacitycapitalcitiescombineconnectingcostdesignflexibilitylargestmillionnetworkpublicrapidreducesinglesystemsystemstraffictransit
SHARED TOKENS (21): "american", "capacity", "capital", "cities", "combine", "connecting", "cost", "design", "flexibility", "largest", "million", "network", "public", "rapid", "reduce", "single", "system", "systems", "traffic", "transit".... | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
beyondboiseconnectseagleextendshighwayidahoparkspermitresidentialriverroadroutesstreetssystemtrailtransportationurban
SHARED TOKENS (18): "beyond", "boise", "connects", "eagle", "extends", "highway", "idaho", "parks", "permit", "residential", "river", "road", "routes", "streets", "system", "trail", "transportation", "urban". | EXACT TITLE in tourism_hospitality: "Boise River Greenbelt".
0.500
activitiesagenciesagriculturaldevelopmentdifferentdistrictseducationestablishinggovernmentgovernmentshistoriclandlimitlocalnationaloperatedoperationalorganizationsotherwiseowner
SHARED TOKENS (33): "activities", "agencies", "agricultural", "development", "different", "districts", "education", "establishing", "government", "governments", "historic", "land", "limit", "local", "national", "operated", "operational", "organizations", "otherwise", "owner".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
analysisappliedcurrentdatadesigndifferentformformalformslargeplacementpropertiesresearchrestrictedscalespatialstructuresstudiesstudyurban
SHARED TOKENS (20): "analysis", "applied", "current", "data", "design", "different", "form", "formal", "forms", "large", "placement", "properties", "research", "restricted", "scale", "spatial", "structures", "studies", "study", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.500
communitycontemporaryculturaldevelopmenteconomicenvironmentalformhistoricalhistorylocalpreservationpreservingresourcessitesthemvalues
SHARED TOKENS (16): "community", "contemporary", "cultural", "development", "economic", "environmental", "form", "historical", "history", "local", "preservation", "preserving", "resources", "sites", "them", "values". | EXACT TITLE in tourism_hospitality: "Heritage tourism".
0.500
Airport ↗ Q1248784 EXACT TITLE
activeairportbuildingschangecommercialcontroleffectsemergencyenvironmentalexperiencefacilitiesgeneralimportantinfrastructurelandlargelocalmaintainmajoroperation
SHARED TOKENS (35): "active", "airport", "buildings", "change", "commercial", "control", "effects", "emergency", "environmental", "experience", "facilities", "general", "important", "infrastructure", "land", "large", "local", "maintain", "major", "operation".... | EXACT TITLE in land_use_planning: "Airport". | EXACT TITLE in tourism_hospitality: "Airport".
0.500
Urban design ↗ Q63100 EXACT TITLE
buildingscitiescommunityconnectdependentdesigneconomicenvironmentalhistoricalimportantlandscapelocalpagephysicalplanningprojectpublicregionalrelatedspace
SHARED TOKENS (26): "buildings", "cities", "community", "connect", "dependent", "design", "economic", "environmental", "historical", "important", "landscape", "local", "page", "physical", "planning", "project", "public", "regional", "related", "space".... | EXACT TITLE in land_use_planning: "Urban design".
0.500
administrationadministrativeagenciesdepartmentdistrictfederalfinancialfunctionsgovernmentgrantslocalmaintainofficeoperatorsprogramsproviderspublicregionalrequirementssystems
SHARED TOKENS (23): "administration", "administrative", "agencies", "department", "district", "federal", "financial", "functions", "government", "grants", "local", "maintain", "office", "operators", "programs", "providers", "public", "regional", "requirements", "systems".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
Fishing ↗ Q14373 EXACT TITLE
activitiesactivityadditionalappliedcommercialcontrolleddirectemploymentidentifiedimportantlong-termmillionmodernparkproductionprovidewaterwildlife
SHARED TOKENS (18): "activities", "activity", "additional", "applied", "commercial", "controlled", "direct", "employment", "identified", "important", "long-term", "million", "modern", "park", "production", "provide", "water", "wildlife". | EXACT TITLE in tourism_hospitality: "Fishing".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesapplicationdevelopeddevelopmentdistributedenvironmentalfederalfoundfoundationgrantshighwaylandmetropolitannationalorgplanningplatformsprofessionalprotection
SHARED TOKENS (29): "administration", "agencies", "application", "developed", "development", "distributed", "environmental", "federal", "found", "foundation", "grants", "highway", "land", "metropolitan", "national", "org", "planning", "platforms", "professional", "protection".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativearrangementbeganbuiltbusinesscenterclassifycomplexitycostdepartmentdepartmentsdestinationdirecteconomyeventfacilitiesformfunction
SHARED TOKENS (48): "access", "additional", "administrative", "arrangement", "began", "built", "business", "center", "classify", "complexity", "cost", "department", "departments", "destination", "direct", "economy", "event", "facilities", "form", "function".... | EXACT TITLE in land_use_planning: "Hotel". | EXACT TITLE in tourism_hospitality: "Hotel".
0.500
Rural tourism ↗ EXACT TITLE
activeactivitiesagriculturalagricultureamongbusinessescommunityconnectsconservationcreatingdevelopeddevelopmenteconomiceducationemploymentenvironmentaleventsexperienceformgovernment
SHARED TOKENS (38): "active", "activities", "agricultural", "agriculture", "among", "businesses", "community", "connects", "conservation", "creating", "developed", "development", "economic", "education", "employment", "environmental", "events", "experience", "form", "government".... | EXACT TITLE in tourism_hospitality: "Rural tourism".
0.500
Wetland ↗ Q170321 EXACT TITLE
actamongbuildingchangeconservationcontroldifferentdistinctenvironmentalfloodformfunctionfunctionshealthidentifyinfrastructurelandslargestprocessprotect
SHARED TOKENS (31): "act", "among", "building", "change", "conservation", "control", "different", "distinct", "environmental", "flood", "form", "function", "functions", "health", "identify", "infrastructure", "lands", "largest", "process", "protect".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
accessassociationcompetitivecostsdevelopmenteconomicefficiencyestatefinancialformsfundinggeneralgovernmenthistoricalinfrastructureintendedinvestmentlocalmodelmunicipal
SHARED TOKENS (43): "access", "association", "competitive", "costs", "development", "economic", "efficiency", "estate", "financial", "forms", "funding", "general", "government", "historical", "infrastructure", "intended", "investment", "local", "model", "municipal".... | EXACT TITLE in land_use_planning: "Public transport".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciesamericancanyoncentralcommercialconstructioncontrolcreateddevelopedfloodgovernmentshabitatheavilyhistoryidahoimportantirrigationlargelargest
SHARED TOKENS (35): "activities", "agencies", "american", "canyon", "central", "commercial", "construction", "control", "created", "developed", "flood", "governments", "habitat", "heavily", "history", "idaho", "important", "irrigation", "large", "largest".... | EXACT TITLE in tourism_hospitality: "Snake River".
0.500
associatedbeyonddatadevelopmenteventsgraphincreasinglyknowledgelinkedmodelrelationshipsrepresentationresearchsearchsystemsunderlyinguses
SHARED TOKENS (17): "associated", "beyond", "data", "development", "events", "graph", "increasingly", "knowledge", "linked", "model", "relationships", "representation", "research", "search", "systems", "underlying", "uses". | EXACT TITLE in land_use_planning: "Knowledge graph". | EXACT TITLE in tourism_hospitality: "Knowledge graph".
0.500
actagenciesagriculturalagriculturebroaderconservationdepartmenteffectsinvestmentlandslocalprivateprogramsprojectprotectresourcesruralwater
SHARED TOKENS (18): "act", "agencies", "agricultural", "agriculture", "broader", "conservation", "department", "effects", "investment", "lands", "local", "private", "programs", "project", "protect", "resources", "rural", "water". | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
administrativeappliedblockbuildingcommercialconstructionculturaldesigndevelopmentfunctionsinstitutionalmixed-usemultipleneighborhoodpedestrianplanningpolicyprivateresidentialsingle
SHARED TOKENS (27): "administrative", "applied", "block", "building", "commercial", "construction", "cultural", "design", "development", "functions", "institutional", "mixed-use", "multiple", "neighborhood", "pedestrian", "planning", "policy", "private", "residential", "single".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescomponentsconstructiondevelopmentformsgovernmenthistoryimportantlandlawlegalmapsownershipplanningprofessionalpropertyrecordedrequiredresearch
SHARED TOKENS (25): "analysis", "boundaries", "components", "construction", "development", "forms", "government", "history", "important", "land", "law", "legal", "maps", "ownership", "planning", "professional", "property", "recorded", "required", "research".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
Motel ↗ Q216212 EXACT TITLE
beganbuildingbuiltcentralchaindevelopeddirectlygrowthhighwayhistorichotellargelaterlodgingnationalparkingplacesratherresponseroad
SHARED TOKENS (28): "began", "building", "built", "central", "chain", "developed", "directly", "growth", "highway", "historic", "hotel", "large", "later", "lodging", "national", "parking", "places", "rather", "response", "road".... | EXACT TITLE in land_use_planning: "Motel". | EXACT TITLE in tourism_hospitality: "Motel".
0.500
accessibilityactivitiesadministrationadoptedanalysisanotherbroaderbuildingsbuiltbusinesscapitalcategorycitiescommunitycreatingdesigndevelopmentdifferentdistributioneconomic
SHARED TOKENS (66): "accessibility", "activities", "administration", "adopted", "analysis", "another", "broader", "buildings", "built", "business", "capital", "category", "cities", "community", "creating", "design", "development", "different", "distribution", "economic".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
ServSafe ↗ Q7455532 EXACT TITLE
americanassociationcertificatecertificationmanagementmillionnationalpreparationprocessprogramprotectionrequiredrestaurantssafetystafftrainingwork
SHARED TOKENS (17): "american", "association", "certificate", "certification", "management", "million", "national", "preparation", "process", "program", "protection", "required", "restaurants", "safety", "staff", "training", "work". | EXACT TITLE in tourism_hospitality: "ServSafe".
0.500
actagenciesapplyauthoritycouncilcreateddecemberdecisionseffectsenvironmentalestablishedfederalfinalgovernmentlawmodelednationalpolicypotentialpreserve
SHARED TOKENS (25): "act", "agencies", "apply", "authority", "council", "created", "december", "decisions", "effects", "environmental", "established", "federal", "final", "government", "law", "modeled", "national", "policy", "potential", "preserve".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
actaddressingcodifiedconservationcontroldirectlyenvironmentalfederalformfundinggoverninggovernmentslawmaintainmajormodernphysicalprotectionprovisionsregulations
SHARED TOKENS (25): "act", "addressing", "codified", "conservation", "control", "directly", "environmental", "federal", "form", "funding", "governing", "governments", "law", "maintain", "major", "modern", "physical", "protection", "provisions", "regulations".... | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
adoptedappliedapplyappropriateapprovedauthoritybecomesbeganbuildingbuildingscodecomplianceconstructioncontrolcouncildepartmentsdesigndistricteffectsenvironmental
SHARED TOKENS (47): "adopted", "applied", "apply", "appropriate", "approved", "authority", "becomes", "began", "building", "buildings", "code", "compliance", "construction", "control", "council", "departments", "design", "district", "effects", "environmental".... | EXACT TITLE in land_use_planning: "Building code".
0.500
actadministrationbuildingscommunityconstructioncontrolcostcostscreatedcreatingdebtdecemberdevelopmentemergencyenforcementfederalfloodgenerallygovernmenthomes
SHARED TOKENS (36): "act", "administration", "buildings", "community", "construction", "control", "cost", "costs", "created", "creating", "debt", "december", "development", "emergency", "enforcement", "federal", "flood", "generally", "government", "homes".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
associateddemandeconomicemergencyformalformsgenerallygovernmenthousingincreaseslocalmarketsnationalownershiprentalresponsesupply
SHARED TOKENS (17): "associated", "demand", "economic", "emergency", "formal", "forms", "generally", "government", "housing", "increases", "local", "markets", "national", "ownership", "rental", "response", "supply". | EXACT TITLE in land_use_planning: "Affordable housing".
0.500
actcoveringcreateddepartmentdistrictfederalhistoricalmanagementmillionnationalparkparksplacespreservingpropertiespublicthemunits
SHARED TOKENS (18): "act", "covering", "created", "department", "district", "federal", "historical", "management", "million", "national", "park", "parks", "places", "preserving", "properties", "public", "them", "units". | EXACT TITLE in tourism_hospitality: "National Park Service".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomeblockcommissiondepartmentgeneralgoverningindividualinformationlandlandslegallegallylocalmapofficeplanningpublicratherreview
SHARED TOKENS (26): "another", "become", "block", "commission", "department", "general", "governing", "individual", "information", "land", "lands", "legal", "legally", "local", "map", "office", "planning", "public", "rather", "review".... | EXACT TITLE in land_use_planning: "Plat". | EXACT TITLE in tourism_hospitality: "Plat".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcasescontrolcreatecurrentdescribedestinationfloodgenerallyincreaseirrigationmanagementmodernrequiringresourcesriversourcesourcessupply
SHARED TOKENS (22): "building", "built", "cases", "control", "create", "current", "describe", "destination", "flood", "generally", "increase", "irrigation", "management", "modern", "requiring", "resources", "river", "source", "sources", "supply".... | EXACT TITLE in land_use_planning: "Canal".
0.500
Chef ↗ Q3499072 EXACT TITLE
businessdifferentformalfoundmodernoperationspreparationproductionprofessionalreceiverestaurantsstaffsystemsystemstraining
SHARED TOKENS (15): "business", "different", "formal", "found", "modern", "operations", "preparation", "production", "professional", "receive", "restaurants", "staff", "system", "systems", "training". | EXACT TITLE in tourism_hospitality: "Chef".
0.500
Franchising ↗ Q171947 EXACT TITLE
agreementanotherarrangementbrandbusinesscapitalchainconditionsdirecteconomicexpansionexplicitlyfeesfinancialgrowthindividualinvestmentlargelegallicenses
SHARED TOKENS (32): "agreement", "another", "arrangement", "brand", "business", "capital", "chain", "conditions", "direct", "economic", "expansion", "explicitly", "fees", "financial", "growth", "individual", "investment", "large", "legal", "licenses".... | EXACT TITLE in tourism_hospitality: "Franchising".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisarrangementboundariesbuildingbuildingsconditionsconstructioncreatingdependentdesigndevelopmentfacilitiesgardenhistoricalinfrastructurelandlandscapelegallicensedmajor
SHARED TOKENS (41): "analysis", "arrangement", "boundaries", "building", "buildings", "conditions", "construction", "creating", "dependent", "design", "development", "facilities", "garden", "historical", "infrastructure", "land", "landscape", "legal", "licensed", "major".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
activitiesagriculturalagricultureannualapprovalcommissioncontextcontrolleddevelopmentevenformsgenerallyirrigatedirrigationlandlandsmeansorganizationpermittedproduce
SHARED TOKENS (26): "activities", "agricultural", "agriculture", "annual", "approval", "commission", "context", "controlled", "development", "even", "forms", "generally", "irrigated", "irrigation", "land", "lands", "means", "organization", "permitted", "produce".... | EXACT TITLE in land_use_planning: "Agricultural land". | EXACT TITLE in tourism_hospitality: "Agricultural land".
0.500
agenciesbuildingsbuiltcomponentsconstructiondepartmentsdesigndistinguishgovernmentinfrastructurelocallymunicipalnationalphysicalpipelinesprivateprofessionalpublicstructuralsystems
SHARED TOKENS (21): "agencies", "buildings", "built", "components", "construction", "departments", "design", "distinguish", "government", "infrastructure", "locally", "municipal", "national", "physical", "pipelines", "private", "professional", "public", "structural", "systems".... | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdifferentflexibilityformindividualmeaningmultipleoperatesoperatingoperationsrapidstreetssystemsystemstechnologytogethertraffictransit
SHARED TOKENS (23): "broader", "capacity", "conditions", "different", "flexibility", "form", "individual", "meaning", "multiple", "operates", "operating", "operations", "rapid", "streets", "system", "systems", "technology", "together", "traffic", "transit".... | EXACT TITLE in land_use_planning: "Light rail".
0.500
arrangementbrandbusinessconstructioncontractscontroldesigndirectfeesfunctionsgovernmentinvestmentlargelicensinglocalmanagementoperatingoperationoperationalperforms
SHARED TOKENS (28): "arrangement", "brand", "business", "construction", "contracts", "control", "design", "direct", "fees", "functions", "government", "investment", "large", "licensing", "local", "management", "operating", "operation", "operational", "performs".... | EXACT TITLE in tourism_hospitality: "Management contract".
0.500
activitiescommunitycomprehensivecurrentdevelopmentdocumentestablishingfoundationgeneralgrowthhousingimportantindividuallandlargelong-termneighborhoodplanplannersplanning
SHARED TOKENS (30): "activities", "community", "comprehensive", "current", "development", "document", "establishing", "foundation", "general", "growth", "housing", "important", "individual", "land", "large", "long-term", "neighborhood", "plan", "planners", "planning".... | EXACT TITLE in land_use_planning: "Comprehensive planning". | EXACT TITLE in tourism_hospitality: "Comprehensive planning".
0.500
agenciesapplybusinessescomprehensivedesignevaluationfacilitiesgenerallygovernmentinfluenceplannersplanningprivateprocesspublicspatialstreetssystemtransportation
SHARED TOKENS (19): "agencies", "apply", "businesses", "comprehensive", "design", "evaluation", "facilities", "generally", "government", "influence", "planners", "planning", "private", "process", "public", "spatial", "streets", "system", "transportation". | EXACT TITLE in land_use_planning: "Transportation planning". | EXACT TITLE in tourism_hospitality: "Transportation planning".
0.500
admissionamericanbeganboisebuildingcapitalconstructioncostdecemberdepartmentdesigndistrictfederalfinalformationgovernmenthistoricidaholaterlists
SHARED TOKENS (26): "admission", "american", "began", "boise", "building", "capital", "construction", "cost", "december", "department", "design", "district", "federal", "final", "formation", "government", "historic", "idaho", "later", "lists".... | EXACT TITLE in tourism_hospitality: "Idaho State Capitol".
0.480
americanboisebrandconsumercreateddatademandidahomajormarketproducedproductstechnologytogether
SHARED TOKENS (14): "american", "boise", "brand", "consumer", "created", "data", "demand", "idaho", "major", "market", "produced", "products", "technology", "together". | EXACT TITLE in land_use_planning: "Micron Technology".
0.480
Annexation ↗ EXACT TITLE
acquisitionactanothercontrolcurrentdescribesdescribingdistinctgenerallylawlegalmeansphysicalpolitical
SHARED TOKENS (14): "acquisition", "act", "another", "control", "current", "describes", "describing", "distinct", "generally", "law", "legal", "means", "physical", "political". | EXACT TITLE in land_use_planning: "Annexation".
0.480
Fort Boise ↗ Q3077782 EXACT TITLE
becomeboiseboundarycanyoncapitaldevelopeddifferentdistrictestablishedgovernmenthistoricidahoriverwestern
SHARED TOKENS (14): "become", "boise", "boundary", "canyon", "capital", "developed", "different", "district", "established", "government", "historic", "idaho", "river", "western". | EXACT TITLE in tourism_hospitality: "Fort Boise".
0.460
Food code ↗ Q5465447 EXACT TITLE
codeconditionsdefinedeterminedistributionfoundmaterialsnationalpreparationpreservationproductsregionalstandards
SHARED TOKENS (13): "code", "conditions", "define", "determine", "distribution", "found", "materials", "national", "preparation", "preservation", "products", "regional", "standards". | EXACT TITLE in tourism_hospitality: "Food code".
0.460
associationboiseconditionsgenerallyidaholandnationaloperatedorganizationprivaterecreationroadwestern
SHARED TOKENS (13): "association", "boise", "conditions", "generally", "idaho", "land", "national", "operated", "organization", "private", "recreation", "road", "western". | EXACT TITLE in tourism_hospitality: "Bogus Basin".
0.460
agriculturalassociationboiseidaholandlocalmetropolitanresourcesriverruraltreasurevalleywestern
SHARED TOKENS (13): "agricultural", "association", "boise", "idaho", "land", "local", "metropolitan", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in land_use_planning: "Treasure Valley". | EXACT TITLE in tourism_hospitality: "Treasure Valley".
0.460
Trail ↗ Q628179 EXACT TITLE
americanapplieddescribeexpansionintendedlandpedestrianrestrictedroadroutessimultaneouslytrailtravel
SHARED TOKENS (13): "american", "applied", "describe", "expansion", "intended", "land", "pedestrian", "restricted", "road", "routes", "simultaneously", "trail", "travel". | EXACT TITLE in land_use_planning: "Trail". | EXACT TITLE in tourism_hospitality: "Trail".
0.460
boisecenterdistrictdowntowneventexpansionfeetidaholargestmeetingoperatingspacesquare
SHARED TOKENS (13): "boise", "center", "district", "downtown", "event", "expansion", "feet", "idaho", "largest", "meeting", "operating", "space", "square". | EXACT TITLE in tourism_hospitality: "Boise Centre".
0.440
buildingsbuiltcitiesconservationdevelopmenthistorichistoricalmaintainspreservationpreserveproductsprotect
SHARED TOKENS (12): "buildings", "built", "cities", "conservation", "development", "historic", "historical", "maintains", "preservation", "preserve", "products", "protect". | EXACT TITLE in tourism_hospitality: "Historic preservation".
0.440
agenciescomdatainformationprocessproduceprovidersreducesearchsourcestraveluses
SHARED TOKENS (12): "agencies", "com", "data", "information", "process", "produce", "providers", "reduce", "search", "sources", "travel", "uses". | EXACT TITLE in tourism_hospitality: "Metasearch engine".
0.440
approximatelycollegecommissioncommunitycomprehensivedowntownidahopublicriverstatustogetherwestern
SHARED TOKENS (12): "approximately", "college", "commission", "community", "comprehensive", "downtown", "idaho", "public", "river", "status", "together", "western". | EXACT TITLE in tourism_hospitality: "North Idaho College".
0.440
Easement ↗ Q448405 EXACT TITLE
accessamonganotheritselfjurisdictionslandlawpropertypublicrealrightsroad
SHARED TOKENS (12): "access", "among", "another", "itself", "jurisdictions", "land", "law", "property", "public", "real", "rights", "road". | EXACT TITLE in land_use_planning: "Easement".
0.440
applicablefederalgovernmentslawprivateprocesspropertyprovideregulationsregulatoryrightsvalue
SHARED TOKENS (12): "applicable", "federal", "governments", "law", "private", "process", "property", "provide", "regulations", "regulatory", "rights", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.440
Floodplain ↗ Q193110 EXACT TITLE
agriculturalcontroldevelopedexperiencefloodheavilyimportantlandriverurbanvalleywater
SHARED TOKENS (12): "agricultural", "control", "developed", "experience", "flood", "heavily", "important", "land", "river", "urban", "valley", "water". | EXACT TITLE in land_use_planning: "Floodplain".
0.440
Museum ↗ Q33506 EXACT TITLE
artsassociatedhistorylargelaterlocaloutsidepreservationpreservingprivatepublicspecialists
SHARED TOKENS (12): "arts", "associated", "history", "large", "later", "local", "outside", "preservation", "preserving", "private", "public", "specialists". | EXACT TITLE in tourism_hospitality: "Museum".
0.440
administrativeappliesbuildingcodedevelopmentlandmunicipalordinanceregulationsrulesstandardszoning
SHARED TOKENS (12): "administrative", "applies", "building", "code", "development", "land", "municipal", "ordinance", "regulations", "rules", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.420
affectaffectingbuiltcontrolenvironmentalhealthmajoroccupationalpublicrequirementsstudy
SHARED TOKENS (11): "affect", "affecting", "built", "control", "environmental", "health", "major", "occupational", "public", "requirements", "study". | EXACT TITLE in tourism_hospitality: "Environmental health".
0.420
becomedescribeestablishedevaluationgeneralidentifyingmodernprocessproductionprofessionalspecialized
SHARED TOKENS (11): "become", "describe", "established", "evaluation", "general", "identifying", "modern", "process", "production", "professional", "specialized". | EXACT TITLE in tourism_hospitality: "Wine tasting".
0.420
Aquifer ↗ Q208791 EXACT TITLE
beyondformationlandlayermajormaterialsrelatedsourcestudyunderlyingwater
SHARED TOKENS (11): "beyond", "formation", "land", "layer", "major", "materials", "related", "source", "study", "underlying", "water". | EXACT TITLE in land_use_planning: "Aquifer".
0.420
agenciesamericanapproximatelybrandcomgroupmillionoperatespercentreviewstravel
SHARED TOKENS (11): "agencies", "american", "approximately", "brand", "com", "group", "million", "operates", "percent", "reviews", "travel". | EXACT TITLE in tourism_hospitality: "Tripadvisor".
0.400
Resort ↗ Q875157 EXACT TITLE
activitiesamericancentralcommercialhotelmeansoperatedownershipprovidesingle
SHARED TOKENS (10): "activities", "american", "central", "commercial", "hotel", "means", "operated", "ownership", "provide", "single". | EXACT TITLE in tourism_hospitality: "Resort".
0.400
departmentfederalfundingidahoinfrastructureoperationsorganizationplanningprogramstransportation
SHARED TOKENS (10): "department", "federal", "funding", "idaho", "infrastructure", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.400
categoryestateeventhospitalitylodgingparksplanningrealrestaurantstravel
SHARED TOKENS (10): "category", "estate", "event", "hospitality", "lodging", "parks", "planning", "real", "restaurants", "travel". | EXACT TITLE in tourism_hospitality: "Hospitality industry".
0.400
commercialdevelopmenthousinglandlargeotherwiseparksretailsinglesmaller
SHARED TOKENS (10): "commercial", "development", "housing", "land", "large", "otherwise", "parks", "retail", "single", "smaller". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.380
americanbuildingcenterlargemajormeetingroomsshowstrade
SHARED TOKENS (9): "american", "building", "center", "large", "major", "meeting", "rooms", "shows", "trade". | EXACT TITLE in tourism_hospitality: "Convention center".
0.380
departmentdevelopmenteconomicgrantsgrowthidahopublicresourcestax
SHARED TOKENS (9): "department", "development", "economic", "grants", "growth", "idaho", "public", "resources", "tax". | EXACT TITLE in tourism_hospitality: "Idaho Department of Commerce".
0.380
artsformgeneralinstitutionslargepreparationprincipalrequiresrestaurants
SHARED TOKENS (9): "arts", "form", "general", "institutions", "large", "preparation", "principal", "requires", "restaurants". | EXACT TITLE in tourism_hospitality: "Culinary arts".
0.380
agenciescouncildevelopmentdivisionenvironmentalfederalofficepolicyworks
SHARED TOKENS (9): "agencies", "council", "development", "division", "environmental", "federal", "office", "policy", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.380
administrativeauthoritycomparativegovernmentjurisdictionspowerprocessreviewseparation
SHARED TOKENS (9): "administrative", "authority", "comparative", "government", "jurisdictions", "power", "process", "review", "separation". | EXACT TITLE in land_use_planning: "Judicial review".
0.380
applicableauthorizesdistrictlandordinancepermitspecial-useuseszoning
SHARED TOKENS (9): "applicable", "authorizes", "district", "land", "ordinance", "permit", "special-use", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.380
americanbrandbusinesschaindecembergardenhotelpropertiesrooms
SHARED TOKENS (9): "american", "brand", "business", "chain", "december", "garden", "hotel", "properties", "rooms". | EXACT TITLE in tourism_hospitality: "Hilton Garden Inn".
0.360
additionalbrandchaindevelopmenthoteljunepipelinerooms
SHARED TOKENS (8): "additional", "brand", "chain", "development", "hotel", "june", "pipeline", "rooms". | EXACT TITLE in tourism_hospitality: "Residence Inn by Marriott".
0.340
Hiking ↗ Q12014035 EXACT TITLE
activitydescribesdevelopedformsorganizationsparkurban
SHARED TOKENS (7): "activity", "describes", "developed", "forms", "organizations", "park", "urban". | EXACT TITLE in tourism_hospitality: "Hiking".
0.340
Winery ↗ Q156362 EXACT TITLE
buildingbusinesslargemakesproducesproductionproperty
SHARED TOKENS (7): "building", "business", "large", "makes", "produces", "production", "property". | EXACT TITLE in tourism_hospitality: "Winery".
0.340
communityculturalhistoryhotelprovideroomsurban
SHARED TOKENS (7): "community", "cultural", "history", "hotel", "provide", "rooms", "urban". | EXACT TITLE in tourism_hospitality: "Boutique hotel".
0.340
Drainage ↗ Q7481320 EXACT TITLE
agriculturalconditionsgrowthlandproductionsupplieswater
SHARED TOKENS (7): "agricultural", "conditions", "growth", "land", "production", "supplies", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.340
dwellinghotelincreasinglyrentalruralsmallertravel
SHARED TOKENS (7): "dwelling", "hotel", "increasingly", "rental", "rural", "smaller", "travel". | EXACT TITLE in tourism_hospitality: "Vacation rental".
0.340
Sales tax ↗ Q11055488 EXACT TITLE
consumerdirectlyeducationgoverningproviderelatedtax
SHARED TOKENS (7): "consumer", "directly", "education", "governing", "provide", "related", "tax". | EXACT TITLE in tourism_hospitality: "Sales tax".
0.320
businessesformslicenseofficialotherwisepermit
SHARED TOKENS (6): "businesses", "forms", "license", "official", "otherwise", "permit". | EXACT TITLE in tourism_hospitality: "Liquor license".
0.320
departmentlandsnationalpublicsystemwildlife
SHARED TOKENS (6): "department", "lands", "national", "public", "system", "wildlife". | EXACT TITLE in tourism_hospitality: "National Wildlife Refuge".
0.300
actassetassetsbuildingbuildingscapitalcasescommercialdevelopmentdistinctestatefinancefinancialfinancinggoverninghomeshousinginstitutionalinvestmentmajor
SHARED TOKENS (34): "act", "asset", "assets", "building", "buildings", "capital", "cases", "commercial", "development", "distinct", "estate", "finance", "financial", "financing", "governing", "homes", "housing", "institutional", "investment", "major"....
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycostsculturaldescribedevelopmentemploymentgovernmentgrowthhealthhousinglandlong-rangemixed-useneighborhoodplanningpreservepublicregionalresourcesstreets
SHARED TOKENS (23): "community", "costs", "cultural", "describe", "development", "employment", "government", "growth", "health", "housing", "land", "long-range", "mixed-use", "neighborhood", "planning", "preserve", "public", "regional", "resources", "streets"....
0.300
Ecotourism ↗ Q187449 KW CROSS HIGH
activeassociatedchangecommunityconservationcreationculturaldependsdifferentdirecteconomiceducationefficiencyenvironmentalexperienceformgeneralgenerallyimportantinfrastructure
SHARED TOKENS (30): "active", "associated", "change", "community", "conservation", "creation", "cultural", "depends", "different", "direct", "economic", "education", "efficiency", "environmental", "experience", "form", "general", "generally", "important", "infrastructure"....
0.300
brandchainhotellodgingoperated
SHARED TOKENS (5): "brand", "chain", "hotel", "lodging", "operated". | EXACT TITLE in tourism_hospitality: "SpringHill Suites".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcitiescommercialcostsdevelopmentenvironmentalexpansionformgrowthhousinginfrastructurelandlargemodernplanningpopulationprivateproperty
SHARED TOKENS (32): "associated", "become", "building", "cities", "commercial", "costs", "development", "environmental", "expansion", "form", "growth", "housing", "infrastructure", "land", "large", "modern", "planning", "population", "private", "property"....
0.300
Street network ↗ Q358078 KW CROSS HIGH
affectanalysisbecomecitiescreatingedgesfoundationhighwaynationalnetworkstreetstreetssystemtraffictransportation
SHARED TOKENS (15): "affect", "analysis", "become", "cities", "creating", "edges", "foundation", "highway", "national", "network", "street", "streets", "system", "traffic", "transportation".
0.300
Protected area ↗ KW CROSS HIGH
adoptedagreementapproximatelybeyondcannotconservationcoveringculturaldecemberframeworkgenerallyhabitatlandlocalmaintainmultiplenationalpercentproductsprotect
SHARED TOKENS (27): "adopted", "agreement", "approximately", "beyond", "cannot", "conservation", "covering", "cultural", "december", "framework", "generally", "habitat", "land", "local", "maintain", "multiple", "national", "percent", "products", "protect"....
0.300
applicationbrandbuildingbusinesschangingconferencescreationdesigndevelopmentdifferentemergencyeventeventsformalidentifyingknowledgemanagementmarketmeetingsorganizations
SHARED TOKENS (33): "application", "brand", "building", "business", "changing", "conferences", "creation", "design", "development", "different", "emergency", "event", "events", "formal", "identifying", "knowledge", "management", "market", "meetings", "organizations"....
0.300
boisecanyoncitieshighwayidahointerstatelargemajoroutsidepopulationriverruralscenicsmallervalley
SHARED TOKENS (15): "boise", "canyon", "cities", "highway", "idaho", "interstate", "large", "major", "outside", "population", "river", "rural", "scenic", "smaller", "valley".
0.300
administrationbusinesscollegecoversdepartmentdestinationhospitalityhotelmanagementorganizationsparksrestaurantsschoolstudiesstudyuniversity
SHARED TOKENS (16): "administration", "business", "college", "covers", "department", "destination", "hospitality", "hotel", "management", "organizations", "parks", "restaurants", "school", "studies", "study", "university".
0.300
Airbnb ↗ Q63327 EXACT TITLE
americancommissionhousingoperatingplatform
SHARED TOKENS (5): "american", "commission", "housing", "operating", "platform". | EXACT TITLE in tourism_hospitality: "Airbnb".
0.300
actagenciesauthoritycodecomprehensiveconservationdecemberdependdevelopmentdifferentdirectseconomicfederalgrowthlawmeansnationalpreservationprotectprovisions
SHARED TOKENS (26): "act", "agencies", "authority", "code", "comprehensive", "conservation", "december", "depend", "development", "different", "directs", "economic", "federal", "growth", "law", "means", "national", "preservation", "protect", "provisions"....
0.300
directlyeconomygenerallyintendedlargelivelocalmarketmarketsphysicalproduceproductspublicregulatedretailstructures
SHARED TOKENS (16): "directly", "economy", "generally", "intended", "large", "live", "local", "market", "markets", "physical", "produce", "products", "public", "regulated", "retail", "structures".
0.300
approvalbuildingcannotcodecomplianceconstructiondevelopmenteconomyemploymentexpansionfinancinggenerallygovernmentgovernmentsjurisdictionslawlocalnationalpermitpermits
SHARED TOKENS (27): "approval", "building", "cannot", "code", "compliance", "construction", "development", "economy", "employment", "expansion", "financing", "generally", "government", "governments", "jurisdictions", "law", "local", "national", "permit", "permits"....
0.300
accessactapplicablebroadercostdatadevelopmentformgeneralgovernmentinformationinstitutionslegalmeanspolicyprivateprotectionprovisionspublicresponse
SHARED TOKENS (23): "access", "act", "applicable", "broader", "cost", "data", "development", "form", "general", "government", "information", "institutions", "legal", "means", "policy", "private", "protection", "provisions", "public", "response"....
0.300
appropriateblockbuildingbusinesscentercentraldevelopmentformgrowthincreaselandmixed-usenetworkplanningprivatepromotespublicresidentialscaleserving
SHARED TOKENS (24): "appropriate", "block", "building", "business", "center", "central", "development", "form", "growth", "increase", "land", "mixed-use", "network", "planning", "private", "promotes", "public", "residential", "scale", "serving"....
0.300
activitiesactivityadministrationadministrativeagenciesanotherbuiltcontrolcreateddecisionsdivisioneconomiceducationenforcementenvironmentalgenerallygoverninggovernmentincreaseinfluence
SHARED TOKENS (35): "activities", "activity", "administration", "administrative", "agencies", "another", "built", "control", "created", "decisions", "division", "economic", "education", "enforcement", "environmental", "generally", "governing", "government", "increase", "influence"....
0.300
accessactivitiesamericanamongannualdirectlygrowthhabitatimportantlocalmillionorganizationplacesrapidsitestravelwildlife
SHARED TOKENS (17): "access", "activities", "american", "among", "annual", "directly", "growth", "habitat", "important", "local", "million", "organization", "places", "rapid", "sites", "travel", "wildlife".
0.300
approximatelyboisebuildingbuildingsbuiltdowntownevenfeetfoundgrewhistorichistoricalidaholateroperatedsinglesitewestern
SHARED TOKENS (18): "approximately", "boise", "building", "buildings", "built", "downtown", "even", "feet", "found", "grew", "historic", "historical", "idaho", "later", "operated", "single", "site", "western".
0.300
approximatelyboisecenteridahonampa
SHARED TOKENS (5): "approximately", "boise", "center", "idaho", "nampa". | EXACT TITLE in tourism_hospitality: "Ford Idaho Center".
0.300
activityassociatedhistoryidahowestern
SHARED TOKENS (5): "activity", "associated", "history", "idaho", "western". | EXACT TITLE in tourism_hospitality: "History of Idaho".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycasesconservationcreateddifferentestategovernmentgroundhighwaylandlegallocalotherwiseownerownershipphysicalprivaterealrestrictedrights
SHARED TOKENS (28): "authority", "cases", "conservation", "created", "different", "estate", "government", "ground", "highway", "land", "legal", "local", "otherwise", "owner", "ownership", "physical", "private", "real", "restricted", "rights"....
0.300
additionalboisebusinesscentralcitiescommunitydifferentgardenhighwayidahointerstatelargemajormetropolitanpopulationriverruralsmallervalley
SHARED TOKENS (19): "additional", "boise", "business", "central", "cities", "community", "different", "garden", "highway", "idaho", "interstate", "large", "major", "metropolitan", "population", "river", "rural", "smaller", "valley".
0.300
Bartender ↗ Q808266 KW CROSS HIGH
confirmingcreatefoundgenerallylegallegallylicensedmaintainprivateprofilerequiredrequirementsrestaurantsservingsuppliesthemvalue
SHARED TOKENS (17): "confirming", "create", "found", "generally", "legal", "legally", "licensed", "maintain", "private", "profile", "required", "requirements", "restaurants", "serving", "supplies", "them", "value".
0.300
agriculturalcommunityconservationcontrolledcreatedevelopmentdistrictsenvironmentalgrowthhistoriclandlandscapemanagementoverlaysplanningpreservationpreserveprivateresourcesrural
SHARED TOKENS (24): "agricultural", "community", "conservation", "controlled", "create", "development", "districts", "environmental", "growth", "historic", "land", "landscape", "management", "overlays", "planning", "preservation", "preserve", "private", "resources", "rural"....
0.300
addressingbroadercouncilcoverscreatingculturaldevelopeddevelopmentdirecteconomiceconomyeffectsenvironmentalexperienceformformsgrowthmanagementmeansorganization
SHARED TOKENS (29): "addressing", "broader", "council", "covers", "creating", "cultural", "developed", "development", "direct", "economic", "economy", "effects", "environmental", "experience", "form", "forms", "growth", "management", "means", "organization"....
0.300
activitiesauthoritycapacitycasesconductenforcementfederalgeneralgovernmentgovernmentshealthindividualinterstatelawlegalmeansphysicalpolicepowerpublic
SHARED TOKENS (27): "activities", "authority", "capacity", "cases", "conduct", "enforcement", "federal", "general", "government", "governments", "health", "individual", "interstate", "law", "legal", "means", "physical", "police", "power", "public"....
0.300
amonganotherbuildingsbuiltcasescitiescodecontrolcontrolscostcreatedevelopmenteffectsfeesfinancialfunctionshousingincentiveslocalmakes
SHARED TOKENS (37): "among", "another", "buildings", "built", "cases", "cities", "code", "control", "controls", "cost", "create", "development", "effects", "fees", "financial", "functions", "housing", "incentives", "local", "makes"....
0.300
Hotel manager ↗ KW CROSS HIGH
businessdepartmentdepartmentsfacilitiesfinancialfunctionsgeneralhotelindividuallodgingmanagementoperationoperationsownershiprevenuestaffstandards
SHARED TOKENS (17): "business", "department", "departments", "facilities", "financial", "functions", "general", "hotel", "individual", "lodging", "management", "operation", "operations", "ownership", "revenue", "staff", "standards".
0.300
affectagenciesboundarycreatingdistributionenvironmentalfunctionslandmanagementplanningplansprocessprogramsresourcesrightsspecialistsstudysupplywater
SHARED TOKENS (19): "affect", "agencies", "boundary", "creating", "distribution", "environmental", "functions", "land", "management", "planning", "plans", "process", "programs", "resources", "rights", "specialists", "study", "supply", "water".
0.300
accessadministrationassetbuildingbusinesscreateddepartmentdevelopmentemergencyfederalfundinggovernmentgovernmentshousinginfrastructurelocalmajormanagementpersonnelplan
SHARED TOKENS (28): "access", "administration", "asset", "building", "business", "created", "department", "development", "emergency", "federal", "funding", "government", "governments", "housing", "infrastructure", "local", "major", "management", "personnel", "plan"....
0.300
administrativeappliedappliesapprovalassociationcontextdecisionsdevelopmenteffectsenvironmentalgovernedidentifyingmajormanagementparticipationplanplanspolicypotentialprocess
SHARED TOKENS (30): "administrative", "applied", "applies", "approval", "association", "context", "decisions", "development", "effects", "environmental", "governed", "identifying", "major", "management", "participation", "plan", "plans", "policy", "potential", "process"....
0.300
americanbuildingcommercialcreationdevelopeddevelopmentdistrictenvironmentalflexibilityhousinglandmixed-useparksplanningplanspreservationprocessrecreationresidentialrights
SHARED TOKENS (27): "american", "building", "commercial", "creation", "developed", "development", "district", "environmental", "flexibility", "housing", "land", "mixed-use", "parks", "planning", "plans", "preservation", "process", "recreation", "residential", "rights"....
0.300
approvedbeganconservationdecemberdepartmenteducationenforcementenvironmentalestablishingfederalfinancialgovernmentgovernmentsindependentinformationlegallocalnationaloperationpermitting
SHARED TOKENS (29): "approved", "began", "conservation", "december", "department", "education", "enforcement", "environmental", "establishing", "federal", "financial", "government", "governments", "independent", "information", "legal", "local", "national", "operation", "permitting"....
0.300
affectagriculturalagriculturechangeconnectconservationconstructioncontrolcorridoremphasizesenvironmentalevenfloodhabitathealthimportantinfluenceinterfacelandland-use
SHARED TOKENS (41): "affect", "agricultural", "agriculture", "change", "connect", "conservation", "construction", "control", "corridor", "emphasizes", "environmental", "even", "flood", "habitat", "health", "important", "influence", "interface", "land", "land-use"....
0.300
associatedbusinessbusinessesprogramstrategy
SHARED TOKENS (5): "associated", "business", "businesses", "program", "strategy". | EXACT TITLE in tourism_hospitality: "Loyalty program".
0.300
Boise Art Museum ↗ KW CROSS HIGH
administrationadministrativeartsassociationbeganboisebuildingcentercontemporaryculturaldevelopmentfederalfunctionsidaholargestlocalmajormodernparkpublic
SHARED TOKENS (24): "administration", "administrative", "arts", "association", "began", "boise", "building", "center", "contemporary", "cultural", "development", "federal", "functions", "idaho", "largest", "local", "major", "modern", "park", "public"....
0.300
Tourist tax ↗ Q96410506 KW CROSS HIGH
consolidateddemanddestinationdirectlyeconomyenvironmentaleventsformgenerallygenerategovernmentshotelinfrastructuremarketportalprocessprovidepublicregulaterevenue
SHARED TOKENS (21): "consolidated", "demand", "destination", "directly", "economy", "environmental", "events", "form", "generally", "generate", "governments", "hotel", "infrastructure", "market", "portal", "process", "provide", "public", "regulate", "revenue"....
0.300
amongappliedauthoritybegancasescitiesconstrainconstructiondistrictdistrictseconomiceconomyenvironmentalestimatesexplicitlygovernmentshomeshousingincreaseland
SHARED TOKENS (46): "among", "applied", "authority", "began", "cases", "cities", "constrain", "construction", "district", "districts", "economic", "economy", "environmental", "estimates", "explicitly", "governments", "homes", "housing", "increase", "land"....
0.300
beganboisebuiltbureauconstructioncontroldirectlyfederalfeetfloodformshighwayidahoirrigationmultipleoperatingoperationalparkpowerprivate
SHARED TOKENS (23): "began", "boise", "built", "bureau", "construction", "control", "directly", "federal", "feet", "flood", "forms", "highway", "idaho", "irrigation", "multiple", "operating", "operational", "park", "power", "private"....
0.300
approximatelyboisebuildingbuiltcapacitycentralcurrentdowntownfeetidahomillionprofessionalrightsstreetwestern
SHARED TOKENS (15): "approximately", "boise", "building", "built", "capacity", "central", "current", "downtown", "feet", "idaho", "million", "professional", "rights", "street", "western".
0.300
Travel agency ↗ Q217107 KW CROSS HIGH
actagenciesbureauchangedestinationdifferenteventfunctiongeneralgrouphotelorganizationprivateproductsprovidepublicrecreationroleroomstravel
SHARED TOKENS (20): "act", "agencies", "bureau", "change", "destination", "different", "event", "function", "general", "group", "hotel", "organization", "private", "products", "provide", "public", "recreation", "role", "rooms", "travel".
0.300
communitydevelopmentdirectlydistricteconomicfinancingincreasesinfrastructureinvestmentprivateprogramprojectpropertypublicredevelopmentrelatedrevenuetaxtowardvalue
SHARED TOKENS (20): "community", "development", "directly", "district", "economic", "financing", "increases", "infrastructure", "investment", "private", "program", "project", "property", "public", "redevelopment", "related", "revenue", "tax", "toward", "value".
0.300
adoptedcasesconferencescreatedecisionsdestinationeventexpendituresfeesfunctionsgenerallygovernmenthotelincentivesincreaseinformationinfrastructurelocalmajormanagement
SHARED TOKENS (30): "adopted", "cases", "conferences", "create", "decisions", "destination", "event", "expenditures", "fees", "functions", "generally", "government", "hotel", "incentives", "increase", "information", "infrastructure", "local", "major", "management"....
0.300
applicationapproximatelybusinessescitiesconstructioncostsdecentralizeddemanddesigndevelopeddifferentevenintendedlandlargemanagementmunicipalnetworkoperatingpopulation
SHARED TOKENS (34): "application", "approximately", "businesses", "cities", "construction", "costs", "decentralized", "demand", "design", "developed", "different", "even", "intended", "land", "large", "management", "municipal", "network", "operating", "population"....
0.300
accesscannotcommissioncontrolcostsdifferentfederalformsgovernmentinfrastructurelargelocalmaintainsmarketmodernmultipleoperatesorganizationpipelinesproduce
SHARED TOKENS (32): "access", "cannot", "commission", "control", "costs", "different", "federal", "forms", "government", "infrastructure", "large", "local", "maintains", "market", "modern", "multiple", "operates", "organization", "pipelines", "produce"....
0.300
airportanalysiscapacitycostcostscurrentdatademandemploymentenvironmentalestimatesfinancialforecastsinfrastructuremodelplanningpolicypopulationroadtraffic
SHARED TOKENS (22): "airport", "analysis", "capacity", "cost", "costs", "current", "data", "demand", "employment", "environmental", "estimates", "financial", "forecasts", "infrastructure", "model", "planning", "policy", "population", "road", "traffic"....
0.300
actactiveactivitiesagenciesapproximatelyauthoritybuildingbusinesscapacitycomponentsconductconstructioncontrolcreationdepartmentdesigndirectdirectlyeconomyenvironmental
SHARED TOKENS (56): "act", "active", "activities", "agencies", "approximately", "authority", "building", "business", "capacity", "components", "conduct", "construction", "control", "creation", "department", "design", "direct", "directly", "economy", "environmental"....
0.300
agriculturalagriculturebuildingcostdesigndevelopeddevelopmentgeneralgovernmentlandlandslandscapelimitsoperatorprivatepropertiespublicratherrelatedrestricted
SHARED TOKENS (24): "agricultural", "agriculture", "building", "cost", "design", "developed", "development", "general", "government", "land", "lands", "landscape", "limits", "operator", "private", "properties", "public", "rather", "related", "restricted"....
0.300
acquiredacquisitionadministrationagreementassetsbuildingbusinesscapitalcommercialconductcontrolestatefinancialinformationinspectionlandmaintainmanagementoperationowner
SHARED TOKENS (32): "acquired", "acquisition", "administration", "agreement", "assets", "building", "business", "capital", "commercial", "conduct", "control", "estate", "financial", "information", "inspection", "land", "maintain", "management", "operation", "owner"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationbuildingsconnectdevelopmentevenfinalfunctionsgovernmentjurisdictionslandlaterlegalownerownersownershippowerprivateproperties
SHARED TOKENS (27): "acquisition", "another", "application", "buildings", "connect", "development", "even", "final", "functions", "government", "jurisdictions", "land", "later", "legal", "owner", "owners", "ownership", "power", "private", "properties"....
0.300
beyondbrandbusinesseseconomiceconomyeventeventsexposurefinancialgenerategovernmentsgrowthinfrastructuremajorsectorstravel
SHARED TOKENS (16): "beyond", "brand", "businesses", "economic", "economy", "event", "events", "exposure", "financial", "generate", "governments", "growth", "infrastructure", "major", "sectors", "travel".
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actanotherapplicationauthorityboundariesbuildingchangecommercialcommissioncommunitycontrolcouncilcreatingcurrentdistrictdistrictsgeneralgovernmenthistoricland
SHARED TOKENS (44): "act", "another", "application", "authority", "boundaries", "building", "change", "commercial", "commission", "community", "control", "council", "creating", "current", "district", "districts", "general", "government", "historic", "land"....
0.300
anotherbecomebecomescontextcostsdevelopeddevelopmentdiscoveryfinancialformsgatewayidentifyimplementationinformationlargemajormediamultiplenewsoperators
SHARED TOKENS (31): "another", "become", "becomes", "context", "costs", "developed", "development", "discovery", "financial", "forms", "gateway", "identify", "implementation", "information", "large", "major", "media", "multiple", "news", "operators"....
0.300
actagricultureamericanapproximatelybeganboisebureaucapacitycenterconstructiondecemberdesignfeetidahoirrigationlawmaterialsmonthsnationaloperated
SHARED TOKENS (29): "act", "agriculture", "american", "approximately", "began", "boise", "bureau", "capacity", "center", "construction", "december", "design", "feet", "idaho", "irrigation", "law", "materials", "months", "national", "operated"....
0.300
administrativeagreementagricultureapplicablearrangementchaincomplianceconservationconstraincreatesdevelopmentdocumentestablishedestatefederalfinancialgenerallygovernmentgrantsgrowth
SHARED TOKENS (55): "administrative", "agreement", "agriculture", "applicable", "arrangement", "chain", "compliance", "conservation", "constrain", "creates", "development", "document", "established", "estate", "federal", "financial", "generally", "government", "grants", "growth"....
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
associatedbuildingcommunitycontemporarycoverscreatingdesigndevelopmentestatefacilitieshistorichousingincreaseinfrastructurelandland-usemunicipalneighborhoodplanningpopulation
SHARED TOKENS (33): "associated", "building", "community", "contemporary", "covers", "creating", "design", "development", "estate", "facilities", "historic", "housing", "increase", "infrastructure", "land", "land-use", "municipal", "neighborhood", "planning", "population"....
0.300
accesscommunitydesigneconomicenvironmentalhealthhighwayoperatedplannerspolicypublicrelatedrequiressafetystreetstraffictransportationtravelurban
SHARED TOKENS (19): "access", "community", "design", "economic", "environmental", "health", "highway", "operated", "planners", "policy", "public", "related", "requires", "safety", "streets", "traffic", "transportation", "travel", "urban".
0.300
activityagenciesbusinessconductdepartmentsgovernmentlicenselicenseslocalmultipleoperatingpermitsphysicalrequiredrequiressingle
SHARED TOKENS (16): "activity", "agencies", "business", "conduct", "departments", "government", "license", "licenses", "local", "multiple", "operating", "permits", "physical", "required", "requires", "single".
0.300
acquireactapprovalapprovalsapprovedbuildingcommercialconstructioncontextcostscreatescreationdesigndeterminedevelopmentdifferenteconomicenvironmentalestatefinancial
SHARED TOKENS (46): "acquire", "act", "approval", "approvals", "approved", "building", "commercial", "construction", "context", "costs", "creates", "creation", "design", "determine", "development", "different", "economic", "environmental", "estate", "financial"....
0.300
authoritybuildingbuildingsbusinesscapitalcombinecommercialestatefunctionsgeneratehousingintendedinvestmentlandlocalmaintainmultipleofficepropertyreal
SHARED TOKENS (29): "authority", "building", "buildings", "business", "capital", "combine", "commercial", "estate", "functions", "generate", "housing", "intended", "investment", "land", "local", "maintain", "multiple", "office", "property", "real"....
🫐 BERRY64 edges
0.280
additionalattachedcasesdwellinggardenmemberprincipalpropertyprovidereceiveresidentialseparatesupportunit
SHARED TOKENS (14): "additional", "attached", "cases", "dwelling", "garden", "member", "principal", "property", "provide", "receive", "residential", "separate", "support", "unit".
0.280
americanamongboisechaindivisionhistoryidaholocaloutsideparkrightsschooluniversitywestern
SHARED TOKENS (14): "american", "among", "boise", "chain", "division", "history", "idaho", "local", "outside", "park", "rights", "school", "university", "western".
0.280
americanoperatedrentaltravel
SHARED TOKENS (4): "american", "operated", "rental", "travel". | EXACT TITLE in tourism_hospitality: "Kayak (company)".
0.280
informationprocesspropertiestypes
SHARED TOKENS (4): "information", "process", "properties", "types". | EXACT TITLE in land_use_planning: "Soil survey".
0.280
authorityboundariescreateddistrictdistrictsgovernmentirrigationlandslargelocalpowerpublictaxwater
SHARED TOKENS (14): "authority", "boundaries", "created", "district", "districts", "government", "irrigation", "lands", "large", "local", "power", "public", "tax", "water".
0.280
amongboundariescitiescontroldistinctgovernmentgovernmentslawlocalmunicipalprocessresponseurbanwork
SHARED TOKENS (14): "among", "boundaries", "cities", "control", "distinct", "government", "governments", "law", "local", "municipal", "process", "response", "urban", "work".
0.280
dwellinghousinglodgingrental
SHARED TOKENS (4): "dwelling", "housing", "lodging", "rental". | EXACT TITLE in tourism_hospitality: "Short-term rental".
0.280
departmenthealthidahopublic
SHARED TOKENS (4): "department", "health", "idaho", "public". | EXACT TITLE in tourism_hospitality: "Idaho Department of Health and Welfare".
0.280
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
agricultureamericanboisebureaufeethistoricidahoirrigationnationaloperatedprovideriverwaterwestern
SHARED TOKENS (14): "agriculture", "american", "boise", "bureau", "feet", "historic", "idaho", "irrigation", "national", "operated", "provide", "river", "water", "western".
0.280
Vrbo ↗ Q17091141 EXACT TITLE
americangroupownerrental
SHARED TOKENS (4): "american", "group", "owner", "rental". | EXACT TITLE in tourism_hospitality: "Vrbo".
0.280
approximatelyboisecapacitycommunitycurrenteventsfeetidahoshowsspacesquaretradeuniversitywestern
SHARED TOKENS (14): "approximately", "boise", "capacity", "community", "current", "events", "feet", "idaho", "shows", "space", "square", "trade", "university", "western".
0.280
Tour guide ↗ Q1039099 KW CROSS HIGH
appropriateauthoritycontemporaryculturalestablishedhistoricalindividualinformationmajorpossessprofessionalprovidesitesstandards
SHARED TOKENS (14): "appropriate", "authority", "contemporary", "cultural", "established", "historical", "individual", "information", "major", "possess", "professional", "provide", "sites", "standards".
0.280
Restaurant ↗ Q11707 EXACT TITLE
businessgenerallyrestaurantssingle
SHARED TOKENS (4): "business", "generally", "restaurants", "single". | EXACT TITLE in land_use_planning: "Restaurant". | EXACT TITLE in tourism_hospitality: "Restaurant".
0.260
Vineyard ↗ Q22715 EXACT TITLE
itselfproductionstudy
SHARED TOKENS (3): "itself", "production", "study". | EXACT TITLE in tourism_hospitality: "Vineyard".
0.260
Parcel ↗ EXACT TITLE
individuallandmodern
SHARED TOKENS (3): "individual", "land", "modern". | EXACT TITLE in land_use_planning: "Parcel".
0.260
centerinformationphysical
SHARED TOKENS (3): "center", "information", "physical". | EXACT TITLE in tourism_hospitality: "Visitor center".
0.260
formalgovernmentlaw
SHARED TOKENS (3): "formal", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.260
americanofficialpossess
SHARED TOKENS (3): "american", "official", "possess". | EXACT TITLE in tourism_hospitality: "American Viticultural Area".
0.260
largestmajorsupply
SHARED TOKENS (3): "largest", "major", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.260
Hostel ↗ Q654772 KW CROSS HIGH
annualformformsgrowthimposelimitslocallylodgingmarketoperatedprivateroomstravel
SHARED TOKENS (13): "annual", "form", "forms", "growth", "impose", "limits", "locally", "lodging", "market", "operated", "private", "rooms", "travel".
0.260
administersdepartmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthousingmemberprogramreportsurban
SHARED TOKENS (13): "administers", "department", "departments", "development", "directly", "federal", "financing", "government", "housing", "member", "program", "reports", "urban".
0.240
approximatelyboisedatadistrictdistrictsevenfoundgovernmentidaholimitspopulationsingle
SHARED TOKENS (12): "approximately", "boise", "data", "district", "districts", "even", "found", "government", "idaho", "limits", "population", "single".
0.240
Booking.com ↗ Q4035313 KW CROSS HIGH
activitiesagenciesapproximatelycitiescomhomeslargestlodgingmarketsmillionpropertiestravel
SHARED TOKENS (12): "activities", "agencies", "approximately", "cities", "com", "homes", "largest", "lodging", "markets", "million", "properties", "travel".
0.240
boisebuiltbureaucanyonidahoirrigationoperatedrivertreasurevalleywaterwestern
SHARED TOKENS (12): "boise", "built", "bureau", "canyon", "idaho", "irrigation", "operated", "river", "treasure", "valley", "water", "western".
0.240
Brewery ↗ Q131734 KW CROSS HIGH
builtbusinesscommercialdistinctmakesprocessproduceproducedproductionprotectionscaleworkers
SHARED TOKENS (12): "built", "business", "commercial", "distinct", "makes", "process", "produce", "produced", "production", "protection", "scale", "workers".
0.240
Viticulture ↗ Q253140 KW CROSS HIGH
approveddevelopmentevidencefoundhistoryirrigationmanagementmodernmonthsprovidesitewestern
SHARED TOKENS (12): "approved", "development", "evidence", "found", "history", "irrigation", "management", "modern", "months", "provide", "site", "western".
0.240
Right to property ↗ KW CROSS HIGH
articleculturaleconomicgeneralindividuallegalownershippoliticalprivatepropertyprotectionrights
SHARED TOKENS (12): "article", "cultural", "economic", "general", "individual", "legal", "ownership", "political", "private", "property", "protection", "rights".
0.240
applicablebuiltcontractsevenhotellong-termmonthsresidentialsystemthemthereforeuses
SHARED TOKENS (12): "applicable", "built", "contracts", "even", "hotel", "long-term", "months", "residential", "system", "them", "therefore", "uses".
0.240
airportboisebuildingbuiltbusinesscenterconservationfacilitiesidaholargeorganizationresearch
SHARED TOKENS (12): "airport", "boise", "building", "built", "business", "center", "conservation", "facilities", "idaho", "large", "organization", "research".
0.220
americandivisionhospitalityhotellicenseslodgingnetworkoperatespropertiesresidentialrooms
SHARED TOKENS (11): "american", "division", "hospitality", "hotel", "licenses", "lodging", "network", "operates", "properties", "residential", "rooms".
0.220
Campsite ↗ Q832778 KW CROSS HIGH
americanfacilitiesgenerallygroupindividualmeansparkrelatedroadtypesunit
SHARED TOKENS (11): "american", "facilities", "generally", "group", "individual", "means", "park", "related", "road", "types", "unit".
0.220
additionalbrandbuildingchaineconomyhealthhoteljunepipelinepropertiesrooms
SHARED TOKENS (11): "additional", "brand", "building", "chain", "economy", "health", "hotel", "june", "pipeline", "properties", "rooms".
0.220
associationbrandchainconsumeritselfmanagementmarketmarketsprocessrelationshipssupply
SHARED TOKENS (11): "association", "brand", "chain", "consumer", "itself", "management", "market", "markets", "process", "relationships", "supply".
0.220
activitiesawaybusinessconferencesgovernmentmeetingsorganizationorganizationsoutsideplacestravel
SHARED TOKENS (11): "activities", "away", "business", "conferences", "government", "meetings", "organization", "organizations", "outside", "places", "travel".
0.220
idahointerstate
SHARED TOKENS (2): "idaho", "interstate". | EXACT TITLE in land_use_planning: "Interstate 84". | EXACT TITLE in tourism_hospitality: "Interstate 84".
0.210
Viator ↗ Q1444040 EXACT TITLE
community
SHARED TOKENS (1): "community". | EXACT TITLE in tourism_hospitality: "Viator".
0.200
agriculturalamericanlegalmerelyownershipremainingrightssourcesystemwater
SHARED TOKENS (10): "agricultural", "american", "legal", "merely", "ownership", "remaining", "rights", "source", "system", "water".
0.200
associatedbecomeconservationeducationenvironmentallocalnationalparksremainingwildlife
SHARED TOKENS (10): "associated", "become", "conservation", "education", "environmental", "local", "national", "parks", "remaining", "wildlife".
0.180
businessbusinessesgeneralincreaselargemediareportingroletravel
SHARED TOKENS (9): "business", "businesses", "general", "increase", "large", "media", "reporting", "role", "travel".
0.180
Expedia Group ↗ Q8085893 KW CROSS HIGH
americancomfacilitiesgrouplodgingmillionoperatestechnologytravel
SHARED TOKENS (9): "american", "com", "facilities", "group", "lodging", "million", "operates", "technology", "travel".
0.180
decisionsevaluationexperienceformproductsprofessionalreviewreviewssites
SHARED TOKENS (9): "decisions", "evaluation", "experience", "form", "products", "professional", "review", "reviews", "sites".
0.180
activitybuiltdevelopedenvironmentalhealthinterfacelandpublicurban
SHARED TOKENS (9): "activity", "built", "developed", "environmental", "health", "interface", "land", "public", "urban".
0.160
boisebuildingbuiltfeethistoricidahonationalplaces
SHARED TOKENS (8): "boise", "building", "built", "feet", "historic", "idaho", "national", "places".
0.160
eventhotellicensingmanagementoccupancyretailrevenuestrategy
SHARED TOKENS (8): "event", "hotel", "licensing", "management", "occupancy", "retail", "revenue", "strategy".
0.160
adoptedamericanbeganlargestnetworkoperatesoperatorowner
SHARED TOKENS (8): "adopted", "american", "began", "largest", "network", "operates", "operator", "owner".
0.160
Craft beer ↗ Q5487333 KW CROSS HIGH
begandistributiongenerallygrewproduceproductionsalesmaller
SHARED TOKENS (8): "began", "distribution", "generally", "grew", "produce", "production", "sale", "smaller".
0.160
Package tour ↗ Q926780 KW CROSS HIGH
activitiesformindependentoperatoroperatorsrentaltogethertravel
SHARED TOKENS (8): "activities", "form", "independent", "operator", "operators", "rental", "together", "travel".
0.140
currentestatemarketproducepropertyrealvalue
SHARED TOKENS (7): "current", "estate", "market", "produce", "property", "real", "value".
0.140
AC Hotels ↗ Q5653536 KW CROSS HIGH
businesschainhoteljunepipelineroomsserving
SHARED TOKENS (7): "business", "chain", "hotel", "june", "pipeline", "rooms", "serving".
0.140
describeeconomichistoricaloutsidepoliticalpopulationsubstantial
SHARED TOKENS (7): "describe", "economic", "historical", "outside", "political", "population", "substantial".
0.140
constructionknowledgematerialsoverlappingrelatedstudyuses
SHARED TOKENS (7): "construction", "knowledge", "materials", "overlapping", "related", "study", "uses".
0.140
americanbranddecemberhospitalitypropertiesroomswork
SHARED TOKENS (7): "american", "brand", "december", "hospitality", "properties", "rooms", "work".
0.140
americandepartmentfederalgovernmentmanagementprotectwildlife
SHARED TOKENS (7): "american", "department", "federal", "government", "management", "protect", "wildlife".
0.120
activeassociatedbegandevelopmentidahoriver
SHARED TOKENS (6): "active", "associated", "began", "development", "idaho", "river".
0.120
changecomplexityratherrelationshipssystemsystems
SHARED TOKENS (6): "change", "complexity", "rather", "relationships", "system", "systems".
0.120
describegenerallyhotellodgingprivaterooms
SHARED TOKENS (6): "describe", "generally", "hotel", "lodging", "private", "rooms".
0.120
activitiesamongassociationexperiencestudytravel
SHARED TOKENS (6): "activities", "among", "association", "experience", "study", "travel".
0.120
cannotconservationhabitatmanagementprotecttypes
SHARED TOKENS (6): "cannot", "conservation", "habitat", "management", "protect", "types".
0.120
constructionitselfmaterialsmeaningpropertyreal
SHARED TOKENS (6): "construction", "itself", "materials", "meaning", "property", "real".
0.120
businessdevelopmentestateofficeparkrather
SHARED TOKENS (6): "business", "development", "estate", "office", "park", "rather".
0.100
Scenic route ↗ Q1406331 KW CROSS HIGH
culturaldepartmentroadscenictransportation
SHARED TOKENS (5): "cultural", "department", "road", "scenic", "transportation".
0.100
boisecenterculturalhistoryidaho
SHARED TOKENS (5): "boise", "center", "cultural", "history", "idaho".
0.100
Birdwatching ↗ Q685629 KW CROSS HIGH
activityformformalpublicstudy
SHARED TOKENS (5): "activity", "form", "formal", "public", "study".
0.100
awayhighwayidahonationalpark
SHARED TOKENS (5): "away", "highway", "idaho", "national", "park".
◈ Frequently Asked Questions
Land Use Planning × Tourism Hospitality — Treasure Valley
HAIKU · HIGH GATE
How do zoning regulations in Boise affect where hotels and resorts can be developed in the Treasure Valley?
Boise's zoning code designates specific commercial and mixed-use districts where lodging facilities can operate, particularly in downtown Boise and near Boise Airport. Land-use planning decisions by the City of Boise directly determine whether hospitality projects in Nampa, Meridian, and the broader Boise metropolitan area can move forward or face restrictions.
Why do irrigation infrastructure and water rights matter for tourism hospitality development in Idaho's Treasure Valley?
Hospitality facilities in the Treasure Valley require reliable water supplies from the Boise River watershed and existing water rights agreements to support guest amenities, landscaping, and operations. Land-use planning that coordinates with Idaho's water right allocation system ensures that new hotels and resort expansions do not conflict with agricultural water needs or wastewater management capacity.
What role does proximity to Boise National Forest play in Treasure Valley tourism hospitality site selection?
Hotels and lodges throughout the Boise metropolitan area position themselves within accessible distance of Boise National Forest recreation, making forest access a key factor in land-use planning for tourism development. Zoning and development approvals in Boise, Nampa, and surrounding areas consider proximity to canyon attractions and national forest boundaries when evaluating hospitality projects.
How does Boise State University influence tourism and hospitality land-use planning in the Treasure Valley?
Boise State University's location in downtown Boise creates demand for conference facilities, student housing partnerships, and hospitality services that shape land-use zoning decisions around the campus corridor. The university's enrollment drives visitor traffic that planners account for when approving hotel construction and mixed-use hospitality developments in the capital city.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Land Use Planning × Tourism Hospitality 29 QID bridges 262 edges 6,617 ext links 2026-07-17 21:44:15 UTC 3c4bf02924886610
Land Use Planning corridor ↗ Tourism Hospitality corridor ↗ Tourism Hospitality × Land Use Planning ↗ boisestandard.org/standard ↗
Parent Corridors
Land Use Planning × All Other Verticals