—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Land Use Planning ↔ relates to ↔ Mortgage Lending

32 Wikipedia bridge articles confirmed in both vertical ledgers. 248 deterministic cross-vertical edges. 5,877 external source links harvested. Every edge provenance-stamped. Every claim auditable.

32 QID Bridge Articles
248 Cross Edges
5,877 External Sources
284 Wikipedia Articles
31 🌲 Evergreen
177 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Land Use Planning
× Mortgage Lending
QID Bridge Articles
32
confirmed Wikipedia overlap
Total Cross Edges
248
External Sources Harvested
5,877
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Boise State University
score: 1.1500  ·  type: exact_title_cross  ·  17 shared tokens
QID Bridge Titles (20)
Boise State UniversityIdahoGroundwaterZoningLand-use planningEasementAffordable housingAgricultural landCollege of Western IdahoTreasure ValleyWater rightParcelBoise RiverUrban sprawlBoise metropolitan areaPlanning permissionIrrigation districts in the United StatesMergers and acquisitionsUnited States Department of Housing and Urban DevelopmentBoise, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationlanddevelopmentmetropolitanpublicurbanhomeadaagriculturalcapitalgovernmentlocalpropertyeastwesternvalleyplanningcanyon
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:42:26 UTC
Content Hash
c69b8b23ac266d17
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
32 BRIDGES
Boise State University
Q891082 EXACT TITLE 1.150
QID OVERLAP: Q891082 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (17): "activity", "among", "boise", "business", "college", "division", "economics", "education", "idaho", "independent", "member", "program", "programs", "public", "research", "school", "university". | URL->B (1): https://boisestate.edu/. | EXACT TITLE in land_use_planning: "Boise State University". | EXACT TITLE in mortgage_lending: "Boise State University".
activityamongboisebusinesscollegedivisioneconomicseducationidahoindependentmemberprogramprogramspublicresearchschooluniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Idaho
EXACT TITLE 1.000
QID OVERLAP: Q1221 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (23): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "east", "geographic", "idaho", "land", "national", "official", "population", "products", "separate", "south", "supplies", "technology".... | EXACT TITLE in land_use_planning: "Idaho". | EXACT TITLE in mortgage_lending: "Idaho".
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistincteastgeographicidaholandnationalofficialpopulationproductsseparatesouthsuppliestechnologyterritoryuseswestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Groundwater
Q161598 EXACT TITLE 1.000
QID OVERLAP: Q161598 in land_use_planning (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (36): "agricultural", "agriculture", "become", "capacity", "central", "change", "contains", "distribution", "environmental", "field", "form", "formation", "household", "industrial", "influence", "land", "municipal", "operating", "percent", "present".... | EXACT TITLE in land_use_planning: "Groundwater".
agriculturalagriculturebecomecapacitycentralchangecontainsdistributionenvironmentalfieldformformationhouseholdindustrialinfluencelandmunicipaloperatingpercentpresentproblemsprocessprovidepublicsepticsourcesourcesstudysuppliessystems+6
d the water table. Groundwater is recharged from the surface; it may discharge from the surface naturally at springs and seeps, and can form oases or wetlands. Groundwater is also often withdrawn for agricultural, municipal, and industrial use by constructing and operating extraction wells. The study of the distribution and movement of groundwater is hydrogeology, also called groundwater hydrology. Typically, groundwater is thought of as water flowing through shallow aquifers, but, in the technical sense, it can also contain soil moisture, permafrost (frozen soil), immobile water in very low permeability bedrock, and deep geothermal or oil formation water. Groundwater is hypothesized to provide lubrication that can possibly influence the movement of faults. It is likely that much of Earth's subsurface contains some water, which may be mixed with other fluids in some instances. Groundwater is often cheaper, more convenient and less vulnerable to pollution than surface water. Therefore, it is commonly used for public drinking water supplies. For example, groundwater provides the largest source of usable water storage in the United States, and California annually withdraws the largest amount of groundwater of all the states. Underground reservoirs contain far more water than the capacity of all surface reservoirs and lakes in the US, including the Great Lakes. Many municipal water supplies are derived solely from groundwater. Over 2 billion people rely on it as their primary water source worldwide. Human use of groundwater causes environmental problems. For example, polluted groundwater is less visible and more difficult to clean up than pollution in rivers and lakes. Groundwater pollution most often results from improper disposal of wastes on land. Major sources include industrial and household chemicals and garbage landfills, excessive fertilizers and pesticides used in agriculture, industrial waste lagoons, tailings and process wastewater from mines, industrial fracking, oil field brine pits, leaking underground oil storage tanks and pipelines, sewage sludge and septic systems. Additionally, groundwater is susceptible to saltwater intrusion in coastal areas and can cause land subsidence when extracted unsustainably, leading to sinking cities (like Bangkok) and loss in elevation (such as the multiple meters lost in the Central Valley of California). These issues are made more complicated by sea level rise and other effects of climate change, particularly those on the water cycle.
Quantities Groundwater is the most accessed source of freshwater around the world, including as drinking water, irrigation, and manufacturing. Groundwater accounts for about half of the world's drinking water, 40% of its irrigation water, and a third of water for industrial purposes. Another estimate stated that globally groundwater accounts for about one third of all water withdrawals, and surface water for the other two thirds. Groundwater provides drinking water to at least 50% of the global population. About 2.5 billion people depend solely on groundwater resources to satisfy their basic daily water needs. A similar estimate was published in 2021 which stated that "groundwater is estimated to supply between a quarter and a third of the world's annual freshwater withdrawals to meet agricultural, industrial and domestic demands." Global freshwater withdrawal was probably around 600 km3 per year in 1900 and increased to 3,880 km3 per year in 2017. The rate of increase was especially high (around 3% per year) during the period 1950–1980, partly due to a higher population growth rate, and partly to rapidly increasing groundwater development, particularly for irrigation. The rate of increase is (as per 2022) approximately 1% per year, in tune with the current population growth rate. Global groundwater depletion has been calculated to be between 100 and 300 km3 per year. This depletion is mainly caused by "expansion of irrigated agriculture in drylands". The Asia-Pacific region is the largest groundwater abstractor in the world, containing seven out of the ten countries that extract most groundwater (Bangladesh, China, India, Indonesia, Iran, Pakistan and Turkey).
Municipal and industrial water supplies are provided through large wells. Multiple wells for one water supply source are termed "wellfields", which may withdraw water from confined or unconfined aquifers. Using groundwater from deep, confined aquifers provides more protection from surface water contamination. Some wells, termed "collector wells", are specifically designed to induce infiltration of surface (usually river) water. Aquifers that provide sustainable fresh groundwater to urban areas and for agricultural irrigation are typically close to the ground surface (within a couple of hundred metres) and have some recharge by fresh water. This recharge is typically from rivers or meteoric water (precipitation) that percolates into the aquifer through overlying unsaturated materials. In cases where the groundwater has unacceptable levels of salinity or specific ions, desalination is a common treatment,.
Zoning
Q702232 EXACT TITLE 1.000
QID OVERLAP: Q702232 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (37): "activities", "building", "combine", "density", "determine", "developed", "development", "different", "differs", "dimensions", "form", "government", "growth", "industrial", "land", "land-use", "local", "particular", "permission", "places".... | EXACT TITLE in land_use_planning: "Zoning". | EXACT TITLE in mortgage_lending: "Zoning".
activitiesbuildingcombinedensitydeterminedevelopeddevelopmentdifferentdiffersdimensionsformgovernmentgrowthindustriallandland-uselocalparticularpermissionplacesplanningpolicyprocedurepropertyquestionregulationsregulatoryresidentialrulesscale+7
s", each of which has a set of regulations for new development that differs from other zones. Zones may be defined for a single use (e.g. residential, industrial), they may combine several compatible activities by use, or in the case of form-based zoning, the differing regulations may govern the density, size and shape of allowed buildings whatever their use. The planning rules for each zone determine whether planning permission for a given development may be granted. Zoning may specify a variety of outright and conditional uses of land. It may indicate the size and dimensions of lots that land may be subdivided into, or the form and scale of buildings. These guidelines are set in order to guide urban growth and development. Zoning is the most common regulatory urban planning method used by local governments in developed countries. Exceptions include the United Kingdom and the city of Houston, Texas.
History The origins of zoning districts can be traced back to antiquity. The ancient walled city was the predecessor for classifying and regulating land, based on use. Outside the city walls were the undesirable functions, which were usually based on noise and smell. The space between the walls is where unsanitary and dangerous activities occurred such as butchering, waste disposal, and brick-firing. Within the walls were civic and religious places, and where the majority of people lived. Beyond distinguishing between urban and non-urban land, most ancient cities further classified land types and uses inside their walls. This was practiced in many regions of the world – for example, in China during the Zhou Dynasty (1046 – 256 BC), in India during the Vedic Era (1500 – 500 BC), and in the military camps that spread throughout the Roman Empire (31 BC – 476 AD). Throughout the Age of Enlightenment and Industrial Revolution, cultural and socio-economic shifts led to the rapid increase in the enforcement and invention of urban regulations. The shifts were informed by a new scientific rationality, the advent of mass production and complex manufacturing, and the subsequent onset of urbanisation. Industry leaving the home reshaped modern cities. The definition of home was tied to the definition of economy, which caused a much greater mixing of uses within the residential quarters of cities. Separation between uses is a feature of many planned cities designed before the advent of zoning. A notable example is Adelaide in South Australia, whose city centre, along with the suburb of North Adelaide, is surrounded on all sides by a park, the Adelaide Park Lands. The park was designed by Colonel William Light in 1836 in order to physically separate the city centre from its suburbs. Low density residential areas surround the park, providing a pleasant walk between work in the city within and the family homes outside. Sir Ebenezer Howard, founder of the garden city movement, cited Adelaide as an example of how green open space could be used to prevent cities from expanding beyond their boundaries and coalescing. His design for an ideal city, published in his 1902 book Garden Cities of To-morrow, envisaged separate concentric rings of public buildings, parks, retail space, residential areas and industrial areas, all surrounded by open space and farmland. All retail activity was to be conducted within a single glass-roofed building, an early concept for the modern shopping centre inspired by the Crystal Palace. However, these planned or ideal cities were static designs embodied in a single masterplan. What was lacking was a regulatory mechanism to allow the city to develop over time, setting guidelines to developers and private citizens over what could be built where.
Mixed-use zoning combines residential, commercial, office, and public uses into a single space. Mixed-use zoning can be vertical, within a single building, or horizontal, involving multiple buildings. Planning and community activist Jane Jacobs wrote extensively on the connections between the separation of uses and the failure of urban renewal projects in New York City. She advocated dense mixed-use developments and walkable streets. In contrast to villages and towns, in which many residents know one another, and low-density outer suburbs that attract few visitors, cities and inner city areas have the problem of maintaining order between strangers. This order is maintained when, throughout the day and evening, there are sufficient people present with eyes on the street. This can be accomplished in successful urban districts that have a great diversity of uses, creating interest and attracting visitors. Jacobs' writings, along with increasing concerns about urban sprawl, are often credited with inspiring the New Urbanism movement. To accommodate the New Urbanist vision of walkable communities combining cafés, restaurants, offices and residential development in a single area, mixed-use zones have been created within some zoning systems. These still use the basic regulatory mechanisms of zoning, excluding incompatible uses such as heavy industry or sewage farms, while allowing compatible uses such as residential, commercial and retail activities so that people can live, work and socialise within a compact geographic area. The mixing of land uses is common throughout the world.
Land-use planning
Q60738778 EXACT TITLE 1.000
QID OVERLAP: Q60738778 in land_use_planning (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (47): "act", "alternatives", "american", "applicable", "applied", "association", "authority", "behavior", "central", "change", "changes", "communities", "community", "comparable", "conditions", "costs", "creating", "definition", "depend", "depends".... | EXACT TITLE in land_use_planning: "Land-use planning".
actalternativesamericanapplicableappliedassociationauthoritybehaviorcentralchangechangescommunitiescommunitycomparableconditionscostscreatingdefinitiondependdependsdevelopmentdistrictsenvironmentalexposurefacilitiesfunctionfuturelandland-usemodern+17
The American Planning Association states that the goal of land use planning is to further the welfare of people and their communities by creating convenient, equitable, healthful, efficient, and attractive environments for present and future generations.
able legislation applicable in Scotland and Northern Ireland. History Land use planning nearly always requires land use regulation, which typically encompasses zoning. Zoning regulates the types of activities that can be accommodated on a given piece of land, as well as the amount of space devoted to those activities, and the ways that buildings may be situated and shaped. The ambiguous nature of the term "planning", as it relates to land use, is historically tied to the practice of zoning. Zoning in the United States came about in the late 19th and early 20th centuries to protect the interests of property owners. The practice was found to be constitutionally sound by the Supreme Court decision of Village of Euclid v. Ambler Realty Co. in 1926. Soon after, the model law known as the Standard State Zoning Enabling Act was enacted by many state legislatures, which gave authority to the states and its subdivisions to regulate land use. Even so, the practice remains controversial today, particularly in its impact on economic and racial segregation, as some critics argue that zoning has often been used to exclude certain populations from particular neighborhoods. The "taking clause" of the Fifth Amendment to the United States Constitution prohibits the government from taking private property for public use without just compensation. The case of Dolan v. City of Tigard demonstrated the criteria that determine the threshold of what is considered taking. One interpretation of the taking clause is that any restriction on the development potential of land through zoning regulation is a "taking". A deep-rooted anti-zoning sentiment exists in America, that no one has the right to tell another what he can or cannot do with his land. Ironically, although people are often averse to being told how to develop their own land, they tend to expect the government to intervene when a proposed land use is undesirable. Conventional zoning has not typically regarded the manner in which buildings relate to one another or the public spaces around them, but rather has provided a pragmatic system for mapping jurisdictions according to permitted land use. This system, combined with the interstate highway system, widespread availability of mortgage loans, growth in the automobile industry, and the over-all post-World War II economic expansion, destroyed most of the character that gave distinctiveness to American cities. The urban sprawl that most US cities began to experience in the mid-twentieth century was, in part, created by a flat approach to land use regulations. Zoning without planning created unnecessarily exclusive zones. Thoughtless mapping of these zones over large areas was a big part of the recipe for suburban sprawl.
As America grew and urban sprawl was rampant, the much-loved America of the older towns, cities, or streetcar suburbs essentially became illegal through zoning. Unparalleled growth and unregulated development changed the look and feel of landscapes and communities. They strained commercial corridors and affected housing prices, causing citizens to fear a decline in the social, economic and environmental attributes that defined their quality of life. Zoning regulations became politically contentious as developers, legislators, and citizens struggled over altering zoning maps in a way that was acceptable to all parties. Land use planning practices evolved as an attempt to overcome these challenges.
Easement
Q448405 EXACT TITLE 1.000
QID OVERLAP: Q448405 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (15): "access", "allow", "among", "another", "easements", "itself", "land", "law", "person", "property", "public", "real", "rights", "road", "stated". | EXACT TITLE in land_use_planning: "Easement". | EXACT TITLE in mortgage_lending: "Easement".
accessallowamonganothereasementsitselflandlawpersonpropertypublicrealrightsroadstated
ated purpose. For example, an easement may allow someone to use a road on their neighbor's land to get to their own.' Another example is someone's right to fish in a privately owned pond, or to have access to a public beach. The rights of an easement holder vary substantially among jurisdictions. Types Historically, common law courts would enforce only four types of easements: Easements of way (also known as Right-of-way) Easements of support (pertaining to excavations) Easements of "light and air" Rights pertaining to artificial waterways Courts now recognize more varieties of easements, but these original four categories still form the foundation of easement law.
As defined by Evershed MR in Re Ellenborough Park [1956] Ch 131, an easement requires the existence of at least two pieces of land. The land with the benefit of the easement is the dominant estate or dominant tenement, while the land burdened by the easement is the servient estate or servient tenement. For example, the owner of parcel A holds an easement to use a driveway on parcel B to gain access to A's house. Here, parcel A is the dominant estate, receiving the benefit, and parcel B is the servient estate, granting the benefit or suffering the burden. Public or private A private easement is held by private individuals or entities.
Appurtenant or in gross In the US, an easement appurtenant is one that benefits the dominant estate and "runs with the land" and so generally transfers automatically when the dominant estate is transferred. An appurtenant easement allows property owners to access land that is only accessible through a neighbor's land. Conversely, an easement in gross benefits an individual or a legal entity, rather than a dominant estate. The easement can be for a personal use (for example, an easement to use a boat ramp) or a commercial use (for example, an easement to a railroad company to cross property to build and maintain a rail line). Historically, an easement in gross was neither assignable nor inheritable, but commercial easements are now freely transferable to a third party. They are divisible but must be exclusive (the original owner no longer uses it and exclusive to easement holder) and all holders of the easement must agree to divide.
Affordable housing
Q4689034 EXACT TITLE 1.000
QID OVERLAP: Q4689034 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (26): "affordability", "affordable", "associated", "choice", "demand", "emergency", "forms", "generally", "government", "home", "homelessness", "household", "households", "housing", "income", "index", "informal", "local", "markets", "median".... | EXACT TITLE in land_use_planning: "Affordable housing". | EXACT TITLE in mortgage_lending: "Affordable housing".
affordabilityaffordableassociatedchoicedemandemergencyformsgenerallygovernmenthomehomelessnesshouseholdhouseholdshousingincomeindexinformallocalmarketsmediannationalownershiprentalresponsesetsupply
Affordable housing is housing which is deemed affordable to those with a household income at or below the median, as rated by the national government or a local government by a recognized housing affordability index. Most of the literature on affordable housing refers to mortgages and a number of forms that exist along a continuum – from emergency homeless shelters, to transitional housing, to non-market rental (also known as social or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
or subsidized housing), to formal and informal rental, indigenous housing, and ending with affordable home ownership. Demand for affordable housing is generally associated with a decrease in housing affordability, such as rent increases, in addition to increased homelessness. Housing choice is a response to a complex set of economic, social, and psychological impulses.
ore on housing because they feel they can afford to, while others may not have a choice. Increases in any housing supply (whether affordable housing or market-rate housing) leads to increased housing affordability across all segments of the housing markets. Definition and measurement There are several means of defining and measuring affordable housing.
Agricultural land
Q3395383 EXACT TITLE 1.000
QID OVERLAP: Q3395383 in land_use_planning (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (26): "activities", "agricultural", "agriculture", "annual", "approval", "collection", "context", "definitions", "development", "even", "forms", "generally", "irrigated", "irrigation", "land", "organization", "permitted", "present", "produce", "production".... | EXACT TITLE in land_use_planning: "Agricultural land".
activitiesagriculturalagricultureannualapprovalcollectioncontextdefinitionsdevelopmentevenformsgenerallyirrigatedirrigationlandorganizationpermittedpresentproduceproductionpurposesrequirerequiresrequiringsuitabilityzoning
arable land (also known as cropland): here redefined to refer to land producing crops requiring annual replanting or fallowland or pasture used for such crops within any five-year period permanent cropland: land producing crops which do not require annual replanting permanent pastures: natural or artificial grasslands and shrublands able to be used for grazing livestock This sense of "agricultural land" thus includes a great deal of land not devoted to agricultural use. The land actually under annually-replanted crops in any given year is instead said to constitute sown land or cropped land. "Permanent cropland" includes forested plantations used to harvest coffee, rubber, or fruit but not tree farms or proper forests used for wood or timber. Land able to be used for farming is called cultivable land. Farmland, meanwhile, is used variously in reference to all agricultural land, to all cultivable land, or just to the newly restricted sense of "arable land". Depending upon its use of artificial irrigation, the FAO's "agricultural land" may be divided into irrigated and non-irrigated land. In the context of zoning, agricultural land or agriculturally-zoned land refers to plots that are permitted to be used for agricultural activities, without regard to its present use or even suitability. In some areas, agricultural land is protected so that it can be farmed without any threat of development.
Agricultural land is typically land devoted to agriculture, the systematic and controlled use of other forms of life—particularly the rearing of livestock and production of crops—to produce food for humans.
enerally synonymous with both farmland or cropland, as well as pasture or rangeland. The United Nations Food and Agriculture Organization (FAO) and others following its definitions, however, also use agricultural land or agricultural area as a term of art, where it means the collection of: arable land (also known as cropland): here redefined to refer to land producing crops requiring annual replanting or fallowland or pasture used for such crops within any five-year period permanent cropland: land producing crops which do not require annual replanting permanent pastures: natural or artificial grasslands and shrublands able to be used for grazing livestock This sense of "agricultural land" thus includes a great deal of land not devoted to agricultural use. The land actually under annually-replanted crops in any given year is instead said to constitute sown land or cropped land. "Permanent cropland" includes forested plantations used to harvest coffee, rubber, or fruit but not tree farms or proper forests used for wood or timber. Land able to be used for farming is called cultivable land. Farmland, meanwhile, is used variously in reference to all agricultural land, to all cultivable land, or just to the newly restricted sense of "arable land". Depending upon its use of artificial irrigation, the FAO's "agricultural land" may be divided into irrigated and non-irrigated land. In the context of zoning, agricultural land or agriculturally-zoned land refers to plots that are permitted to be used for agricultural activities, without regard to its present use or even suitability. In some areas, agricultural land is protected so that it can be farmed without any threat of development.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (23): "academic", "ada", "boise", "canyon", "college", "community", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "southwest", "students", "treasure".... | EXACT TITLE in land_use_planning: "College of Western Idaho". | EXACT TITLE in mortgage_lending: "College of Western Idaho".
academicadaboisecanyoncollegecommunitycountiescwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicsouthweststudentstreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Treasure Valley
Q7836726 EXACT TITLE 0.940
QID OVERLAP: Q7836726 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (12): "agricultural", "association", "boise", "idaho", "land", "local", "metropolitan", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in land_use_planning: "Treasure Valley". | EXACT TITLE in mortgage_lending: "Treasure Valley".
agriculturalassociationboiseidaholandlocalmetropolitanresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
W
Q7973730 EXACT TITLE 0.880
QID OVERLAP: Q7973730 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (9): "different", "generally", "irrigation", "law", "legal", "physical", "source", "systems", "water". | EXACT TITLE in land_use_planning: "Water right". | EXACT TITLE in mortgage_lending: "Water right".
differentgenerallyirrigationlawlegalphysicalsourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
History In ancient Rome, the law was that people could obtain temporary usufructuary rights for running water. These rights were independent of land ownership, and lasted as long as use continued. Under English common law, all tidal waters were held by the Crown and all freshwater streams were included with title to the lands, with full accompanying rights. However, under the riparian doctrine, landowners had the right to receive water undiminished by upstream landowners. Over time, rights evolved from being strictly land-based to also include use-based, allowing non-landowners to hold enforceable rights to receive clean water. A reasonable use rule evolved in some countries. Finland In Finland, waterbodies are generally privately owned, but Finland also applies the Roman law principle of aqua profluens (flowing water), according to which the freely flowing water in waterbodies cannot be owned or possessed. This means that the owners of waterbodies cannot prohibit diversion of water for agricultural, industrial, municipal, or domestic use according to the provisions of the Finnish Water Law. A separate act regulates provision of water.
P
EXACT TITLE 0.820
QID OVERLAP: Q7136418 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (6): "delivery", "geography", "individual", "land", "modern", "parcel". | EXACT TITLE in land_use_planning: "Parcel". | EXACT TITLE in mortgage_lending: "Parcel".
deliverygeographyindividuallandmodernparcel
Parcel may refer to: Parcel (consignment), an individual consignment of cargo for shipment Parcel (package), sent through the mail or package delivery Bilu Rakkhosh or Parcel, a 2019 Indian Bengali-language film The Parcel, a 2020 Indian Bengali-language film Parcels (band), Australian modern soul band formed in 2014 Fluid parcel, a concept in fluid dynamics Land lot, a piece of land Placer (geography), parcel in Portuguese, a type of submerged bank or reef an object used in the game Pass the parcel
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in land_use_planning (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "urban", "western". | EXACT TITLE in land_use_planning: "Boise River".
agriculturalapproximatelyboiseidahourbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Urban sprawl
Q192042 QID OVERLAP 0.800
QID OVERLAP: Q192042 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (37): "agency", "associate", "associated", "become", "building", "commercial", "costs", "density", "development", "environmental", "expansion", "form", "geographic", "growth", "housing", "industrial", "infrastructure", "land", "large", "modern"....
agencyassociateassociatedbecomebuildingcommercialcostsdensitydevelopmentenvironmentalexpansionformgeographicgrowthhousingindustrialinfrastructurelandlargemodernplanningpopulationprivatepropertyprotectionrapidratesrequireresidentialroads+7
l require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
oads over large expanses of land, with little concern for very dense urban planning. Urban sprawl refers to a special form of urbanization, and it relates to the social and environmental consequences associated with such development. In modern times some suburban areas described as "sprawl" have less detached housing and higher density than the nearby core city. Medieval suburbs suffered from the loss of protection of city walls, before the advent of industrial warfare. Sometimes the urban areas described as the most "sprawling" are the most densely populated. The modern disadvantages and costs of urban sprawl include increased travel time, transport costs, pollution, and destruction of the countryside. The revenue for building and maintaining urban infrastructure in these areas are gained mostly through property and sales taxes. Most jobs in the US are now located in suburbs generating much of the revenue, although a lack of growth will require higher tax rates. In Europe, the term peri-urbanisation is often used to denote similar dynamics and phenomena, but the term urban sprawl is currently being used by the European Environment Agency. There is widespread disagreement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
eement about what constitutes sprawl and how to quantify it. For example, some commentators measure sprawl by residential density, using the average residential units per acre in a given area. Others associate it with decentralization (spread of population without a well-defined centre), discontinuity (leapfrogging development, as defined below), segregation of uses, and so forth. The term urban sprawl is highly politicized and almost always has negative connotations. It is criticized for causing environmental degradation, intensifying segregation, and undermining the vitality of existing urban areas, and is attacked on aesthetic grounds. Few people openly support urban sprawl as such, due to the pejorative connotations of the term.
Boise metropolitan area
Q4938481 QID OVERLAP 0.800
QID OVERLAP: Q4938481 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (16): "ada", "boise", "canyon", "combined", "counties", "estimate", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley".
adaboisecanyoncombinedcountiesestimatehomeidaholargermeridianmetropolitannampapercentpopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Planning permission
Q7571373 QID OVERLAP 0.800
QID OVERLAP: Q7571373 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (27): "approval", "building", "cannot", "code", "codes", "completion", "compliance", "construction", "development", "employment", "expansion", "financing", "generally", "government", "law", "local", "national", "needed", "permission", "permit"....
approvalbuildingcannotcodecodescompletioncomplianceconstructiondevelopmentemploymentexpansionfinancinggenerallygovernmentlawlocalnationalneededpermissionpermitpermitsplanningplansprocessesregionalrequiredurban
Planning permission or building permit refers to the approval needed for construction or expansion (including significant renovation), and sometimes for demolition, in some jurisdictions. House building permits, for example, are subject to building codes. There is also a "plan check" (PLCK) to check compliance with plans for the area, if any. For example, one cannot obtain permission to build a nightclub in an area where it is inappropriate such as a high-density suburb. The criteria for planning permission are a part of urban planning and construction law, and are usually managed by town planners employed by local governments. Failure to obtain a permit can result in fines, penalties, and demolition of unauthorized construction if it cannot be made to meet code. Generally, the new construction must be inspected during construction and after completion to ensure compliance with national, regional, and local building codes. Since building permits usually precede outlays for construction, employment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country.
oyment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country. By-right approval processes can be faster than discretionary approval processes. In specific industries Broadcasting As part of broadcast law, the term is also used in broadcasting, where individual radio and television stations typically must apply for and receive permission to construct radio towers and radio antennas. This type of permit is issued by a national broadcasting authority, but does not imply zoning any other permission that must be given by local government. The permit itself also does not necessarily imply permission to operate the station once constructed. In the U.S., a construction permit is valid for three years. Afterwards, the station must receive a full license to operate, which is good for seven years. This is provided by a separate broadcast license, also called a "license to cover" by the Federal Communications Commission (FCC) in the United States. Further permission or registration for towers may be needed from aviation authorities. In the U.S., construction permits for new commercial stations are now assigned by auction, rather than the former process of determining who would serve the community of license best.
ized construction if it cannot be made to meet code. Generally, the new construction must be inspected during construction and after completion to ensure compliance with national, regional, and local building codes. Since building permits usually precede outlays for construction, employment, financing and furnishings, they are often used as a leading indicator for development in other areas of the economy. The number of building permits issued per year varies by country.
I
Q6073798 QID OVERLAP 0.800
QID OVERLAP: Q6073798 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (16): "authority", "boundaries", "district", "districts", "entity", "geographic", "government", "irrigation", "large", "local", "public", "set", "statute", "subdivision", "tax", "water".
authorityboundariesdistrictdistrictsentitygeographicgovernmentirrigationlargelocalpublicsetstatutesubdivisiontaxwater
division of the State government, with definite geographic boundaries, organized, and having taxing power to obtain and distribute water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn.
water for irrigation of lands within the district; created under the authority of a State legislature with the consent of a designated fraction of the landowners or citizens. It is a special-purpose district created by statute in order to develop large irrigation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district
igation projects. These districts have the power to tax, borrow, and condemn. Sample districts See also Deficit irrigation Environmental effects of irrigation Huerta Irrigation methods Irrigation District Act of 1916 (Smith Act) Irrigation Districts and Farm Loans Act Water district References External links Federal lands included in state irrigation districts "The Nevada Irrigation District Act"
Mergers and acquisitions
Q731112 QID OVERLAP 0.800
QID OVERLAP: Q731112 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (47): "acquisition", "acquisitions", "act", "activity", "allow", "another", "assets", "business", "capital", "central", "combine", "combined", "consolidated", "consolidation", "control", "corporate", "create", "department", "direct", "economically"....
acquisitionacquisitionsactactivityallowanotherassetsbusinesscapitalcentralcombinecombinedconsolidatedconsolidationcontrolcorporatecreatedepartmentdirecteconomicallyentityfederalgovernedgovernmentinterestslawlegalmanagementmarketnotice+17
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
United States Department of Housing and Urban Development
Q811595 QID OVERLAP 0.800
QID OVERLAP: Q811595 in land_use_planning (tier:evergreen) and mortgage_lending (tier:branch). | SHARED TOKENS (15): "administers", "agency", "department", "departments", "development", "directly", "federal", "financing", "government", "home", "housing", "member", "program", "reports", "urban".
administersagencydepartmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthomehousingmemberprogramreportsurban
The United States Department of Housing and Urban Development (HUD) is one of the executive departments of the U.S. federal government. It administers federal housing and urban development laws. It is headed by the secretary of housing and urban development, who reports directly to the president of the United States and is a member of the president's Cabinet. Although its beginnings were in the House and Home Financing Agency, it was founded as a Cabinet department in 1965, as part of the "Great Society" program of President Lyndon B.
Community Planning and Development: Many major affordable housing and homelessness programs are administered under Community Planning and Development.
y of housing and urban development, who reports directly to the president of the United States and is a member of the president's Cabinet. Although its beginnings were in the House and Home Financing Agency, it was founded as a Cabinet department in 1965, as part of the "Great Society" program of President Lyndon B. Johnson, to develop and execute policies on housing and metropolises. History The idea of a department of Urban Affairs was proposed in a 1957 report to President Dwight D. Eisenhower, led by New York governor Nelson A. Rockefeller. The idea of a department of Housing and Urban Affairs was taken up by President John F. Kennedy, with Pennsylvania Senator and Kennedy ally Joseph S. Clark Jr. listing it as one of the top seven legislative priorities for the administration in internal documents. The department was established on September 9, 1965, when President Lyndon B. Johnson signed the Department of Housing and Urban Development Act into law. It stipulated that the department was to be created no later than November 8, sixty days following the date of enactment. The actual implementation was postponed until January 14, 1966, following the completion of a special study group report on the federal role in solving urban problems. HUD is administered by the U.S. secretary of housing and urban development. Its headquarters was located in the Robert C. Weaver Federal Building from 1968 to 2025, when HUD announced that it would move to Alexandria, Virginia.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "counties", "east", "employers", "home", "idaho", "locally", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountieseastemployershomeidaholocallymetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (27): "active", "business", "capital", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firm", "general", "investment", "long-term", "management", "operational", "otherwise", "ownership", "private", "products"....
activebusinesscapitalchangescontroldevelopmentexpansionfinancefinancialfinancingfirmgeneralinvestmentlong-termmanagementoperationalotherwiseownershipprivateproductsprovidepublicratherrolespecializedspecificstrategy
Private equity (PE) is stock in a private company that does not offer stock to the general public. Instead, it is offered to specialized investment funds and limited partnerships that take an active role in managing and structuring the companies. In colloquial usage, "private equity" can refer to these investment firms rather than the companies in which they invest. Private-equity capital is invested into a target company either by an investment management company (private equity firm), a venture capital fund, or an angel investor; each category of investor has specific financial goals, management preferences, and investment strategies for profiting from their investments. Private equity can provide working capital to finance a target company's expansion, including the development of new products and services, operational restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
"Distressed-to-Control" ("Loan-to-Own") investment whereby the investor buys debt securities in hope of acquiring ownership and control of the company's equity after financing the corporate restructuring of the target company; "Special Situations" ("Turnaround") investment wherein the investor buys debt securities and equity investments, to be used as rescue financing that will restore the profitability of the financially-weak target company. Moreover, the private-equity investment strategies of hedge funds also include actively trading the loans held and the bonds issued by the financially-weak target companies. Secondaries Secondary investments refer to investments made in existing private-equity assets. These transactions can involve the sale of private equity fund interests or portfolios of direct investments in privately held companies through the purchase of these investments from existing institutional investors. By its nature, the private-equity asset class is illiquid, intended to be a long-term investment for buy and hold investors. Secondary investments allow institutional investors, particularly those new to the asset class, to invest in private equity from older vintages than would otherwise be available to them. Secondaries also typically experience a different cash flow profile, diminishing the j-curve effect of investing in new private-equity funds. Often investments in secondaries are made through third-party fund vehicle, structured similar to a fund of funds although many large institutional investors have purchased private-equity fund interests through secondary transactions.
Eagle, Idaho
Q1516870 EXACT TITLE 0.800
QID OVERLAP: Q1516870 in land_use_planning (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population". | EXACT TITLE in mortgage_lending: "Eagle, Idaho".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
Real estate development
Q695829 QID OVERLAP 0.800
QID OVERLAP: Q695829 in land_use_planning (tier:evergreen) and mortgage_lending (tier:evergreen). | SHARED TOKENS (41): "act", "approval", "approvals", "approved", "building", "commercial", "construction", "context", "costs", "creates", "determine", "development", "different", "engineers", "environmental", "estate", "financial", "financing", "growth", "housing"....
actapprovalapprovalsapprovedbuildingcommercialconstructioncontextcostscreatesdeterminedevelopmentdifferentengineersenvironmentalestatefinancialfinancinggrowthhousingincreaselandmixed-usepermitsplanningplanspotentialprocessprogramproperty+11
ersee construction or renovation. Developers usually take significant financial risks in the creation or renovation of real estate and receive the greatest rewards. Typically, developers purchase a tract of land, determine the marketing of the property, develop the building program and design, obtain the necessary public approval and financing, build the structures, and rent out, manage, and ultimately sell it. Real estate development has been criticized for contributing to urban sprawl and environmental degradation. Supporters argue that development expands housing supply, reduces housing costs, stimulates economic growth and creates jobs.
Some developers only handle part of the process. For example, some developers source a property and get the plans and permits approved before selling the property with the plans and permits to a builder at a premium price. Alternatively, a developer who is also a builder may purchase a property with the plans and permits in place so that they do not have the risk of failing to obtain planning approval and can start construction on the development immediately. Financial difficulties in development and investing differ because of leverage. Developers work with many different counterparts along each step of this process, including architects, city planners, engineers, surveyors, inspectors, contractors, lawyers, leasing agents, etc. In the Town and Country Planning context in the United Kingdom, “development” is defined in the Town and Country Planning Act 1990 s55. Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Organizing for development Development teams vary in size, bigger companies may provide all services in-house. At the other end of the spectrum, a development company might consist of one principal and a few staff who hire or contract with other companies and professionals for each service as needed. Assembling a team of professionals to address the environmental, economic, private, physical and political issues inherent in a complex development project is critical. A developer's success depends on the ability to coordinate and lead the completion of a series of interrelated activities efficiently and at the appropriate time. Development process requires skills of many professionals: architects, landscape architects, civil engineers and site planners to address project design; market consultants to determine demand and a project's economics; attorneys to handle agreements and government approvals; environmental consultants and soils engineers to analyze a site's physical limitations and environmental impacts; surveyors and title companies to provide legal descriptions of a property; and lenders to provide financing.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (14): "boise", "canyon", "college", "footprint", "home", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncollegefootprinthomeidahomeaningmeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in land_use_planning (tier:branch) and mortgage_lending (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "east", "home", "idaho", "jurisdiction", "local", "metropolitan", "population", "private", "roads".
adaboisecapitaldistricteasthomeidahojurisdictionlocalmetropolitanpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Secondary suite
Q1308354 QID OVERLAP 0.740
QID OVERLAP: Q1308354 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (12): "accessory", "additional", "dwelling", "home", "income", "member", "principal", "property", "provide", "residential", "separate", "support".
accessoryadditionaldwellinghomeincomememberprincipalpropertyprovideresidentialseparatesupport
A secondary suite (also known as an accessory dwelling unit (ADU), in-law apartment, granny flat, granny annex or garden suite) is a self-contained apartment, cottage, or small residential unit that is located on a property that has a separate main, single-family home, duplex, or other residential unit. In some cases, the ADU or in-law is attached to the principal dwelling or is an entirely separate unit, located above a garage, across a carport, or in the backyard on the same property.
al and personal support to a family member, or obtain greater security. Description Background Naming conventions vary by time period and location, but secondary suites may also be referred to as accessory dwelling units (ADUs), mother-in-law suites, granny flats, coach houses, laneway houses, Ohana dwelling units, granny annexes, granny suites, in-law suites, and accessory apartments. The prevalence of secondary suites is also dependent on time and location with varying rates depending on the country, state, or city. Furthermore, regulations on secondary suites vary widely across jurisdictions.
Spatial relationship to main residence A secondary suite is considered "secondary" or "accessory" to the primary residence on the parcel. It normally has its own entrance, kitchen, bathroom and living area. There are three main types of accessory units: interior, interior with modification, and detached.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
M
Q6804463 QID OVERLAP 0.700
QID OVERLAP: Q6804463 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (10): "construction", "improve", "itself", "lien", "liens", "materials", "meaning", "property", "real", "title".
constructionimproveitselflienliensmaterialsmeaningpropertyrealtitle
plied labor or materials that improve the property. The lien exists for both real property and personal property. In the realm of real property, it is called by various names, including, generically, construction lien. The term "lien" comes from a French root, with a meaning similar to link, which is itself ultimately descended from the Latin ligamen, meaning "bond" and ligare, meaning "to bind".
c's liens on property in the United States date from the 18th century. History and reasons for existence Mechanic's liens in their modern form were first conceived by Thomas Jefferson, to encourage construction in the new capital city of Washington. They were established by the Maryland General Assembly, of which the city of Washington was then a part. However, it is not likely that Jefferson single-handedly dreamed up the idea. At the time Jefferson promoted the law, a lien-like privilege already existed in civil law countries like France, the Dutch Republic and Spain, with some laws even tracing their roots to the Roman Empire. And since control of Louisiana had passed between the French and Spaniards, and had largely adopted the French Napoleonic Code, there was a similar privilege concept in that territory. It seems highly likely that the legislators working on the first U.S. Mechanic Lien laws had knowledge of, and referenced these civil law concepts. Nevertheless, the United States version was original, as it gave builders a more robust right into the land itself (versus just the improvement's value). With respect to real property, mechanic's liens are purely statutory devices that exist in every state (although in California, as noted below, they have a constitutional foundation). The reason they exist is a legislative public policy to protect contractors. More specifically, the state legislatures have determined that, due to the economics of the construction business, contractors and subcontractors need greater remedy for non-payment for their work than merely the right to sue on their contracts. In particular, without the mechanics' lien, subcontractors providing either labor or materials may have no effective remedy if their general contractor is not sufficiently financially responsible, because their only contractual right is with that general contractor. Without the mechanic's lien, the contractor would have a limited number of options to enforce payment of the amounts owed. Further, there is usually a long list of claimants on any failed project. To avoid the specter of various trades, materialmen and suppliers attempting to remove the improvements they have made, and to maintain a degree of equality between the various lienors on a project, the statutory lien scheme was created. Without it, Tradesperson A may try to "race" Supplier B to the courthouse, the project site or the construction lender to obtain payment. Most lien statutes instead mandate strict compliance with the formalized process they create in return for the timely resolution and balancing of claims between all parties involved - both owners and lien claimants. In the state of California, mechanic's liens are a constitutional right guaranteed to contractors by the California Constitution. This right has been implemented in detail by statutes enacted by the California State Legislature.
Creation, perfection, priority and enforcement – real property Mechanic's liens on the title to real property are exclusively the result of legislation. Each state has its own laws regarding the creation and enforcement of these liens, but, overall, there are some similar elements among them. Many States distinguish between the types of real property upon which a mechanics lien can be filed. Under the principle of sovereign immunity, real property of the government (public property) is ordinarily not subject to the claims of private parties. Therefore, unless the state specifically so provides, mechanic's liens do not attach to the title owned by the state or its administrative subdivisions, such as cities. Similarly, mechanic's liens under state law are invalid on federal construction projects. To protect subcontractors and suppliers working on federal projects where the contract price exceeds $100,000.00 the Miller Act requires general contractors to provide a payment bond which guarantees payment for work done in accordance with the terms of the contract. Many state and municipal governments similarly require contractors on public works projects to be bonded under so-called "Little Miller Acts." Theoretically, the payment bond under the Miller Act or Little Miller Act stands in place of the government's property, and qualified claimants make claims against that bond similar to how they would file an ordinary mechanic's lien. In many states, the legislature has created extra procedures in order for a mechanics lien to be placed on residential property. In New Jersey, which enacted the strictest of these regulations, a mechanics lien can only be placed on residential property after a Notice of Unpaid Balance and Right to File Lien has been filed within 60 days of the lienor's last date of work and an arbitration award has been issued by an American Arbitration Association arbitrator permitting a mechanics lien to be filed. The act itself of filing a mechanics lien can be difficult. Most States simply require the filing of the mechanics lien with a county or court clerk within a defined amount of time from a triggering event. However, Maryland requires an application to the Court in order to file a mechanics liens.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Snake River Plain
Q1396049 QID OVERLAP 0.580
QID OVERLAP: Q1396049 in land_use_planning (tier:branch) and mortgage_lending (tier:branch). | SHARED TOKENS (4): "agricultural", "east", "idaho", "land".
agriculturaleastidaholand
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
216 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP216 edges
🌿 BRANCH176 edges
0.500
applicationsbanksbecomecomplianceconsumerdebtdependsdevelopeddirectestatefeesfinanceindividualinstitutionsjurisdictionlendersmarketsproductsrealregulated
SHARED TOKENS (24): "applications", "banks", "become", "compliance", "consumer", "debt", "depends", "developed", "direct", "estate", "fees", "finance", "individual", "institutions", "jurisdiction", "lenders", "markets", "products", "real", "regulated".... | EXACT TITLE in mortgage_lending: "Mortgage broker".
0.500
amongapproximatelyboisedivisionestablishedidaholaterofficesoperatesparkproductionprofessionalpublicresearchruralschoolsstatewidestudentsuniversity
SHARED TOKENS (19): "among", "approximately", "boise", "division", "established", "idaho", "later", "offices", "operates", "park", "production", "professional", "public", "research", "rural", "schools", "statewide", "students", "university". | EXACT TITLE in land_use_planning: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanothercompletedconstructedconstructioncontainscreatedrivenenvironmentalmaterialmodernoccurpotentialproviderequireresourcesruralselectedsitesources
SHARED TOKENS (28): "access", "another", "completed", "constructed", "construction", "contains", "create", "driven", "environmental", "material", "modern", "occur", "potential", "provide", "require", "resources", "rural", "selected", "site", "sources".... | EXACT TITLE in land_use_planning: "Well". | EXACT TITLE in mortgage_lending: "Well".
0.500
activitiesassociatedbuildingconstructiondevelopmentequivalentfacilitiesfinancingimproveindustrialinfrastructurepercentplanningprocessproductswork
SHARED TOKENS (16): "activities", "associated", "building", "construction", "development", "equivalent", "facilities", "financing", "improve", "industrial", "infrastructure", "percent", "planning", "process", "products", "work". | EXACT TITLE in land_use_planning: "Construction". | EXACT TITLE in mortgage_lending: "Construction".
0.500
additionalagenciesassetsbanksbasebeyondcommercialcommunitiescommunitydecisionsdefinitionsfederalfocusgovernmentinstitutionsinsurancelocallocallynationaloffice
SHARED TOKENS (24): "additional", "agencies", "assets", "banks", "base", "beyond", "commercial", "communities", "community", "decisions", "definitions", "federal", "focus", "government", "institutions", "insurance", "local", "locally", "national", "office".... | EXACT TITLE in mortgage_lending: "Community bank".
0.500
Cartography ↗ Q42515 EXACT TITLE
boundariesgeographicinformationlandmakingmediamodeledmodernphysicalpracticalpracticereducerepresentroadssetstudysystems
SHARED TOKENS (17): "boundaries", "geographic", "information", "land", "making", "media", "modeled", "modern", "physical", "practical", "practice", "reduce", "represent", "roads", "set", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.500
activitiesactivityagencieschoicecommunitydevelopeddistributionestimatesevenfeaturesgeographicgrowinggrowthinformationland-usemetropolitanmodelmodelsplanningpractice
SHARED TOKENS (32): "activities", "activity", "agencies", "choice", "community", "developed", "distribution", "estimates", "even", "features", "geographic", "growing", "growth", "information", "land-use", "metropolitan", "model", "models", "planning", "practice".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
actactionsactivityadditionalagainstamonganalyzeannualauthoritybureaucollectioncommunitycomplianceconsumerdatadepartmentdirectenforcementestablishexemptions
SHARED TOKENS (53): "act", "actions", "activity", "additional", "against", "among", "analyze", "annual", "authority", "bureau", "collection", "community", "compliance", "consumer", "data", "department", "direct", "enforcement", "establish", "exemptions".... | EXACT TITLE in mortgage_lending: "Home Mortgage Disclosure Act".
0.500
Accountant ↗ Q326653 EXACT TITLE
determineemployersfeesfinancialfirmimpactindependentlyinfluenceobligationsorganizationpractitionerpractitionersprocessprofessionalprofessionalspublicqualityrequiresrolestatute
SHARED TOKENS (23): "determine", "employers", "fees", "financial", "firm", "impact", "independently", "influence", "obligations", "organization", "practitioner", "practitioners", "process", "professional", "professionals", "public", "quality", "requires", "role", "statute".... | EXACT TITLE in mortgage_lending: "Accountant".
0.500
academicanalysisanalyzeanotherapplicationsbroaderbusinessdatadefinitiongeographicgeographyindexinformationinstitutionalinsuranceintegratedknowledgemanagementoperationsphysical
SHARED TOKENS (31): "academic", "analysis", "analyze", "another", "applications", "broader", "business", "data", "definition", "geographic", "geography", "index", "information", "institutional", "insurance", "integrated", "knowledge", "management", "operations", "physical".... | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
actactionsactualagainstapplicantapplicantsappliesassistanceauthoritybanksbusinesscapacitycodifiedcommunitycomplyconsumercoursedefinesdevelopmentdifferent
SHARED TOKENS (44): "act", "actions", "actual", "against", "applicant", "applicants", "applies", "assistance", "authority", "banks", "business", "capacity", "codified", "community", "comply", "consumer", "course", "defines", "development", "different".... | EXACT TITLE in mortgage_lending: "Equal Credit Opportunity Act".
0.500
americancentralchangesconcentrationdevelopmenteastenvironmentalexpansionformationformsgrowinggrowthhouseholdsinformalmodelpatternspopulationprocessruralsettlement
SHARED TOKENS (22): "american", "central", "changes", "concentration", "development", "east", "environmental", "expansion", "formation", "forms", "growing", "growth", "households", "informal", "model", "patterns", "population", "process", "rural", "settlement".... | EXACT TITLE in mortgage_lending: "Suburbanization".
0.500
actagencyappliedbecomebureaudeliverydepartmentdevelopmentestablishedfederalfundinggovernmentirrigationjunelawmanagementoperationpotentialproduceprogram
SHARED TOKENS (27): "act", "agency", "applied", "become", "bureau", "delivery", "department", "development", "established", "federal", "funding", "government", "irrigation", "june", "law", "management", "operation", "potential", "produce", "program".... | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
0.500
activitiesaddressbroadercoveringdevelopmentenvironmentalfocusgrowthindividualindustrialinfrastructurelandland-uselargermanagementnationalnetworkparticularplanningplans
SHARED TOKENS (33): "activities", "address", "broader", "covering", "development", "environmental", "focus", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "management", "national", "network", "particular", "planning", "plans".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accessagencieschangecommunityconditionsdevelopmentdifferentdistinctemergencyenforcementenvironmentalfacilitiesfocusfunctiongeneralhouseholdsindustrialinfrastructureinstitutionslaw
SHARED TOKENS (45): "access", "agencies", "change", "community", "conditions", "development", "different", "distinct", "emergency", "enforcement", "environmental", "facilities", "focus", "function", "general", "households", "industrial", "infrastructure", "institutions", "law".... | EXACT TITLE in land_use_planning: "Infrastructure". | EXACT TITLE in mortgage_lending: "Infrastructure".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddevelopeddirectlyeventslandlargepopulationpotentialreducerelatedresourcetimingtreatmenturbanvolumewater
SHARED TOKENS (18): "become", "create", "demand", "developed", "directly", "events", "land", "large", "population", "potential", "reduce", "related", "resource", "timing", "treatment", "urban", "volume", "water". | EXACT TITLE in land_use_planning: "Stormwater".
0.500
actionactivityanalysisanotherassociatedbuildingcentralchangescontroldevelopmentdifferentenvironmentalfieldformformationformsfunctionsgeographymaintainmaterial
SHARED TOKENS (37): "action", "activity", "analysis", "another", "associated", "building", "central", "changes", "control", "development", "different", "environmental", "field", "form", "formation", "forms", "functions", "geography", "maintain", "material".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
agenciesarchitectureconditionsconstructioncontrolenvironmentalestategeneralinfrastructurelandscapelicenselicensedlicensesmanagementparksplanningpractitionerprivateprocessesproduce
SHARED TOKENS (28): "agencies", "architecture", "conditions", "construction", "control", "environmental", "estate", "general", "infrastructure", "landscape", "license", "licensed", "licenses", "management", "parks", "planning", "practitioner", "private", "processes", "produce".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
addressingcommunitiesconstructiongovernmentgrowthhousinginfrastructurelandneighborhoodsprivateprocesspublicredevelopmentrenewalseturban
SHARED TOKENS (16): "addressing", "communities", "construction", "government", "growth", "housing", "infrastructure", "land", "neighborhoods", "private", "process", "public", "redevelopment", "renewal", "set", "urban". | EXACT TITLE in land_use_planning: "Urban renewal".
0.500
affectcourtsdeedsdeterminediffersestablishedestateframeworkinstrumentsinterestslandlawlegalotherwiseprincipalprotectpublicrealrecordsystem
SHARED TOKENS (22): "affect", "courts", "deeds", "determine", "differs", "established", "estate", "framework", "instruments", "interests", "land", "law", "legal", "otherwise", "principal", "protect", "public", "real", "record", "system".... | EXACT TITLE in mortgage_lending: "Recording (real estate)".
0.500
americanassetsbankscommercialconsumercorporateequivalentfinancialinstitutionsmembernonprofitoperationspublicretailsystemstrust
SHARED TOKENS (16): "american", "assets", "banks", "commercial", "consumer", "corporate", "equivalent", "financial", "institutions", "member", "nonprofit", "operations", "public", "retail", "systems", "trust". | EXACT TITLE in mortgage_lending: "Credit union".
0.500
alteralternativeanotherconditionsconsolidatedcontextcorporatedebtdifferentfeesfinancefinancialformshomemakesmanagementobligationobligationspaymentprojected
SHARED TOKENS (26): "alter", "alternative", "another", "conditions", "consolidated", "context", "corporate", "debt", "different", "fees", "finance", "financial", "forms", "home", "makes", "management", "obligation", "obligations", "payment", "projected".... | EXACT TITLE in mortgage_lending: "Refinancing".
0.500
Foreclosure ↗ Q231710 EXACT TITLE
appliedassociationcannotcompletecomplycostscourtsdebtduesfeefeesforeclosurefutureholderslawlegallienmakingoperationowner
SHARED TOKENS (34): "applied", "association", "cannot", "complete", "comply", "costs", "courts", "debt", "dues", "fee", "fees", "foreclosure", "future", "holders", "law", "legal", "lien", "making", "operation", "owner".... | EXACT TITLE in land_use_planning: "Foreclosure". | EXACT TITLE in mortgage_lending: "Foreclosure".
0.500
actchaptercodecodifiedcostsestatefeeslawlenderspracticeproceduresprocessprotectproviderealrequiressettlementthemtitle
SHARED TOKENS (19): "act", "chapter", "code", "codified", "costs", "estate", "fees", "law", "lenders", "practice", "procedures", "process", "protect", "provide", "real", "requires", "settlement", "them", "title". | EXACT TITLE in mortgage_lending: "Real Estate Settlement Procedures Act".
0.500
chaindocumentdocumentationdocumentshistoricallawmaintainedofficeownerownershippresentpropertyrecordservestitle
SHARED TOKENS (15): "chain", "document", "documentation", "documents", "historical", "law", "maintained", "office", "owner", "ownership", "present", "property", "record", "serves", "title". | EXACT TITLE in mortgage_lending: "Chain of title".
0.500
alongsideamericancapacitycapitalcombineconnectingconventionalfeaturesfullynetworkprioritypublicqualityrapidreducesinglesystemsystems
SHARED TOKENS (18): "alongside", "american", "capacity", "capital", "combine", "connecting", "conventional", "features", "fully", "network", "priority", "public", "quality", "rapid", "reduce", "single", "system", "systems". | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
activitiesagenciesagriculturalallowdevelopmentdifferentdistrictseasementseducationestablishingfuturegovernmentgrowinglandlimitlocalnationaloperatedoperationalotherwise
SHARED TOKENS (34): "activities", "agencies", "agricultural", "allow", "development", "different", "districts", "easements", "education", "establishing", "future", "government", "growing", "land", "limit", "local", "national", "operated", "operational", "otherwise".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
analysisappliedcurrentdatadifferentformformsgeographiclargepropertiesresearchscalestructuresstudyurban
SHARED TOKENS (15): "analysis", "applied", "current", "data", "different", "form", "forms", "geographic", "large", "properties", "research", "scale", "structures", "study", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.500
analyzebankscapacitycreatedetermineevenfinallargerlendersmanagementmodelsparticularprocessprovidequalityriskunderwritinguses
SHARED TOKENS (18): "analyze", "banks", "capacity", "create", "determine", "even", "final", "larger", "lenders", "management", "models", "particular", "process", "provide", "quality", "risk", "underwriting", "uses". | EXACT TITLE in mortgage_lending: "Mortgage underwriting".
0.500
Urban design ↗ Q63100 EXACT TITLE
architecturecommunityconnectdependentenvironmentalfeatureshistoricalimpactlandscapelocalpagephysicalplanningprocessesprojectpublicregionalrelatedspecificsurrounding
SHARED TOKENS (23): "architecture", "community", "connect", "dependent", "environmental", "features", "historical", "impact", "landscape", "local", "page", "physical", "planning", "processes", "project", "public", "regional", "related", "specific", "surrounding".... | EXACT TITLE in land_use_planning: "Urban design".
0.500
authorityestategoverninggovernmentimprovementsincomejurisdictionlandnationalpropertyrealrentalrequiressystemtaxtransactionvaluewhose
SHARED TOKENS (18): "authority", "estate", "governing", "government", "improvements", "income", "jurisdiction", "land", "national", "property", "real", "rental", "requires", "system", "tax", "transaction", "value", "whose". | EXACT TITLE in mortgage_lending: "Property tax".
0.500
actualagainstbusinessbuyerscommercialcostscoveragedeedsdollarestateevidencefeefinancedfinancialformgeneralgenerallyindependentinstitutionalinsurance
SHARED TOKENS (46): "actual", "against", "business", "buyers", "commercial", "costs", "coverage", "deeds", "dollar", "estate", "evidence", "fee", "financed", "financial", "form", "general", "generally", "independent", "institutional", "insurance".... | EXACT TITLE in land_use_planning: "Title insurance". | EXACT TITLE in mortgage_lending: "Title insurance".
0.500
Aquifer ↗ Q208791 EXACT TITLE
beyondformationhomeindustriallandlayermaterialmaterialspresentpressurepurposesrelatedsourcestudyunderlyingwaterwells
SHARED TOKENS (17): "beyond", "formation", "home", "industrial", "land", "layer", "material", "materials", "present", "pressure", "purposes", "related", "source", "study", "underlying", "water", "wells". | EXACT TITLE in land_use_planning: "Aquifer".
0.500
administrationagenciesagencyassistancedepartmentdistrictfederalfinancialfunctionsgovernmentimprovelocalmaintainofficeofficesoperatorsprogramsproviderspublicregional
SHARED TOKENS (24): "administration", "agencies", "agency", "assistance", "department", "district", "federal", "financial", "functions", "government", "improve", "local", "maintain", "office", "offices", "operators", "programs", "providers", "public", "regional".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
Impact fee ↗ Q6005889 EXACT TITLE
capitalconstructioncostsdevelopmentexpansionfeefeesgovernmentgrowthimpactimprovementslocalneededpopulationprojectpublicreduce
SHARED TOKENS (17): "capital", "construction", "costs", "development", "expansion", "fee", "fees", "government", "growth", "impact", "improvements", "local", "needed", "population", "project", "public", "reduce". | EXACT TITLE in land_use_planning: "Impact fee". | EXACT TITLE in mortgage_lending: "Impact fee".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesagencyapplicationdevelopeddevelopmentenvironmentalfederalfundedlandmetropolitannationalorgplanningplatformsprofessionalprotectionresearchreviewssource
SHARED TOKENS (26): "administration", "agencies", "agency", "application", "developed", "development", "environmental", "federal", "funded", "land", "metropolitan", "national", "org", "planning", "platforms", "professional", "protection", "research", "reviews", "source".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialdifferententityestategeneralgovernmentgrowinghousingintendedlandlawlegalnonprofitownershippersonprivatepropertypublic
SHARED TOKENS (26): "acquisition", "business", "commercial", "different", "entity", "estate", "general", "government", "growing", "housing", "intended", "land", "law", "legal", "nonprofit", "ownership", "person", "private", "property", "public".... | EXACT TITLE in land_use_planning: "Real estate". | EXACT TITLE in mortgage_lending: "Real estate".
0.500
actactionsactivityagencybanksbureauconsumerdatadebtenforcementestablishedexistencefederalfeesfinancialforeclosurefundedfundinggovernmentindependent
SHARED TOKENS (40): "act", "actions", "activity", "agency", "banks", "bureau", "consumer", "data", "debt", "enforcement", "established", "existence", "federal", "fees", "financial", "foreclosure", "funded", "funding", "government", "independent".... | EXACT TITLE in mortgage_lending: "Consumer Financial Protection Bureau".
0.500
businesscreatedocumentdocumentseventsfinancialfunctionsgeneralincomeindividualinformationoccuroperationsorganizationpersonprocessrealrecordrecordedrecords
SHARED TOKENS (26): "business", "create", "document", "documents", "events", "financial", "functions", "general", "income", "individual", "information", "occur", "operations", "organization", "person", "process", "real", "record", "recorded", "records".... | EXACT TITLE in mortgage_lending: "Bookkeeping".
0.500
Wetland ↗ Q170321 EXACT TITLE
actamongbuildingchangecontroldifferentdistinctenvironmentalfloodformfunctionfunctionsinfrastructureprocessprocessesprotectprotectionprovidepublicquality
SHARED TOKENS (29): "act", "among", "building", "change", "control", "different", "distinct", "environmental", "flood", "form", "function", "functions", "infrastructure", "process", "processes", "protect", "protection", "provide", "public", "quality".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
Lien ↗ Q4469383 EXACT TITLE
applicationdebtformformsgenerallyinterestslienliensmeaningobligationownerpaymentperformancepersonpropertyspecifictypes
SHARED TOKENS (17): "application", "debt", "form", "forms", "generally", "interests", "lien", "liens", "meaning", "obligation", "owner", "payment", "performance", "person", "property", "specific", "types". | EXACT TITLE in land_use_planning: "Lien". | EXACT TITLE in mortgage_lending: "Lien".
0.500
additionalassetsdiscoveryfeefinancefinancialfutureindicatesinstrumentinvestorslatermarketmarketsmechanismobligationotherwiseparticularpaymentphysicalposition
SHARED TOKENS (31): "additional", "assets", "discovery", "fee", "finance", "financial", "future", "indicates", "instrument", "investors", "later", "market", "markets", "mechanism", "obligation", "otherwise", "particular", "payment", "physical", "position".... | EXACT TITLE in land_use_planning: "Short (finance)". | EXACT TITLE in mortgage_lending: "Short (finance)".
0.500
Freddie Mac ↗ Q935969 EXACT TITLE
actionagencyamericanassetsassociationdebtdepartmentdollarfederalfinancefinancialgovernmentheadquarteredhomehousinginvestmentinvestorsjunemakingmanagement
SHARED TOKENS (27): "action", "agency", "american", "assets", "association", "debt", "department", "dollar", "federal", "finance", "financial", "government", "headquartered", "home", "housing", "investment", "investors", "june", "making", "management".... | EXACT TITLE in mortgage_lending: "Freddie Mac".
0.500
applicationsassociatedbasebeyonddatadescriptionsdevelopmenteventsgraphknowledgelearningmodelnetworksrelationshipsrepresentrepresentationresearchsearchsystemsunderlying
SHARED TOKENS (21): "applications", "associated", "base", "beyond", "data", "descriptions", "development", "events", "graph", "knowledge", "learning", "model", "networks", "relationships", "represent", "representation", "research", "search", "systems", "underlying".... | EXACT TITLE in land_use_planning: "Knowledge graph". | EXACT TITLE in mortgage_lending: "Knowledge graph".
0.500
actagenciesagencyagriculturalagricultureassistancebroaderchangeddepartmentfocusimproveinvestmentlocalprivateprogramsprojectprotectqualityresourcesrural
SHARED TOKENS (23): "act", "agencies", "agency", "agricultural", "agriculture", "assistance", "broader", "changed", "department", "focus", "improve", "investment", "local", "private", "programs", "project", "protect", "quality", "resources", "rural".... | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
agencyappliedbuildingcommercialcompletedconstructiondevelopmentfunctionsinstitutionalintegratedmixed-useneighborhoodplanningpolicyprivateresidentialsinglesitestrategyurban
SHARED TOKENS (22): "agency", "applied", "building", "commercial", "completed", "construction", "development", "functions", "institutional", "integrated", "mixed-use", "neighborhood", "planning", "policy", "private", "residential", "single", "site", "strategy", "urban".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
commercialcommunitiesdevelopmenthousingindependentlyindustriallandlargeotherwiseparksretailsinglesmallersubdivisionsubdivisions
SHARED TOKENS (15): "commercial", "communities", "development", "housing", "independently", "industrial", "land", "large", "otherwise", "parks", "retail", "single", "smaller", "subdivision", "subdivisions". | EXACT TITLE in land_use_planning: "Subdivision (land)". | EXACT TITLE in mortgage_lending: "Subdivision (land)".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariesconstructiondefinitiondevelopmentestablishfeaturesformsgovernmenthistorylandlawlegalownershipplanningprofessionalpropertypurposesrecordedrequired
SHARED TOKENS (23): "analysis", "boundaries", "construction", "definition", "development", "establish", "features", "forms", "government", "history", "land", "law", "legal", "ownership", "planning", "professional", "property", "purposes", "recorded", "required".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinesscapitalcommercialdemanddevelopeddirectlyestateeventfeaturesfinancialforeclosureformfundedhomeinvestmentinvestorslawlegallien
SHARED TOKENS (34): "building", "business", "capital", "commercial", "demand", "developed", "directly", "estate", "event", "features", "financial", "foreclosure", "form", "funded", "home", "investment", "investors", "law", "legal", "lien".... | EXACT TITLE in mortgage_lending: "Mortgage".
0.500
adabaseboisecentercombinedcommercialdepartmentfieldfunctionsgeneralidahoincreasenationaloperatedoperatespermissionprotectionrequiringrightssouth
SHARED TOKENS (23): "ada", "base", "boise", "center", "combined", "commercial", "department", "field", "functions", "general", "idaho", "increase", "national", "operated", "operates", "permission", "protection", "requiring", "rights", "south".... | EXACT TITLE in land_use_planning: "Boise Airport".
0.500
activitiesadministrationanalysisanotherarchitecturebroaderbusinesscapitalcodescommunitiescommunityconsiderationscreatingdevelopmentdifferentdistributionenvironmentalfieldfocusgeography
SHARED TOKENS (60): "activities", "administration", "analysis", "another", "architecture", "broader", "business", "capital", "codes", "communities", "community", "considerations", "creating", "development", "different", "distribution", "environmental", "field", "focus", "geography".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
Annexation ↗ EXACT TITLE
acquisitionactactionsanothercontrolcurrentdescribesdescribingdistinctgenerallylawlegalphysicalterritorytitle
SHARED TOKENS (15): "acquisition", "act", "actions", "another", "control", "current", "describes", "describing", "distinct", "generally", "law", "legal", "physical", "territory", "title". | EXACT TITLE in land_use_planning: "Annexation".
0.500
activitiesadditionalagenciesanotherbanksbusinesscapitalcommercialconsumerdirectlydiscoveryeligibleentityfederalfederallyfeefeesframeworkfundedgenerally
SHARED TOKENS (44): "activities", "additional", "agencies", "another", "banks", "business", "capital", "commercial", "consumer", "directly", "discovery", "eligible", "entity", "federal", "federally", "fee", "fees", "framework", "funded", "generally".... | EXACT TITLE in mortgage_lending: "Mortgage bank".
0.500
actcodifiedconnectedconnectionconsumerdwellingfederalfeeslawlimitsmakingplansprincipalproceduresratesregulatesregulationrequirementsrequiringstandardized
SHARED TOKENS (20): "act", "codified", "connected", "connection", "consumer", "dwelling", "federal", "fees", "law", "limits", "making", "plans", "principal", "procedures", "rates", "regulates", "regulation", "requirements", "requiring", "standardized". | EXACT TITLE in mortgage_lending: "Truth in Lending Act".
0.500
actactionactionsagenciesagencyapplyauthoritycourtsdecisionsdefinitionenvironmentalestablishedevaluatefederalfinalgovernmentimpactlawmodelednational
SHARED TOKENS (29): "act", "action", "actions", "agencies", "agency", "apply", "authority", "courts", "decisions", "definition", "environmental", "established", "evaluate", "federal", "final", "government", "impact", "law", "modeled", "national".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
actaddressaddressingagencyamendmentsassistancechangescodifiedcontroldirectlyengineersenvironmentalfederalformfundinggoverninglawmaintainmodernphysical
SHARED TOKENS (29): "act", "address", "addressing", "agency", "amendments", "assistance", "changes", "codified", "control", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "law", "maintain", "modern", "physical".... | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
appliedapplyapprovedauthoritybuildingcodecodescomplianceconstructioncontroldepartmentsdistrictengineersenvironmentalestategeneralgenerallyinsuranceintendedjurisdiction
SHARED TOKENS (44): "applied", "apply", "approved", "authority", "building", "code", "codes", "compliance", "construction", "control", "departments", "district", "engineers", "environmental", "estate", "general", "generally", "insurance", "intended", "jurisdiction".... | EXACT TITLE in land_use_planning: "Building code".
0.500
actadministrationagainstagencyalternativeassistanceclaimscommunitiescommunityconstructioncontrolcostscreatingdebtdevelopmenteffectiveemergencyenforcementfederalflood
SHARED TOKENS (45): "act", "administration", "against", "agency", "alternative", "assistance", "claims", "communities", "community", "construction", "control", "costs", "creating", "debt", "development", "effective", "emergency", "enforcement", "federal", "flood".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomedepartmentdescriptionsgeneralgoverningindividualinformationlandlegallegallylocalofficeplanningplatspublicratherreviewscalesubdivision
SHARED TOKENS (25): "another", "become", "department", "descriptions", "general", "governing", "individual", "information", "land", "legal", "legally", "local", "office", "planning", "plats", "public", "rather", "review", "scale", "subdivision".... | EXACT TITLE in land_use_planning: "Plat". | EXACT TITLE in mortgage_lending: "Plat".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangescollectionconditionsconsolidationcontroldevelopeddirectlydistributionenvironmentalfieldformgrowthimprovementsirrigationland
SHARED TOKENS (45): "agricultural", "agriculture", "application", "applies", "central", "changes", "collection", "conditions", "consolidation", "control", "developed", "directly", "distribution", "environmental", "field", "form", "growth", "improvements", "irrigation", "land".... | EXACT TITLE in land_use_planning: "Irrigation". | EXACT TITLE in mortgage_lending: "Irrigation".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingcontrolcreatecurrentfeaturesfloodgenerallyincreaseirrigationmanagementmodernneededpressurerequiringresourcessourcesourcessupplyvalleywater
SHARED TOKENS (20): "building", "control", "create", "current", "features", "flood", "generally", "increase", "irrigation", "management", "modern", "needed", "pressure", "requiring", "resources", "source", "sources", "supply", "valley", "water". | EXACT TITLE in land_use_planning: "Canal".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisboundariesbuildingcodesconditionsconsiderationsconstructioncontractorcountiescreatingdependentdevelopmentengineersfacilitiesfeatureshistoricalimprovementsinfrastructurelandlandscape
SHARED TOKENS (43): "analysis", "boundaries", "building", "codes", "conditions", "considerations", "construction", "contractor", "counties", "creating", "dependent", "development", "engineers", "facilities", "features", "historical", "improvements", "infrastructure", "land", "landscape".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
agenciesconstructiondepartmentsdistinguishgovernmentinfrastructurelocallymunicipalnationalphysicalprivateprofessionalpublicroadssystemsworks
SHARED TOKENS (16): "agencies", "construction", "departments", "distinguish", "government", "infrastructure", "locally", "municipal", "national", "physical", "private", "professional", "public", "roads", "systems", "works". | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdefinitionsdifferentequivalentformfullyindividualmeaningnetworksoperatesoperatingoperationsrapidsystemsystemstechnologytogetherunits
SHARED TOKENS (22): "broader", "capacity", "conditions", "definitions", "different", "equivalent", "form", "fully", "individual", "meaning", "networks", "operates", "operating", "operations", "rapid", "system", "systems", "technology", "together", "units".... | EXACT TITLE in land_use_planning: "Light rail".
0.500
Credit risk ↗ Q162714 EXACT TITLE
againstanotherassetsassociatedbusinesscollectioncompleteconsumercostsdebtfinancialgeneralgovernmentinsurancelendersmarketobligationobligationspaymentpolicy
SHARED TOKENS (26): "against", "another", "assets", "associated", "business", "collection", "complete", "consumer", "costs", "debt", "financial", "general", "government", "insurance", "lenders", "market", "obligation", "obligations", "payment", "policy".... | EXACT TITLE in mortgage_lending: "Credit risk".
0.500
academicsaccessadditionalallowapprovedbureauclaimsconsumerestatefinancialforeclosuregenerallyhomehomesincomeindependentinsurancelegalmaintainmarket
SHARED TOKENS (34): "academics", "access", "additional", "allow", "approved", "bureau", "claims", "consumer", "estate", "financial", "foreclosure", "generally", "home", "homes", "income", "independent", "insurance", "legal", "maintain", "market".... | EXACT TITLE in mortgage_lending: "Reverse mortgage".
0.500
activitiescommunitycurrentdeterminesdevelopmentdocumentestablishinggeneralgrowthhousingindividualinstrumentslandlargelong-termneighborhoodparcelplanningplanspolicy
SHARED TOKENS (29): "activities", "community", "current", "determines", "development", "document", "establishing", "general", "growth", "housing", "individual", "instruments", "land", "large", "long-term", "neighborhood", "parcel", "planning", "plans", "policy".... | EXACT TITLE in land_use_planning: "Comprehensive planning".
0.500
agenciesalternativesapplyevaluationfacilitiesfuturegenerallygovernmentinfluencelinesmoveplanningprivateprocesspublicsystem
SHARED TOKENS (16): "agencies", "alternatives", "apply", "evaluation", "facilities", "future", "generally", "government", "influence", "lines", "move", "planning", "private", "process", "public", "system". | EXACT TITLE in land_use_planning: "Transportation planning".
0.500
Reddit ↗ Q1136 EXACT TITLE
acquiredamericanamongcommunitiescreatecurrentdatafeaturesindependentjoinedjunelinksmarketmedianewsoperatedpageplatformpublicationsrole
SHARED TOKENS (24): "acquired", "american", "among", "communities", "create", "current", "data", "features", "independent", "joined", "june", "links", "market", "media", "news", "operated", "page", "platform", "publications", "role".... | EXACT TITLE in mortgage_lending: "Reddit".
0.480
americanboisebrandconsumerdatademandidahomarketmemoryproductssemiconductorsouthtechnologytogether
SHARED TOKENS (14): "american", "boise", "brand", "consumer", "data", "demand", "idaho", "market", "memory", "products", "semiconductor", "south", "technology", "together". | EXACT TITLE in land_use_planning: "Micron Technology".
0.480
alongsidebasecapitalcentraldebtdetermineeventfederalfinancingfutureinvestmentpolicyprincipalrates
SHARED TOKENS (14): "alongside", "base", "capital", "central", "debt", "determine", "event", "federal", "financing", "future", "investment", "policy", "principal", "rates". | EXACT TITLE in mortgage_lending: "Interest rate".
0.480
analysisanalystsanalyzebureaucorporatefinancialmanagementmeanorganizationpersonpositionpotentialriskrole
SHARED TOKENS (14): "analysis", "analysts", "analyze", "bureau", "corporate", "financial", "management", "mean", "organization", "person", "position", "potential", "risk", "role". | EXACT TITLE in mortgage_lending: "Credit analyst".
0.480
Fannie Mae ↗ Q621096 EXACT TITLE
additionalassetsassociationestablishedfederalfinancialhomelenderslocalmakingmarketnationalorganizationprocess
SHARED TOKENS (14): "additional", "assets", "association", "established", "federal", "financial", "home", "lenders", "local", "making", "market", "national", "organization", "process". | EXACT TITLE in mortgage_lending: "Fannie Mae".
0.460
baseboiseconstructedhomeidahooperationspersonnelpopulationprovidesouthwestsupporttrainingwestern
SHARED TOKENS (13): "base", "boise", "constructed", "home", "idaho", "operations", "personnel", "population", "provide", "southwest", "support", "training", "western". | EXACT TITLE in mortgage_lending: "Mountain Home Air Force Base".
0.460
acquisitionanalysisassetscompletionlawprincipalprocessprohibitedpropertysystemtaxvaluezoning
SHARED TOKENS (13): "acquisition", "analysis", "assets", "completion", "law", "principal", "process", "prohibited", "property", "system", "tax", "value", "zoning". | EXACT TITLE in mortgage_lending: "Amortization".
0.460
Floodplain ↗ Q193110 EXACT TITLE
agriculturalbanksbasecontroldevelopedexperiencefloodheavilylandriskurbanvalleywater
SHARED TOKENS (13): "agricultural", "banks", "base", "control", "developed", "experience", "flood", "heavily", "land", "risk", "urban", "valley", "water". | EXACT TITLE in land_use_planning: "Floodplain".
0.440
Escrow ↗ Q338451 EXACT TITLE
completedconditionsdependentestablishedinsurancemeaningobligationspersonprincipalpropertytransactiontrust
SHARED TOKENS (12): "completed", "conditions", "dependent", "established", "insurance", "meaning", "obligations", "person", "principal", "property", "transaction", "trust". | EXACT TITLE in mortgage_lending: "Escrow".
0.440
codedefinitiondwellingfederalhomehomeshousinglawregulatedregulationstypesunits
SHARED TOKENS (12): "code", "definition", "dwelling", "federal", "home", "homes", "housing", "law", "regulated", "regulations", "types", "units". | EXACT TITLE in mortgage_lending: "Manufactured housing".
0.440
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommunitydefinitionindustrialmunicipalprocessessewerwater
SHARED TOKENS (12): "activities", "agricultural", "another", "applications", "commercial", "community", "definition", "industrial", "municipal", "processes", "sewer", "water". | EXACT TITLE in land_use_planning: "Wastewater".
0.440
actualagainsteventsfloodformshomeinsurancepolicypropertyprotectionrequirespecialized
SHARED TOKENS (12): "actual", "against", "events", "flood", "forms", "home", "insurance", "policy", "property", "protection", "require", "specialized". | EXACT TITLE in mortgage_lending: "Property insurance".
0.420
agencydepartmentfederalfundingfutureidahoinfrastructureoperationsorganizationplanningprograms
SHARED TOKENS (11): "agency", "department", "federal", "funding", "future", "idaho", "infrastructure", "operations", "organization", "planning", "programs". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.420
applicablefederallawprivateprocesspropertyprovideregulationsregulatoryrightsvalue
SHARED TOKENS (11): "applicable", "federal", "law", "private", "process", "property", "provide", "regulations", "regulatory", "rights", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.420
actionsauthoritycomparativecourtsgovernmentjudicialpowersprocedureprocessreviewstatute
SHARED TOKENS (11): "actions", "authority", "comparative", "courts", "government", "judicial", "powers", "procedure", "process", "review", "statute". | EXACT TITLE in land_use_planning: "Judicial review".
0.420
appliesbuildingcodedevelopmentlandmunicipalregulationsrulessetstandardszoning
SHARED TOKENS (11): "applies", "building", "code", "development", "land", "municipal", "regulations", "rules", "set", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.400
applicationsapprovalbankscommercialevaluatefinancialinstitutionslicensedofficersrelated
SHARED TOKENS (10): "applications", "approval", "banks", "commercial", "evaluate", "financial", "institutions", "licensed", "officers", "related". | EXACT TITLE in mortgage_lending: "Loan officer".
0.400
agenciesdevelopmentdivisionenvironmentalfederalofficeofficespolicyqualityworks
SHARED TOKENS (10): "agencies", "development", "division", "environmental", "federal", "office", "offices", "policy", "quality", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.400
divisionfinancialfirmforeclosuremodificationprocessreducesaleshortworks
SHARED TOKENS (10): "division", "financial", "firm", "foreclosure", "modification", "process", "reduce", "sale", "short", "works". | EXACT TITLE in mortgage_lending: "Loss mitigation".
0.380
againstcoveragedeterminefloodinsurancepropertiespropertyriskspecific
SHARED TOKENS (9): "against", "coverage", "determine", "flood", "insurance", "properties", "property", "risk", "specific". | EXACT TITLE in land_use_planning: "Flood insurance".
0.360
Trust deed ↗ Q7848150 EXACT TITLE
estategeneralinstrumentlawlegalrealsystemstrust
SHARED TOKENS (8): "estate", "general", "instrument", "law", "legal", "real", "systems", "trust". | EXACT TITLE in mortgage_lending: "Trust deed".
0.360
Zillow ↗ Q8071921 EXACT TITLE
americancomcurrentestategrouprealreal-estatetechnology
SHARED TOKENS (8): "american", "com", "current", "estate", "group", "real", "real-estate", "technology". | EXACT TITLE in mortgage_lending: "Zillow".
0.360
Drainage ↗ Q7481320 EXACT TITLE
agriculturalconditionsgrowthimprovelandproductionsupplieswater
SHARED TOKENS (8): "agricultural", "conditions", "growth", "improve", "land", "production", "supplies", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.360
anotherconditionsdocumentfinancialinstrumentlegalpaymentspecified
SHARED TOKENS (8): "another", "conditions", "document", "financial", "instrument", "legal", "payment", "specified". | EXACT TITLE in mortgage_lending: "Promissory note".
0.340
costsestatefeespropertyrealtitletransaction
SHARED TOKENS (7): "costs", "estate", "fees", "property", "real", "title", "transaction". | EXACT TITLE in mortgage_lending: "Closing costs".
0.340
applicableauthorizesdistrictlandpermituseszoning
SHARED TOKENS (7): "applicable", "authorizes", "district", "land", "permit", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.320
Bankruptcy ↗ Q152074 EXACT TITLE
cannotlegalmeaningpersonprocessstatus
SHARED TOKENS (6): "cannot", "legal", "meaning", "person", "process", "status". | EXACT TITLE in mortgage_lending: "Bankruptcy".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycompleteconsiderationscostsdevelopmentemploymentfocusgovernmentgrowthhousinglandmixed-useneighborhoodplanningpreservepublicregionalresourcesschoolsurban
SHARED TOKENS (21): "community", "complete", "considerations", "costs", "development", "employment", "focus", "government", "growth", "housing", "land", "mixed-use", "neighborhood", "planning", "preserve", "public", "regional", "resources", "schools", "urban"....
0.300
administrationaffectaffectingaloneamongassociationbanksbuildersdebtestateevenfederalforeclosuregovernmenthistoryhomehousingimpactindexinstitutional
SHARED TOKENS (39): "administration", "affect", "affecting", "alone", "among", "association", "banks", "builders", "debt", "estate", "even", "federal", "foreclosure", "government", "history", "home", "housing", "impact", "index", "institutional"....
0.300
againstcommunitydirectdistrictestatefinancialgeographicidentifiedprojectpublicratherrealspecialspecifictax
SHARED TOKENS (15): "against", "community", "direct", "district", "estate", "financial", "geographic", "identified", "project", "public", "rather", "real", "special", "specific", "tax".
0.300
americanassetscommercialentityestateinvestmentlawpropertyprotectprotectionprovisionsratherrealresidentialriskstructuretaxtrusttypesunderlying
SHARED TOKENS (20): "american", "assets", "commercial", "entity", "estate", "investment", "law", "property", "protect", "protection", "provisions", "rather", "real", "residential", "risk", "structure", "tax", "trust", "types", "underlying".
0.300
agreementsamongassociatedbanksbecomechangedcommercialdebtdifferentestatefinancialfundinggeneralgenerallyindividualinstrumentinvestmentinvestorslargelenders
SHARED TOKENS (40): "agreements", "among", "associated", "banks", "become", "changed", "commercial", "debt", "different", "estate", "financial", "funding", "general", "generally", "individual", "instrument", "investment", "investors", "large", "lenders"....
0.300
amongbasechangechangedchangesdirectdistinctfederalformsfundinggenerallygovernmentimpliesindexlegallylendersmarketmarketsoutsidepayment
SHARED TOKENS (31): "among", "base", "change", "changed", "changes", "direct", "distinct", "federal", "forms", "funding", "generally", "government", "implies", "index", "legally", "lenders", "market", "markets", "outside", "payment"....
0.300
accessactadministrationaffordableagainstagencycommunitiesconstructiondepartmentdevelopmentdifferentfacilitiesfederalfinancegovernmenthousinginsurancelendersmarketnational
SHARED TOKENS (31): "access", "act", "administration", "affordable", "against", "agency", "communities", "construction", "department", "development", "different", "facilities", "federal", "finance", "government", "housing", "insurance", "lenders", "market", "national"....
0.300
accessadditionalapplicationassetsassociatedconventionalcostsestateevaluationeventfeeforeclosuregeneralhomelienlienslinespermitpositionprocessing
SHARED TOKENS (35): "access", "additional", "application", "assets", "associated", "conventional", "costs", "estate", "evaluation", "event", "fee", "foreclosure", "general", "home", "lien", "liens", "lines", "permit", "position", "processing"....
0.300
actagenciesauthoritycodedependdevelopmentdifferentdirectsfederalgrowthlawnationalneededprotectprovisionspurposesregulationsrequiresrulesserves
SHARED TOKENS (22): "act", "agencies", "authority", "code", "depend", "development", "different", "directs", "federal", "growth", "law", "national", "needed", "protect", "provisions", "purposes", "regulations", "requires", "rules", "serves"....
0.300
actagenciesagencybanksbureaudepartmentestablishedfederalfederallyindependentinstitutionslicensednationalofficeregulatoryserves
SHARED TOKENS (16): "act", "agencies", "agency", "banks", "bureau", "department", "established", "federal", "federally", "independent", "institutions", "licensed", "national", "office", "regulatory", "serves".
0.300
agenciesbanksconventionalfeesindividuallargelargerlenderslimitlimitsqualityratesresidentialsetthemvalue
SHARED TOKENS (16): "agencies", "banks", "conventional", "fees", "individual", "large", "larger", "lenders", "limit", "limits", "quality", "rates", "residential", "set", "them", "value".
0.300
accessactapplicablebroaderdatadevelopmentestablishformgeneralgovernmentinformationinstitutionslegalmakingpolicypracticeprivateprotectionprovisionspublic
SHARED TOKENS (27): "access", "act", "applicable", "broader", "data", "development", "establish", "form", "general", "government", "information", "institutions", "legal", "making", "policy", "practice", "private", "protection", "provisions", "public"....
0.300
buildingbusinesscentercentraldevelopmentformgrowthincreaseintegratedlandmixed-usenetworkplanningprivatepublicresidentialscaleservingsmallerurban
SHARED TOKENS (20): "building", "business", "center", "central", "development", "form", "growth", "increase", "integrated", "land", "mixed-use", "network", "planning", "private", "public", "residential", "scale", "serving", "smaller", "urban".
0.300
actionsanotherbecomechaincombineconsolidationdifferentdirectlyfinalfirmintegratedlargemakingmanagementmarketmemberneededownershippositionproduce
SHARED TOKENS (25): "actions", "another", "become", "chain", "combine", "consolidation", "different", "directly", "final", "firm", "integrated", "large", "making", "management", "market", "member", "needed", "ownership", "position", "produce"....
0.300
activitiesactivityadministrationagenciesanotherchangescontrolcoordinatecourtsdecisionsdivisioneducationenforcementenvironmentalgenerallygoverninggovernmentincreaseinfluenceitself
SHARED TOKENS (33): "activities", "activity", "administration", "agencies", "another", "changes", "control", "coordinate", "courts", "decisions", "division", "education", "enforcement", "environmental", "generally", "governing", "government", "increase", "influence", "itself"....
0.300
Federal Reserve ↗ Q53536 KW CROSS HIGH
actactionsactivityamongannualapprovedapproximatelybankscapitalcentralcommercialcontroldecisionsdepartmentemploymententityestablishedeventsexpansionfederal
SHARED TOKENS (47): "act", "actions", "activity", "among", "annual", "approved", "approximately", "banks", "capital", "central", "commercial", "control", "decisions", "department", "employment", "entity", "established", "events", "expansion", "federal"....
0.300
activitiesadministrationcommercialdepartmentestatefederalfeefeesfirmgenerallygovernmenthousingincomeinstrumentsinsuranceinvestorsprincipalprivateprocessreal
SHARED TOKENS (29): "activities", "administration", "commercial", "department", "estate", "federal", "fee", "fees", "firm", "generally", "government", "housing", "income", "instruments", "insurance", "investors", "principal", "private", "process", "real"....
0.300
actionamongboundariescontroldistinctexpandinggovernmentimpliesjurisdictionlawlocalmunicipalprocessresponseterritoryurbanwork
SHARED TOKENS (17): "action", "among", "boundaries", "control", "distinct", "expanding", "government", "implies", "jurisdiction", "law", "local", "municipal", "process", "response", "territory", "urban", "work".
0.300
actactionsaffordableamericanassetsbankscapitalcentralcombinedcommercialconsumercreatedemanddepartmentdevelopmentemergencyestateestimatesfebruaryfederal
SHARED TOKENS (62): "act", "actions", "affordable", "american", "assets", "banks", "capital", "central", "combined", "commercial", "consumer", "create", "demand", "department", "development", "emergency", "estate", "estimates", "february", "federal"....
0.300
actadministrationagainstagenciesassetsauthoritybanksbureaubusinesschangescollectioncomplianceconsumercostsdataestablishedfederalfinancialgrowthinstitutions
SHARED TOKENS (35): "act", "administration", "against", "agencies", "assets", "authority", "banks", "bureau", "business", "changes", "collection", "compliance", "consumer", "costs", "data", "established", "federal", "financial", "growth", "institutions"....
0.300
centraldebtestatefuturehousinglocalmarketmarketsnationalpolicypropertypublicrapidrealregionalrisk
SHARED TOKENS (16): "central", "debt", "estate", "future", "housing", "local", "market", "markets", "national", "policy", "property", "public", "rapid", "real", "regional", "risk".
0.300
allowbroaderdocumentationfinancialfundedfundinginstitutionslargelenderslimitprivatepropertyreal-estaterequirestatus
SHARED TOKENS (15): "allow", "broader", "documentation", "financial", "funded", "funding", "institutions", "large", "lenders", "limit", "private", "property", "real-estate", "require", "status".
0.300
accessanotherapplicationapprovedassociatedcapitalchangesdevelopmentdifferentdirectformformsgeographichomehouseholdimproveindividuallargelegalmove
SHARED TOKENS (26): "access", "another", "application", "approved", "associated", "capital", "changes", "development", "different", "direct", "form", "forms", "geographic", "home", "household", "improve", "individual", "large", "legal", "move"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritydifferentestategovernmentlandlegallineslocalmeanotherwiseownerownershippathphysicalprivaterealrightsroadroadsspecific
SHARED TOKENS (24): "authority", "different", "estate", "government", "land", "legal", "lines", "local", "mean", "otherwise", "owner", "ownership", "path", "physical", "private", "real", "rights", "road", "roads", "specific"....
0.300
againstconditionconsumerdebtdirectlyeducationfinancialforeclosuregenerallyhomeimprovementsinvestmentitselflendersmaintainproductspropertyratesrequirerequirements
SHARED TOKENS (22): "against", "condition", "consumer", "debt", "directly", "education", "financial", "foreclosure", "generally", "home", "improvements", "investment", "itself", "lenders", "maintain", "products", "property", "rates", "require", "requirements"....
0.300
actualagriculturalcommunitycreatedevelopmentdistrictsenvironmentalgrowthinterestslandlandscapemanagementoverlaysplanningpreserveprivateresourcesruralseturban
SHARED TOKENS (22): "actual", "agricultural", "community", "create", "development", "districts", "environmental", "growth", "interests", "land", "landscape", "management", "overlays", "planning", "preserve", "private", "resources", "rural", "set", "urban"....
0.300
actagenciesbureaucollectionconsumerdatafederalfinancialinformationintendedprivateprotectionregulatesreportingreportstrade
SHARED TOKENS (16): "act", "agencies", "bureau", "collection", "consumer", "data", "federal", "financial", "information", "intended", "private", "protection", "regulates", "reporting", "reports", "trade".
0.300
activitiesauthoritybehaviorcapacityconductdeterminesenforcementfederalgeneralgovernmentindividualjurisdictionlawlegalphysicalpowerspublicpurposesregulationsrelated
SHARED TOKENS (24): "activities", "authority", "behavior", "capacity", "conduct", "determines", "enforcement", "federal", "general", "government", "individual", "jurisdiction", "law", "legal", "physical", "powers", "public", "purposes", "regulations", "related"....
0.300
affordabilityaffordableallowamonganothercodecommunitiesconstructedcontrolcontrolscreatedensitydevelopmentfeesfinancialfunctionshouseholdshousingimpactincome
SHARED TOKENS (43): "affordability", "affordable", "allow", "among", "another", "code", "communities", "constructed", "control", "controls", "create", "density", "development", "fees", "financial", "functions", "households", "housing", "impact", "income"....
0.300
applicationapprovalchapterclaimscodeconsolidationcourtsdebtfinancialformgeneralgoverningincomeindividualliensmodificationopportunitypersonplansplatform
SHARED TOKENS (30): "application", "approval", "chapter", "claims", "code", "consolidation", "courts", "debt", "financial", "form", "general", "governing", "income", "individual", "liens", "modification", "opportunity", "person", "plans", "platform"....
0.300
activityamongapproximatelyassociationboisebureaucanyoncapacitycentercompletedcontainscountiescreatesdirectlyeastedgefebruaryfederalformationidaho
SHARED TOKENS (34): "activity", "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "center", "completed", "contains", "counties", "creates", "directly", "east", "edge", "february", "federal", "formation", "idaho"....
0.300
affectagenciesboundarycommunitiescreatingdistributionenvironmentalfeaturesfunctionslandmanagementplanningplansprocessprogramsqualityresourcesrightsspecialistsstudy
SHARED TOKENS (22): "affect", "agencies", "boundary", "communities", "creating", "distribution", "environmental", "features", "functions", "land", "management", "planning", "plans", "process", "programs", "quality", "resources", "rights", "specialists", "study"....
0.300
americanapplicationappliesdifferentfinancialfullygenerallyhomemarketmarketsnetworkofficersplanningpolicyprocessprocessesresearchriskspecializedspecific
SHARED TOKENS (21): "american", "application", "applies", "different", "financial", "fully", "generally", "home", "market", "markets", "network", "officers", "planning", "policy", "process", "processes", "research", "risk", "specialized", "specific"....
0.300
accessadministrationaffectsagencybuildingbusinesscoordinatedepartmentdevelopmentemergencyfederalfundinggovernmenthousinginfrastructurelocalmanagementpersonnelpropertyprovide
SHARED TOKENS (25): "access", "administration", "affects", "agency", "building", "business", "coordinate", "department", "development", "emergency", "federal", "funding", "government", "housing", "infrastructure", "local", "management", "personnel", "property", "provide"....
0.300
actionactualappliedappliesapprovalassociationcommitmentscontextdecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactjudicialmakingmanagementmove
SHARED TOKENS (34): "action", "actual", "applied", "applies", "approval", "association", "commitments", "context", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "judicial", "making", "management", "move"....
0.300
actagainstagencyamericanbankscapitalcommercialconditionsconsumercoveragedebtduesfederalfinancialfinancingfunctionsfundinggovernmentinstitutionsinsurance
SHARED TOKENS (35): "act", "against", "agency", "american", "banks", "capital", "commercial", "conditions", "consumer", "coverage", "debt", "dues", "federal", "financial", "financing", "functions", "funding", "government", "institutions", "insurance"....
0.300
actagainstagencyamongauthoritybankscommercialfederalfinancialfirmformgroupinsuranceinvestmentlargelaterlawmarketmemberpdf
SHARED TOKENS (23): "act", "against", "agency", "among", "authority", "banks", "commercial", "federal", "financial", "firm", "form", "group", "insurance", "investment", "large", "later", "law", "market", "member", "pdf"....
0.300
americanbuildingcodescommercialdevelopeddevelopmentdistrictenvironmentalhousingindustriallandmixed-useparksplanningplansprocessresidentialrightssitespecial
SHARED TOKENS (26): "american", "building", "codes", "commercial", "developed", "development", "district", "environmental", "housing", "industrial", "land", "mixed-use", "parks", "planning", "plans", "process", "residential", "rights", "site", "special"....
0.300
agencyanotherassetsbankscollectioncommercialdebtdifferentestategenerallygovernmentgroupinstrumentinvestmentinvestorsmarketobligationsofficepaymentprincipal
SHARED TOKENS (40): "agency", "another", "assets", "banks", "collection", "commercial", "debt", "different", "estate", "generally", "government", "group", "instrument", "investment", "investors", "market", "obligations", "office", "payment", "principal"....
0.300
conditionestablishestateformhomelandlivingmarketprocesspropertyrealreportreportsrolesalevalue
SHARED TOKENS (16): "condition", "establish", "estate", "form", "home", "land", "living", "market", "process", "property", "real", "report", "reports", "role", "sale", "value".
0.300
agencyapproveddepartmenteducationenforcementengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmentindependentinformationlegallocalnationalofficesoperation
SHARED TOKENS (29): "agency", "approved", "department", "education", "enforcement", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "independent", "information", "legal", "local", "national", "offices", "operation"....
0.300
againstapplycommercialcurrentdescribingestateexpectedfeaturesfinalfullylargeliensmarketmeanmonthsownerparticularpaymentprincipalproperty
SHARED TOKENS (28): "against", "apply", "commercial", "current", "describing", "estate", "expected", "features", "final", "fully", "large", "liens", "market", "mean", "months", "owner", "particular", "payment", "principal", "property"....
0.300
affectinganalysisapplicationbusinesschangesdemandeconomicsestatefieldfinancehousingmarketspatternsrealrelatedresearchresidentialsupplyurban
SHARED TOKENS (19): "affecting", "analysis", "application", "business", "changes", "demand", "economics", "estate", "field", "finance", "housing", "markets", "patterns", "real", "related", "research", "residential", "supply", "urban".
0.300
actionaffectagriculturalagriculturebankschangecommunitiesconnectconstructioncontrolemphasizesenvironmentalevenfloodinfluenceinterfacelandland-uselandscapelarge
SHARED TOKENS (38): "action", "affect", "agricultural", "agriculture", "banks", "change", "communities", "connect", "construction", "control", "emphasizes", "environmental", "even", "flood", "influence", "interface", "land", "land-use", "landscape", "large"....
0.300
administersaffordableassistancebusinesscommunitiescommunitydevelopmentdistrictforeclosurefundinghousingimpactindependentlearninglocalnationalneighborhoodnetworknonprofitorganization
SHARED TOKENS (30): "administers", "affordable", "assistance", "business", "communities", "community", "development", "district", "foreclosure", "funding", "housing", "impact", "independent", "learning", "local", "national", "neighborhood", "network", "nonprofit", "organization"....
0.300
VA loan ↗ Q7906577 KW CROSS HIGH
additionalallowamericanapplicationapprovedconstructiondepartmentdirectlyeligiblefeefinancedfinancingfundinghomehomesimprovementsincomeinsurancelargerlenders
SHARED TOKENS (33): "additional", "allow", "american", "application", "approved", "construction", "department", "directly", "eligible", "fee", "financed", "financing", "funding", "home", "homes", "improvements", "income", "insurance", "larger", "lenders"....
0.300
analysiscommercialcostsdefinitiondefinitionsdependsdevelopeddevelopmentdifferentincreaseindustriallandpolicypresentpurposesredevelopmentrequirerequiresrisksite
SHARED TOKENS (22): "analysis", "commercial", "costs", "definition", "definitions", "depends", "developed", "development", "different", "increase", "industrial", "land", "policy", "present", "purposes", "redevelopment", "require", "requires", "risk", "site"....
0.300
acquisitionagainstallowcenterclaimsconsumerdependsfeesforeclosureinstitutionslargelawlegalliennationalprincipalproceduresproducepropertypublic
SHARED TOKENS (29): "acquisition", "against", "allow", "center", "claims", "consumer", "depends", "fees", "foreclosure", "institutions", "large", "law", "legal", "lien", "national", "principal", "procedures", "produce", "property", "public"....
0.300
administrationagencyamericanassistancecostsdepartmenteducationeligibleemergencyestablishedfacilitiesfederalfuturegovernmenthealthcarehomeinsurancejunelong-termmember
SHARED TOKENS (23): "administration", "agency", "american", "assistance", "costs", "department", "education", "eligible", "emergency", "established", "facilities", "federal", "future", "government", "healthcare", "home", "insurance", "june", "long-term", "member"....
0.300
affordabilityagainstamongappliedauthoritycitywideconstrainconstructiondistrictdistrictsenvironmentalestimatesgrowinghomelessnesshomeshousingincreasejurisdictionlandlimits
SHARED TOKENS (41): "affordability", "against", "among", "applied", "authority", "citywide", "constrain", "construction", "district", "districts", "environmental", "estimates", "growing", "homelessness", "homes", "housing", "increase", "jurisdiction", "land", "limits"....
0.300
administrationagencyauthoritybanksdepartmentdevelopmentfederalfinancehomehousingindependentinsurancelegalofficepowersregulatesregulatoryroleseparatestructure
SHARED TOKENS (22): "administration", "agency", "authority", "banks", "department", "development", "federal", "finance", "home", "housing", "independent", "insurance", "legal", "office", "powers", "regulates", "regulatory", "role", "separate", "structure"....
0.300
adaboisebureaucompletedconstructioncontroldirectlyeastengineersfederalfloodformsidahoirrigationoperatingoperationalparkprivateutilitywestern
SHARED TOKENS (20): "ada", "boise", "bureau", "completed", "construction", "control", "directly", "east", "engineers", "federal", "flood", "forms", "idaho", "irrigation", "operating", "operational", "park", "private", "utility", "western".
0.300
actamericanapplicableappliescodeconcerningdevelopmentdifferentenforcementfederalfinancingfundinghousinglawmakesmembernationalprivateprogramsprohibited
SHARED TOKENS (27): "act", "american", "applicable", "applies", "code", "concerning", "development", "different", "enforcement", "federal", "financing", "funding", "housing", "law", "makes", "member", "national", "private", "programs", "prohibited"....
0.300
Credit score ↗ Q1787103 KW CROSS HIGH
alternativeanalysisbanksdatadebtdepartmentsdetermineevaluatefinancegovernmentindividualinformationinsurancelenderslimitspersonpotentialreportrepresentrisk
SHARED TOKENS (21): "alternative", "analysis", "banks", "data", "debt", "departments", "determine", "evaluate", "finance", "government", "individual", "information", "insurance", "lenders", "limits", "person", "potential", "report", "represent", "risk"....
0.300
buildingconditionscreatesevengenerallyhazardindicatesmaterialspersonnelphysicalpropertypublicregulationsriskspecificsystemthem
SHARED TOKENS (17): "building", "conditions", "creates", "even", "generally", "hazard", "indicates", "materials", "personnel", "physical", "property", "public", "regulations", "risk", "specific", "system", "them".
0.300
administrationagenciesagencyamericanassetsbankscentralcommercialcommunitydevelopmentfederalfederallygovernmentholdersindependentinstitutionsinsurancenationaloperatesoperating
SHARED TOKENS (22): "administration", "agencies", "agency", "american", "assets", "banks", "central", "commercial", "community", "development", "federal", "federally", "government", "holders", "independent", "institutions", "insurance", "national", "operates", "operating"....
0.300
communitydevelopmentdirectlydistrictfinancingfutureinfrastructureinvestmentprivateprogramprojectpropertypublicredevelopmentrelatedtaxtowardvalue
SHARED TOKENS (18): "community", "development", "directly", "district", "financing", "future", "infrastructure", "investment", "private", "program", "project", "property", "public", "redevelopment", "related", "tax", "toward", "value".
0.300
Financial literacy ↗ KW CROSS HIGH
agenciesallowalternativeauthoritybehaviorcalculationscannotcostsdebtdecisionsdevelopmenteducationestablishedfinancefinancialfocusfuturegovernmentimproveindividual
SHARED TOKENS (33): "agencies", "allow", "alternative", "authority", "behavior", "calculations", "cannot", "costs", "debt", "decisions", "development", "education", "established", "finance", "financial", "focus", "future", "government", "improve", "individual"....
0.300
Home equity loan ↗ KW CROSS HIGH
actualagainstcannotcollegecombinedcreateseducationfinancehistoryhomeincomelawlienlienslimitlinespaymentpersonpropertyrequire
SHARED TOKENS (24): "actual", "against", "cannot", "college", "combined", "creates", "education", "finance", "history", "home", "income", "law", "lien", "liens", "limit", "lines", "payment", "person", "property", "require"....
0.300
alternativeapplicationapproximatelycentralizedcombinedconnectedconstructioncontainscostsdemanddevelopeddifferentengineersevenexpectedfieldhouseholdsindustrialintendedland
SHARED TOKENS (44): "alternative", "application", "approximately", "centralized", "combined", "connected", "construction", "contains", "costs", "demand", "developed", "different", "engineers", "even", "expected", "field", "households", "industrial", "intended", "land"....
0.300
accesscannotcontrolcostsdifferententityfederalformsgovernmentinfrastructurelargelineslocalmaintainsmarketmodernoccuroperatesorganizationproduce
SHARED TOKENS (36): "access", "cannot", "control", "costs", "different", "entity", "federal", "forms", "government", "infrastructure", "large", "lines", "local", "maintains", "market", "modern", "occur", "operates", "organization", "produce"....
0.300
Trailer park ↗ Q1426493 KW CROSS HIGH
americancommunityconstructioncoursehomehomeshousingincomelivingmodernparkparksstatementstatusstructurestechnology
SHARED TOKENS (16): "american", "community", "construction", "course", "home", "homes", "housing", "income", "living", "modern", "park", "parks", "statement", "status", "structures", "technology".
0.300
Bridge loan ↗ Q2079582 KW CROSS HIGH
additionalapplicationsbusinessconventionalcostsdocumentationfeesfinancefinancinggenerallyindividuallargerparticipationrequirerisksouth
SHARED TOKENS (16): "additional", "applications", "business", "conventional", "costs", "documentation", "fees", "finance", "financing", "generally", "individual", "larger", "participation", "require", "risk", "south".
0.300
analysiscapacitycollectioncombinedcostscurrentdatademandemploymentenvironmentalestimateestimatesfinancialfutureimpactinfrastructuremodelplanningpolicypopulation
SHARED TOKENS (25): "analysis", "capacity", "collection", "combined", "costs", "current", "data", "demand", "employment", "environmental", "estimate", "estimates", "financial", "future", "impact", "infrastructure", "model", "planning", "policy", "population"....
0.300
annualappliedbanksconsumerdefinitionseffectivefeefinanceformintendedlegallendersprotectionratherrequiredstandardized
SHARED TOKENS (16): "annual", "applied", "banks", "consumer", "definitions", "effective", "fee", "finance", "form", "intended", "legal", "lenders", "protection", "rather", "required", "standardized".
0.300
Pollution ↗ Q58734 KW CROSS HIGH
agenciesagriculturalagriculturealongsideapproximatelyboundariescommunitiesconstructiondevelopmentenvironmentaleventsformformationformsgenerallyimpactimplieslaterlocalmanagement
SHARED TOKENS (35): "agencies", "agricultural", "agriculture", "alongside", "approximately", "boundaries", "communities", "construction", "development", "environmental", "events", "form", "formation", "forms", "generally", "impact", "implies", "later", "local", "management"....
0.300
actactiveactivitiesagenciesapproximatelyauthoritybuildingbusinesscapacitycombinedconductconstructioncontroldepartmentdirectdirectlyeastengineersenvironmentalestablish
SHARED TOKENS (56): "act", "active", "activities", "agencies", "approximately", "authority", "building", "business", "capacity", "combined", "conduct", "construction", "control", "department", "direct", "directly", "east", "engineers", "environmental", "establish"....
0.300
administrationaffordableagenciesagricultureassociationcostsdepartmentdevelopmenteffectiveevenfederalfederallyfinancialfinancinggovernmenthomehomeshousinginvestorsnational
SHARED TOKENS (30): "administration", "affordable", "agencies", "agriculture", "association", "costs", "department", "development", "effective", "even", "federal", "federally", "financial", "financing", "government", "home", "homes", "housing", "investors", "national"....
0.300
agriculturalagriculturebuildingdevelopeddevelopmententitygeneralgovernmentlandlandscapelimitsoperatoropportunityprivatepropertiespublicratherrelatedruralsite
SHARED TOKENS (21): "agricultural", "agriculture", "building", "developed", "development", "entity", "general", "government", "land", "landscape", "limits", "operator", "opportunity", "private", "properties", "public", "rather", "related", "rural", "site"....
0.300
actagenciesamericanamonganotherapproximatelybroaderchangesdebtdifferentestimateevenfinancedfinancialfullygovernmenthouseholdhouseholdshousingincome
SHARED TOKENS (35): "act", "agencies", "american", "among", "another", "approximately", "broader", "changes", "debt", "different", "estimate", "even", "financed", "financial", "fully", "government", "household", "households", "housing", "income"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
alternativeanotherbrandbusinesscapitalchaincomplyconditionscontrollingcorporatedirectentityexpansionfeesfinancialgrowthindividualinvestmentlargelegal
SHARED TOKENS (37): "alternative", "another", "brand", "business", "capital", "chain", "comply", "conditions", "controlling", "corporate", "direct", "entity", "expansion", "fees", "financial", "growth", "individual", "investment", "large", "legal"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionactionallowanotherapplicationconnectdevelopmenteasementsevenfeefinalfunctionsgovernmentimpactlandlaterlegalnetworksownerownership
SHARED TOKENS (35): "acquisition", "action", "allow", "another", "application", "connect", "development", "easements", "even", "fee", "final", "functions", "government", "impact", "land", "later", "legal", "networks", "owner", "ownership"....
0.300
H-1B visa ↗ Q974595 KW CROSS HIGH
additionaladministrationagencyagricultureapplicantsapplicationapprovedbeyondchangecodifiedconditionsconsumerdefinesdepartmentemployersemploymentequivalentexemptionsfeegrowth
SHARED TOKENS (38): "additional", "administration", "agency", "agriculture", "applicants", "application", "approved", "beyond", "change", "codified", "conditions", "consumer", "defines", "department", "employers", "employment", "equivalent", "exemptions", "fee", "growth"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actanotherapplicationauthorityboundariesbuildingchangecommercialcommunityconflictingcontrolcourtscreatingcurrentdistrictdistrictsgeneralgovernmentindustrialland
SHARED TOKENS (51): "act", "another", "application", "authority", "boundaries", "building", "change", "commercial", "community", "conflicting", "control", "courts", "creating", "current", "district", "districts", "general", "government", "industrial", "land"....
0.300
actagricultureamericanapproximatelyboisebureaucapacitycenterchangedcompletedcompletionconstructionhomeidahoirrigationlawmaterialsmonthsnationaloperated
SHARED TOKENS (26): "act", "agriculture", "american", "approximately", "boise", "bureau", "capacity", "center", "changed", "completed", "completion", "construction", "home", "idaho", "irrigation", "law", "materials", "months", "national", "operated"....
0.300
agricultureapplicablechaincomplianceconstraincreatesdevelopmentdocumenteasementsentityestablishedestatefederalfinancialfuturegenerallygovernmentgrowthimproveland
SHARED TOKENS (59): "agriculture", "applicable", "chain", "compliance", "constrain", "creates", "development", "document", "easements", "entity", "established", "estate", "federal", "financial", "future", "generally", "government", "growth", "improve", "land"....
0.300
alternativeassociatedcommercialdebtestateexpectedfinancialfuturehomeimprovelatermakingmarketprocesspropertyrealremainresidentialsubstantialvalue
SHARED TOKENS (20): "alternative", "associated", "commercial", "debt", "estate", "expected", "financial", "future", "home", "improve", "later", "making", "market", "process", "property", "real", "remain", "residential", "substantial", "value".
0.300
affordableamongassetsdrivenestatefinancialhouseholdshousingincreaseinvestorslargelargermakingmarketoccurrealreal-estatetypes
SHARED TOKENS (18): "affordable", "among", "assets", "driven", "estate", "financial", "households", "housing", "increase", "investors", "large", "larger", "making", "market", "occur", "real", "real-estate", "types".
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
addressaffordablearchitectureassociatedbuildingcommunitycreatingdevelopmentestatefacilitieshousingincreaseinfrastructurelandland-usemunicipalneighborhoodplanningpopulationreal
SHARED TOKENS (28): "address", "affordable", "architecture", "associated", "building", "community", "creating", "development", "estate", "facilities", "housing", "increase", "infrastructure", "land", "land-use", "municipal", "neighborhood", "planning", "population", "real"....
0.300
accessallowcommunitycompleteengineersenvironmentalhomelivingmaintainedoperatedpolicypractitionerspublicrelatedrequiressafeurban
SHARED TOKENS (17): "access", "allow", "community", "complete", "engineers", "environmental", "home", "living", "maintained", "operated", "policy", "practitioners", "public", "related", "requires", "safe", "urban".
0.300
authoritybuildingbusinesscapitalcombinecommercialestatefunctionshousingincomeintendedinvestmentlandlocalmaintainofficeofficespropertypurposesreal
SHARED TOKENS (28): "authority", "building", "business", "capital", "combine", "commercial", "estate", "functions", "housing", "income", "intended", "investment", "land", "local", "maintain", "office", "offices", "property", "purposes", "real"....
🫐 BERRY40 edges
0.280
informationprocesspropertiestypes
SHARED TOKENS (4): "information", "process", "properties", "types". | EXACT TITLE in land_use_planning: "Soil survey".
0.280
allocationbusinessdifferenteconomicsestatehousinglandmarketpersonpurposesrealreal-estateresidentialsingle
SHARED TOKENS (14): "allocation", "business", "different", "economics", "estate", "housing", "land", "market", "person", "purposes", "real", "real-estate", "residential", "single".
0.280
adaboisebureaucanyoncompletedcountiesengineersidahoirrigationoperatedtreasurevalleywaterwestern
SHARED TOKENS (14): "ada", "boise", "bureau", "canyon", "completed", "counties", "engineers", "idaho", "irrigation", "operated", "treasure", "valley", "water", "western".
0.280
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
agricultureamericanboisebureaucountieseastengineersidahoirrigationnationaloperatedprovidewaterwestern
SHARED TOKENS (14): "agriculture", "american", "boise", "bureau", "counties", "east", "engineers", "idaho", "irrigation", "national", "operated", "provide", "water", "western".
0.280
capitalcommercialconventionalestatefinancingfundedinstrumentprivatepropertyratesrealresidentialriskspecific
SHARED TOKENS (14): "capital", "commercial", "conventional", "estate", "financing", "funded", "instrument", "private", "property", "rates", "real", "residential", "risk", "specific".
0.280
boisecontainscoveringdistrictsfacilitieshomeidaholandmaintainnationalpercentresourcesunitswater
SHARED TOKENS (14): "boise", "contains", "covering", "districts", "facilities", "home", "idaho", "land", "maintain", "national", "percent", "resources", "units", "water".
0.280
accessagainstextendsfinancefinancialmaintainmarketotherwisepaymentpracticequalityratesriskuniversity
SHARED TOKENS (14): "access", "against", "extends", "finance", "financial", "maintain", "market", "otherwise", "payment", "practice", "quality", "rates", "risk", "university".
0.270
currentgovernmentidahoofficeofficersposition
SHARED TOKENS (6): "current", "government", "idaho", "office", "officers", "position". | URL->B (1): https://sos.idaho.gov/.
0.260
formsgenerallypaymentpersonpresentratesrealremainsrisksingletypesvaluevalues
SHARED TOKENS (13): "forms", "generally", "payment", "person", "present", "rates", "real", "remains", "risk", "single", "types", "value", "values".
0.260
Street network ↗ Q358078 KW CROSS HIGH
affectanalysisbecomeconnectedcreatingedgeslinesnationalnetworknetworksrepresentroadssystem
SHARED TOKENS (13): "affect", "analysis", "become", "connected", "creating", "edges", "lines", "national", "network", "networks", "represent", "roads", "system".
0.260
Septic tank ↗ Q386300 KW CROSS HIGH
connecteddevelopsfieldoccurprocessesreduceruralsepticsystemsystemsthereforetreatmentunits
SHARED TOKENS (13): "connected", "develops", "field", "occur", "processes", "reduce", "rural", "septic", "system", "systems", "therefore", "treatment", "units".
0.260
agencygovernmentlaw
SHARED TOKENS (3): "agency", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.260
firmheadquarteredsupply
SHARED TOKENS (3): "firm", "headquartered", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.240
approximatelyboisedatadistrictdistrictsevengovernmentidaholimitspopulationsinglesouth
SHARED TOKENS (12): "approximately", "boise", "data", "district", "districts", "even", "government", "idaho", "limits", "population", "single", "south".
0.240
agriculturalamericanhouseholdindustriallegalmerelyownershippersonrightssourcesystemwater
SHARED TOKENS (12): "agricultural", "american", "household", "industrial", "legal", "merely", "ownership", "person", "rights", "source", "system", "water".
0.240
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastgrowingidahometropolitanpopulationschoolschoolsstar
SHARED TOKENS (12): "ada", "boise", "canyon", "district", "east", "growing", "idaho", "metropolitan", "population", "school", "schools", "star".
0.240
Right to property ↗ KW CROSS HIGH
articlegeneralindividuallegalownershippaymentpersonprivatepropertyprotectionrightsspecified
SHARED TOKENS (12): "article", "general", "individual", "legal", "ownership", "payment", "person", "private", "property", "protection", "rights", "specified".
0.240
actamericanamongapplychangeschaptercodeconsumerlawpdfprotectionprovisions
SHARED TOKENS (12): "act", "american", "among", "apply", "changes", "chapter", "code", "consumer", "law", "pdf", "protection", "provisions".
0.220
Mobile home ↗ Q1434998 KW CROSS HIGH
basedifferenthomehomeslegalmoveparkrequiredsitestructurework
SHARED TOKENS (11): "base", "different", "home", "homes", "legal", "move", "park", "required", "site", "structure", "work".
0.220
actaddresscapitalfundinggovernmenthousingintendedlargemarketpressureregulations
SHARED TOKENS (11): "act", "address", "capital", "funding", "government", "housing", "intended", "large", "market", "pressure", "regulations".
0.220
boundariesdescriptioninstrumentlandlawlegalpropertyrealrequiredspecificstatement
SHARED TOKENS (11): "boundaries", "description", "instrument", "land", "law", "legal", "property", "real", "required", "specific", "statement".
0.210
subdivision
SHARED TOKENS (1): "subdivision". | EXACT TITLE in land_use_planning: "Subdivision". | EXACT TITLE in mortgage_lending: "Subdivision".
0.200
Appraisal ↗ Q4781689 EXACT TITLE
topics
EXACT TITLE in mortgage_lending: "Appraisal".
0.200
agencyboisebureaudepartmentgovernmentidahonationalpotentialprotectstaff
SHARED TOKENS (10): "agency", "boise", "bureau", "department", "government", "idaho", "national", "potential", "protect", "staff".
0.200
applicationsbehaviorconstructionknowledgematerialsmechanicsproblemsrelatedstudyuses
SHARED TOKENS (10): "applications", "behavior", "construction", "knowledge", "materials", "mechanics", "problems", "related", "study", "uses".
0.200
estateformfunctionshomehousinginvestmentownerpersonrealstatus
SHARED TOKENS (10): "estate", "form", "functions", "home", "housing", "investment", "owner", "person", "real", "status".
0.200
banksbuildingestatefinanciallenderspropertyrealrepresenttransactionvalue
SHARED TOKENS (10): "banks", "building", "estate", "financial", "lenders", "property", "real", "represent", "transaction", "value".
0.180
USDA home loan ↗ KW CROSS HIGH
agriculturedepartmentdevelopmenthomehousingprogrampropertyruralusda
SHARED TOKENS (9): "agriculture", "department", "development", "home", "housing", "program", "property", "rural", "usda".
0.160
actualcurrentestatemarketproducepropertyrealvalue
SHARED TOKENS (8): "actual", "current", "estate", "market", "produce", "property", "real", "value".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
actionchangeeffectivemakingratherrelationshipssystemsystems
SHARED TOKENS (8): "action", "change", "effective", "making", "rather", "relationships", "system", "systems".
0.160
affectingdebtgenerallegalmodificationoutsideprocesstrust
SHARED TOKENS (8): "affecting", "debt", "general", "legal", "modification", "outside", "process", "trust".
0.160
activitydevelopedenvironmentalinterfacelandpublicriskurban
SHARED TOKENS (8): "activity", "developed", "environmental", "interface", "land", "public", "risk", "urban".
0.160
costsforeclosureinsurancelendersprivatepropertyrequiredsale
SHARED TOKENS (8): "costs", "foreclosure", "insurance", "lenders", "private", "property", "required", "sale".
0.160
businessdevelopmentestateindustrialofficeofficesparkrather
SHARED TOKENS (8): "business", "development", "estate", "industrial", "office", "offices", "park", "rather".
0.140
chaptercodefederalformprocessstatutetitle
SHARED TOKENS (7): "chapter", "code", "federal", "form", "process", "statute", "title".
0.120
associatebuildingcourtsdecisionsidahopresent
SHARED TOKENS (6): "associate", "building", "courts", "decisions", "idaho", "present".
0.120
cannotmanagementpracticepriorityprotecttypes
SHARED TOKENS (6): "cannot", "management", "practice", "priority", "protect", "types".
0.120
Negative equity ↗ KW CROSS HIGH
assetsestateownerrealvaluewhose
SHARED TOKENS (6): "assets", "estate", "owner", "real", "value", "whose".
0.100
boisehomeidahometropolitanserves
SHARED TOKENS (5): "boise", "home", "idaho", "metropolitan", "serves".
◈ Frequently Asked Questions
Land Use Planning × Mortgage Lending — Treasure Valley
HAIKU · HIGH GATE
How do zoning restrictions in Ada County affect mortgage approval timelines in the Treasure Valley?
Lenders in the Boise metropolitan area require title reports that document zoning classifications before committing to loans, which can extend closing periods by 10-14 days. Ada County's land-use planning department must issue zoning confirmations for parcels in Boise, Meridian, and Eagle, and mortgage lenders will not fund properties until these documents are received.
Why do water rights documentation and land-use planning matter to mortgage lending in the Treasure Valley?
Mortgage lenders in Boise require proof of water rights attached to agricultural land and parcels zoned for development because groundwater availability directly affects property value and development feasibility. The Boise River allocation and groundwater permits from Idaho's state system determine whether a parcel can support residential or agricultural use, and lenders will not issue mortgages without verification that water rights are secured to the property.
How do easements identified in land-use planning surveys affect mortgage lending decisions in the Treasure Valley?
Mortgage lenders in Ada County and the Boise metropolitan area require easement disclosures during the underwriting phase because easements can restrict property development and reduce collateral value. A parcel in Boise or surrounding areas may carry utility easements or public access easements tied to urban sprawl prevention, and lenders will adjust loan amounts or terms based on the extent and location of these encumbrances.
How does affordable housing policy in the Treasure Valley influence mortgage lending standards for parcels in Boise?
Mortgage lenders working in Boise consider land-use designations for affordable housing when evaluating loan risk, as properties in zones requiring affordable housing contributions may have lower development potential. Parcels zoned for affordable housing under Boise's comprehensive land-use planning policies may qualify for specialized financing programs or face restrictions that lenders must document before approving mortgages.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Land Use Planning × Mortgage Lending 32 QID bridges 248 edges 5,877 ext links 2026-07-17 21:42:26 UTC 5b37aab6ff33f8e7
Land Use Planning corridor ↗ Mortgage Lending corridor ↗ Mortgage Lending × Land Use Planning ↗ boisestandard.org/standard ↗
Parent Corridors
Land Use Planning × All Other Verticals