—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Land Use Planning ↔ relates to ↔ Outdoor Recreation

14 Wikipedia bridge articles confirmed in both vertical ledgers. 196 deterministic cross-vertical edges. 5,049 external source links harvested. Every edge provenance-stamped. Every claim auditable.

14 QID Bridge Articles
196 Cross Edges
5,049 External Sources
226 Wikipedia Articles
15 🌲 Evergreen
125 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Land Use Planning
× Outdoor Recreation
QID Bridge Articles
14
confirmed Wikipedia overlap
Total Cross Edges
196
External Sources Harvested
5,049
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Bureau of Reclamation
score: 1.0000  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (14)
Bureau of ReclamationBoise National ForestTreasure ValleyBoise RiverRiparian zoneUnited States Army Corps of EngineersConservation easementBoise, IdahoAda County, IdahoGarden City, IdahoMeridian, IdahoKuna, IdahoCanyon County, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahoadawaterrivergovernmentlandrangelocalfederallandsmanagementwesternhomenationalcapitaldepartmentdevelopmentjuneresource
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:42:54 UTC
Content Hash
017ab2e90190c3c0
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
14 BRIDGES
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in land_use_planning (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (20): "agency", "become", "built", "bureau", "department", "development", "federal", "government", "june", "lands", "law", "management", "million", "reclamation", "resource", "revenue", "source", "throughout", "water", "western". | EXACT TITLE in land_use_planning: "Bureau of Reclamation". | EXACT TITLE in outdoor_recreation: "Bureau of Reclamation".
agencybecomebuiltbureaudepartmentdevelopmentfederalgovernmentjunelandslawmanagementmillionreclamationresourcerevenuesourcethroughoutwaterwestern
The United States Bureau of Reclamation (formerly the United States Reclamation Service) is a federal agency under the United States Department of the Interior that oversees water resource management in the United States, specifically as applied to the oversight and operation of the diversion, delivery, and storage projects that it has built throughout the western United States for irrigation, water supply, and attendant hydroelectric power generation. It is currently the U.S.'s largest wholesaler of water, bringing water to more than 31 million people, and providing one in five Western farmers with irrigation water for 10 million acres of farmland, which produce 60% of the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
Leadership Reclamation commissioners that have had a strong impact and molding of the Bureau have included Elwood Mead, Michael W. Straus, and Floyd Dominy, with the latter two being public-power boosters who ran the Bureau during its heyday. Mead guided the bureau during the development, planning, and construction of the Hoover Dam, the United States' first multiple-purpose dam. John W. Keys, the 16th commissioner of the Bureau of Reclamation who served from July 2001 to April 2006, was killed two years after his retirement on May 30, 2008, when the airplane he was piloting crashed in Canyonlands National Park, Utah. On June 26, 2017, President Donald Trump nominated Brenda Burman to serve as the commissioner of the United States Bureau of Reclamation. She was confirmed by the United States Senate on November 16, 2017. Burman is the first woman to ever lead the Bureau of Reclamation. David Murillo was serving as the acting commissioner of the bureau. Burman resigned on January 20 after the inauguration of the Biden administration. The current commissioner is Camille Calimlim Touton, the first Filipino American to head the agency.
Boise National Forest
Q891075 EXACT TITLE 1.000
QID OVERLAP: Q891075 in land_use_planning (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (16): "boise", "districts", "emmett", "facilities", "feet", "home", "idaho", "land", "multiple", "national", "range", "recreation", "resources", "river", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Boise National Forest".
boisedistrictsemmettfacilitiesfeethomeidaholandmultiplenationalrangerecreationresourcesriverwaterwildlife
Boise National Forest is a National Forest covering 2,203,703 acres (8,918.07 km2) of the U.S. state of Idaho. Created on July 1, 1908, from part of Sawtooth National Forest, it is managed by the U.S. Forest Service as five units: the Cascade, Emmett, Idaho City, Lowman, and Mountain Home ranger districts. The Idaho Batholith underlies most of Boise National Forest, forming the forest's Boise, Salmon River, and West mountain ranges; the forest reaches a maximum elevation of 9,730 feet (2,970 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
70 m) on Steel Mountain. Common land cover includes sagebrush steppe and spruce-fir forests; there are 9,600 miles (15,400 km) of streams and rivers and 15,400 acres (62 km2) of lakes and reservoirs. Boise National Forest contains 75 percent of the known populations of Sacajawea's bitterroot, a flowering plant endemic to Idaho. The Shoshone people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
one people occupied the forest before European settlers arrived in the early 19th century. Many of the early settlers were trappers and prospectors before gold was discovered in 1862. After the 1860s Boise Basin gold rush ended, mining of tungsten, silver, antimony, and gold continued in the forest until the mid-twentieth century. Recreation facilities include over 70 campgrounds, whitewater and flatwater boating, cabin rentals, and 1,300 miles (2,100 km) of trails for hiking, biking, horseback riding, and motorized off-road vehicle use.
Treasure Valley
Q7836726 EXACT TITLE 0.880
QID OVERLAP: Q7836726 in land_use_planning (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (9): "boise", "idaho", "land", "local", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in land_use_planning: "Treasure Valley". | EXACT TITLE in outdoor_recreation: "Treasure Valley".
boiseidaholandlocalresourcesrivertreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise River
Q891080 EXACT TITLE 0.880
QID OVERLAP: Q891080 in land_use_planning (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (9): "approximately", "boise", "idaho", "lands", "range", "river", "urban", "watershed", "western". | EXACT TITLE in land_use_planning: "Boise River". | EXACT TITLE in outdoor_recreation: "Boise River".
approximatelyboiseidaholandsrangeriverurbanwatershedwestern
the Northwestern United States. It drains a rugged portion of the Sawtooth Range in southwestern Idaho northeast of Boise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
Riparian zone
Q13360049 QID OVERLAP 0.800
QID OVERLAP: Q13360049 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (33): "additionally", "change", "communities", "connect", "connectivity", "conservation", "construction", "control", "corridor", "ecology", "emphasizes", "environmental", "erosion", "even", "habitat", "important", "land", "local", "management", "national"....
additionallychangecommunitiesconnectconnectivityconservationconstructioncontrolcorridorecologyemphasizesenvironmentalerosionevenhabitatimportantlandlocalmanagementnationalnaturalplayprotectionqualityresourcerestorationriverroleshowssupporting+3
Research shows that riparian zones are instrumental in water quality improvement for both surface runoff and water flowing into streams through subsurface or groundwater flow. Riparian zones can play a role in lowering nitrate contamination in surface runoff, such as manure and other fertilizers from agricultural fields, that would otherwise damage ecosystems and human health. Particularly, the attenuation of nitrate or denitrification of the nitrates from fertilizer in this buffer zone is important. The use of wetland riparian zones shows a particularly high rate of removal of nitrate entering a stream and thus has a place in agricultural management. Also in terms of carbon transport from terrestrial ecosystems to aquatic ecosystems, riparian groundwater can play an important role. As such, a distinction can be made between parts of the riparian zone that connect large parts of the landscape to streams, and riparian areas with more local groundwater contributions. Additionally, Richardson et al.
Riparian zones dissipate stream energy. The meandering curves of a river, combined with vegetation and root systems, slow the flow of water, which reduces soil erosion and flood damage. Sediment is trapped, reducing suspended solids to create less turbid water, replenish soils, and build stream banks. Pollutants are filtered from surface runoff, enhancing water quality via biofiltration. The riparian zones also provide wildlife habitat, increased biodiversity, and wildlife corridors, enabling aquatic and riparian organisms to move along river systems avoiding isolated communities. Riparian vegetation can also provide forage for wildlife and livestock. Additionally, riparian vegetation supports the reproduction of species such as dragonflies, whose diverse egg-laying strategies depend on the presence of specific plants and substrates along stream banks. Riparian zones are also important for the fish that live within rivers, such as brook and charr. Impacts on riparian zones can affect fish, and restoration is not always sufficient to recover fish populations. They provide native landscape irrigation by extending seasonal or perennial flows of water. Nutrients from terrestrial vegetation (e.g. plant litter and insect drop) are transferred to aquatic food webs, and are a vital source of energy in aquatic food webs. The vegetation surrounding the stream helps to shade the water, mitigating water temperature changes. Thinning of riparian zones has been observed to cause increased maximum temperatures, higher fluctuations in temperature, and elevated temperatures being observed more frequently and for longer periods of time. Extreme changes in water temperature can have lethal effects on fish and other organisms in the area. The vegetation also contributes wood debris to streams, which is important to maintaining geomorphology. Riparian zones also act as important buffers against nutrient loss in the wake of natural disasters, such as hurricanes. Many of the characteristics of riparian zones that reduce the inputs of nitrogen from agricultural runoff also retain the necessary nitrogen in the ecosystem after hurricanes threaten to dilute and wash away critical nutrients. From a social aspect, riparian zones contribute to nearby property values through amenity and views, and they improve enjoyment for footpaths and bikeways through supporting foreshoreway networks.
Riparian zones in Africa Riparian forest can be found in Benin, West Africa. In Benin, where the savanna ecosystem prevails, "riparian forests" include various types of woodlands, such as semi-deciduous forests, dry forests, open forests, and woodland savannas. These woodlands can be found alongside rivers and streams. In Nigeria, you can also discover riparian zones within the Ibadan region of Oyo state. Ibadan, one of the oldest towns in Africa, covers a total area of 3,080 square kilometers and is characterized by a network of perennial water streams that create these valuable riparian zones. In the research conducted by Adeoye et al. (2012) on land use changes in Southwestern Nigeria, it was observed that 46.18 square kilometers of the area are occupied by water bodies. Additionally, most streams and rivers in this region are accompanied by riparian forests. Nevertheless, the study also identified a consistent reduction in the extent of these riparian forests over time, primarily attributed to a significant deforestation rate. In Nigeria, according to Momodu et al. (2011), there has been a notable decline of about 50% in the riparian forest coverage within the period of 1978 to 2000. This reduction is primarily attributed to alterations in land use and land cover. Additionally, their research indicates that if current trends continue, the riparian forests may face further depletion, potentially leading to their complete disappearance by the year 2040. Riparian zones can also be found in Cape Agulhas region of South Africa. Riparian areas along South African rivers have experienced significant deterioration as a result of human activities.
United States Army Corps of Engineers
Q1049334 QID OVERLAP 0.800
QID OVERLAP: Q1049334 in land_use_planning (tier:evergreen) and outdoor_recreation (tier:branch). | SHARED TOKENS (42): "activities", "agencies", "approximately", "army", "authority", "business", "capacity", "clean", "construction", "control", "corps", "department", "design", "direct", "directly", "economy", "engineers", "environmental", "exist", "facilities"....
activitiesagenciesapproximatelyarmyauthoritybusinesscapacitycleanconstructioncontrolcorpsdepartmentdesigndirectdirectlyeconomyengineersenvironmentalexistfacilitiesfederalformgovernmentinfrastructurejunemanagementnationalofficeoperatingoperations+12
ilians do not function as active duty military and are not required to be in active war and combat zones; however, volunteer (with pay) opportunities do exist for civilians to do so. The day-to-day activities of the three mission areas are administered by a lieutenant general known as the chief of engineers/commanding general. The chief of engineers commands the Engineer Regiment, comprising combat engineer, rescue, construction, dive, and other specialty units, and answers directly to the chief of staff of the Army. Combat engineers, sometimes called sappers, form an integral part of the Army's combined arms team and are found in all Army service components: Regular Army, National Guard, and Army Reserve. Their duties are to breach obstacles; construct fighting positions, fixed/floating bridges, and obstacles and defensive positions; place and detonate explosives; conduct route clearance operations; emplace and detect landmines; and fight as provisional infantry when required. For the military construction mission, the chief of engineers is directed and supervised by the Assistant Secretary of the Army for installations, environment, and energy, whom the President appoints and the Senate confirms. Military construction relates to construction on military bases and worldwide installations. On 16 June 1775, the Continental Congress, gathered in Philadelphia, granted authority for the creation of a "chief engineer for the Army". Congress authorized a corps of engineers for the United States on 1 March 1779. The corps as it is known today came into being on 16 March 1802, when the president was authorized to "organize and establish a Corps of Engineers ... that the said Corps ... shall be stationed at West Point in the State of New York and shall constitute a Military Academy." A Corps of Topographical Engineers, authorized on 4 July 1838, merged with the Corps of Engineers in March 1863. Civil works are managed and supervised by the assistant secretary of the Army. Army civil works include three U.S. Congress-authorized business lines: navigation, flood and storm damage protection, and aquatic ecosystem restoration. Civil works is also tasked with administering the Clean Water Act Section 404 program, including recreation, hydropower, and water supply at USACE flood control reservoirs, and environmental infrastructure. The civil works staff oversee construction, operation, and maintenance of dams, canals and flood protection in the U.S., as well as a wide range of public works throughout the world. Some of its dams, reservoirs, and flood control projects also serve as public outdoor recreation facilities. Its hydroelectric projects provide 24% of U.S. hydropower capacity.
The National Defense Act of 1916 authorized a reserve corps in the Army, and the Engineer Officers' Reserve Corps and the Engineer Enlisted Reserve Corps became one of the branches. Some of these personnel were called into active service for World War I. An example of this was the 510th and 511th Engineer Service Battalions. These two military units were organized at Camp Lee, Va, and consisted of black soldiers (draftees), white officers, and non-commissioned officers. From the beginning, many politicians wanted the Corps of Engineers to contribute to both military construction and civil works. Assigned the military construction mission on 1 December 1941, after the Quartermaster Department struggled with the expanding mission, the Corps built facilities at home and abroad to support the U.S. Army and Air Force. During World War II the USACE program expanded to more than 27,000 military and industrial projects in a $15.3 billion mobilization effort. Included were aircraft, tank assembly, and ammunition plants; camps for 5.3 million soldiers; depots, ports, and hospitals; and the rapid construction of such landmark projects such as the Manhattan Project at Los Alamos, Hanford and Oak Ridge among other places, and the Pentagon, the Department of Defense headquarters across the Potomac from Washington, DC. In civilian projects, the Corps of Engineers became the lead federal navigation and flood control agency. Congress significantly expanded its civil works activities, becoming a major provider of hydroelectric energy and the country's leading provider of recreation. Its role in responding to natural disasters also grew dramatically, especially following the devastating Mississippi Flood of 1927. In the late 1960s, the agency became a leading environmental preservation and restoration agency. In 1944, specially trained army combat engineers were assigned to blow up underwater obstacles and clear defended ports during the invasion of Normandy. During World War II, the Army Corps of Engineers in the European Theater of Operations was responsible for building numerous bridges, including the first and longest floating tactical bridge across the Rhine at Remagen, and building or maintaining roads vital to the Allied advance across Europe into the heart of Germany. In the Pacific theater, the "Pioneer troops" were formed, a hand-selected unit of volunteer Army combat engineers trained in jungle warfare, knife fighting, and unarmed jujitsu (hand-to-hand combat) techniques. Working in camouflage, the Pioneers cleared jungle, prepared routes of advance and established bridgeheads for the infantry, as well as demolishing enemy installations. Five commanding generals (chiefs of staff after the 1903 reorganization) of the United States Army held engineer commissions early in their careers. All transferred to other branches before being promoted to the top position. They were Alexander Macomb, George B. McClellan, Henry W. Halleck, Douglas MacArthur, and Maxwell D.
The General Survey Act of 1824 authorized use of army engineers to survey roads and canals. The next month, an act to improve navigation on the Ohio and Mississippi rivers initiated the Corps of Engineers' permanent civil works construction mission. Although the 1824 act to improve the Mississippi and Ohio rivers is often called the first rivers and harbors legislation, the act passed in 1826 was the first to combine authorizations for both surveys and projects, thereby establishing a pattern that continues to the present day. Survey and construction of the National Road until Federal funds were withdrawn (1838) The 555 ft 5+1⁄8 in (169.29 m) tall Washington Monument, completed under the direction and command of Lieutenant Colonel Thomas Lincoln Casey, 1884 Construction of Fort Baldwin as part of the Harbor Defenses of Portland during the Endicott Period (1905-1912) Panama Canal, completed under supervision of Army Engineer officers, 1914 Flood Control Act of 1936 made flood control a federal policy and officially recognized the Corps of Engineers as the major federal flood control agency Bonneville Dam, completed in 1937 Flood Control Act of 1941, which channelized the Los Angeles River and parts of the Santa Ana River USACE took over all real estate acquisition, construction, and maintenance for army facilities, 1941 There was no road between Costa Rica and Panama until the Corps began one in 1941–1943. The concern was access to the Panama Canal during wartime. The Manhattan Project (1942–1946) Planning and construction of the Pentagon, completed in 1943 just 16 months after groundbreaking Comprehensive Everglades Restoration Plan, first authorized by congress in 1948 USACE began construction support for NASA leading to major activities at the Manned Spacecraft Center and Kennedy Space Center, 1961 King Khalid Military City 1973–1987 The Water Resources Development Act of 1986 (WRDA 86) brought major change in financing by requiring non-federal contributions toward most federal water resource projects Cross Florida Barge Canal Tennessee-Tombigbee Waterway Occasional civil disasters, including the Great Mississippi Flood of 1927, resulted in greater responsibilities for the Corps of Engineers.
Conservation easement
Q3480552 QID OVERLAP 0.800
QID OVERLAP: Q3480552 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (34): "chain", "conservation", "corridors", "creates", "development", "easements", "entity", "estate", "exercise", "federal", "financial", "government", "growth", "habitat", "land", "lands", "local", "market", "nonprofit", "organization"....
chainconservationcorridorscreatesdevelopmenteasementsentityestateexercisefederalfinancialgovernmentgrowthhabitatlandlandslocalmarketnonprofitorganizationownershipprivateprotectpublicqualityrealrestrictionsroadsscenicsubdivision+4
servation easement "runs with the land", meaning it is applicable to both present and future owners of the land. The grant of conservation easement, as with any real property interest, is part of the chain of title for the property and is normally recorded in local land records. The conservation easement's purposes will vary depending on the character of the particular property, the goals of the land trust or government unit, and the needs of the landowners.
In the United States, a conservation easement (also called conservation covenant, conservation restriction or conservation servitude) is a power invested in a nonprofit organization called a land trust, or a governmental entity to restrict, as to a specified land area, the exercise of rights otherwise held by a landowner so as to achieve certain conservation purposes. It is an interest in real property established by agreement between a landowner and land trust or unit of government. The conservation easement "runs with the land", meaning it is applicable to both present and future owners of the land. The grant of conservation easement, as with any real property interest, is part of the chain of title for the property and is normally recorded in local land records. The conservation easement's purposes will vary depending on the character of the particular property, the goals of the land trust or government unit, and the needs of the landowners.
otherwise held by a landowner so as to achieve certain conservation purposes. It is an interest in real property established by agreement between a landowner and land trust or unit of government. The conservation easement "runs with the land", meaning it is applicable to both present and future owners of the land. The grant of conservation easement, as with any real property interest, is part of the chain of title for the property and is normally recorded in local land records. The conservation easement's purposes will vary depending on the character of the particular property, the goals of the land trust or government unit, and the needs of the landowners.
Boise, Idaho
Q35775 QID OVERLAP 0.740
QID OVERLAP: Q35775 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (12): "ada", "boise", "capital", "downtown", "feet", "home", "idaho", "locally", "major", "river", "treasure", "valley".
adaboisecapitaldowntownfeethomeidaholocallymajorrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in land_use_planning (tier:branch) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "home", "idaho", "jurisdiction", "local", "private", "range", "roads".
adaboisecapitaldistricthomeidahojurisdictionlocalprivaterangeroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Garden City, Idaho
Q1516892 QID OVERLAP 0.640
QID OVERLAP: Q1516892 in land_use_planning (tier:evergreen) and outdoor_recreation (tier:evergreen). | SHARED TOKENS (7): "ada", "boise", "garden", "government", "idaho", "municipal", "street".
adaboisegardengovernmentidahomunicipalstreet
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.620
QID OVERLAP: Q1085274 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (6): "ada", "among", "boise", "capital", "idaho", "meridian".
adaamongboisecapitalidahomeridian
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.600
QID OVERLAP: Q1515177 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "ada", "additional", "boise", "idaho", "kuna".
adaadditionalboiseidahokuna
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.600
QID OVERLAP: Q486078 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "boise", "caldwell", "canyon", "idaho", "nampa".
boisecaldwellcanyonidahonampa
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in land_use_planning (tier:branch) and outdoor_recreation (tier:branch). | SHARED TOKENS (5): "ada", "boise", "downtown", "eagle", "idaho".
adaboisedowntowneagleidaho
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
182 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP182 edges
🌲 EVERGREEN1 edges
0.650
adaadditionaladditionallyamericaboisebureaucanyonconservationcoverscreatingdifferentfeethistoricalhomeidahoimportantlandlandsmanagementmillion
SHARED TOKENS (33): "ada", "additional", "additionally", "america", "boise", "bureau", "canyon", "conservation", "covers", "creating", "different", "feet", "historical", "home", "idaho", "important", "land", "lands", "management", "million".... | URL->B (1): https://www.blm.gov/programs/national-conservation-lands/idaho/morley-nelson-snake-river-birds-of-prey. | EXACT TITLE in outdoor_recreation: "Morley Nelson Snake River Birds of Prey National Conservation Area".
🌿 BRANCH125 edges
0.570
boiseconditionsidaholandnationaloperatedorganizationprivaterecreationroadwestern
SHARED TOKENS (11): "boise", "conditions", "idaho", "land", "national", "operated", "organization", "private", "recreation", "road", "western". | URL->B (1): http://www.bogusbasin.org/. | EXACT TITLE in outdoor_recreation: "Bogus Basin".
0.510
agencydepartmentgovernmentidahoparksprogramsrecreationthroughout
SHARED TOKENS (8): "agency", "department", "government", "idaho", "parks", "programs", "recreation", "throughout". | URL->B (1): https://parksandrecreation.idaho.gov/. | EXACT TITLE in outdoor_recreation: "Idaho Department of Parks and Recreation".
0.500
agenciesagencyamongapproximatelybureauconservationdepartmentestatefederalgovernmentgrazingidaholandlandsmanagementmillionnationalofficepermitsprivate
SHARED TOKENS (25): "agencies", "agency", "among", "approximately", "bureau", "conservation", "department", "estate", "federal", "government", "grazing", "idaho", "land", "lands", "management", "million", "national", "office", "permits", "private".... | EXACT TITLE in outdoor_recreation: "Bureau of Land Management".
0.500
activitiesactivityagenciesattachedcommunitydevelopeddistributioneconomicevenfeaturesgrowthimportantinformationneedorganizationsplanningprojectregionalshapesystems
SHARED TOKENS (22): "activities", "activity", "agencies", "attached", "community", "developed", "distribution", "economic", "even", "features", "growth", "important", "information", "need", "organizations", "planning", "project", "regional", "shape", "systems".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
anotherattachedbroaderbusinessdatadefinitionecologyfoundationgeographyinformationinstitutionalknowledgemanagementmethodsmultiplenaturalopenoperationsorganizationsphysical
SHARED TOKENS (25): "another", "attached", "broader", "business", "data", "definition", "ecology", "foundation", "geography", "information", "institutional", "knowledge", "management", "methods", "multiple", "natural", "open", "operations", "organizations", "physical".... | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
Wildfire ↗ Q169950 EXACT TITLE
changecreatecreatesdirecteconomiceventfeedbackfiregrowthinterfaceslandmanagementnaturalopenphysicalriskspacesurbanwaterwildfire
SHARED TOKENS (20): "change", "create", "creates", "direct", "economic", "event", "feedback", "fire", "growth", "interfaces", "land", "management", "natural", "open", "physical", "risk", "spaces", "urban", "water", "wildfire". | EXACT TITLE in land_use_planning: "Wildfire". | EXACT TITLE in outdoor_recreation: "Wildfire".
0.500
Groundwater ↗ Q161598 EXACT TITLE
additionallybecomecapacitycentralchangecleandistributionenvironmentalformformationlandmajormultiplemunicipaloperatingprovidepublicrocksourcesources
SHARED TOKENS (25): "additionally", "become", "capacity", "central", "change", "clean", "distribution", "environmental", "form", "formation", "land", "major", "multiple", "municipal", "operating", "provide", "public", "rock", "source", "sources".... | EXACT TITLE in land_use_planning: "Groundwater".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesdeterminedevelopeddevelopmentdifferentformgovernmentgrowthlandlocalplacesplanningregulatoryrulesscaleshapesinglesystemsurban
SHARED TOKENS (19): "activities", "determine", "developed", "development", "different", "form", "government", "growth", "land", "local", "places", "planning", "regulatory", "rules", "scale", "shape", "single", "systems", "urban". | EXACT TITLE in land_use_planning: "Zoning".
0.500
activitiesbroaderdevelopmenteconomicenvironmentalgrowthinfrastructurelandlargermanagementnationalnetworkplanningprotectionregionalrelatedrequirerequiresscalespace
SHARED TOKENS (24): "activities", "broader", "development", "economic", "environmental", "growth", "infrastructure", "land", "larger", "management", "national", "network", "planning", "protection", "regional", "related", "require", "requires", "scale", "space".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accessagencieschangecommunityconditionsconnectivitydevelopmentdifferenteconomiceconomyemergencyenforcementenvironmentalfacilitiesinfrastructurelawmanagementofficialparksphysical
SHARED TOKENS (29): "access", "agencies", "change", "community", "conditions", "connectivity", "development", "different", "economic", "economy", "emergency", "enforcement", "environmental", "facilities", "infrastructure", "law", "management", "official", "parks", "physical".... | EXACT TITLE in land_use_planning: "Infrastructure". | EXACT TITLE in outdoor_recreation: "Infrastructure".
0.500
State park ↗ Q1761072 EXACT TITLE
administrationconservationdesignedexistexperiencefederalgovernmenthistoryimportantlocalnationalnaturalparkparkspreservepreservingprogramsratherregionalresources
SHARED TOKENS (23): "administration", "conservation", "designed", "exist", "experience", "federal", "government", "history", "important", "local", "national", "natural", "park", "parks", "preserve", "preserving", "programs", "rather", "regional", "resources".... | EXACT TITLE in outdoor_recreation: "State park".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
backbecomecreatedevelopeddirectlyeventsimportantlandmajornaturalnearbyrelatedresourcetimingurbanwater
SHARED TOKENS (16): "back", "become", "create", "developed", "directly", "events", "important", "land", "major", "natural", "nearby", "related", "resource", "timing", "urban", "water". | EXACT TITLE in land_use_planning: "Stormwater".
0.500
activityanothercentralcontroldesigndevelopmentdifferentenvironmentalformformationformsgeographyincreasinglymapsmeansmultipleneighborhoodneighborhoodsopenownership
SHARED TOKENS (28): "activity", "another", "central", "control", "design", "development", "different", "environmental", "form", "formation", "forms", "geography", "increasingly", "maps", "means", "multiple", "neighborhood", "neighborhoods", "open", "ownership".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
agenciesconditionsconstructioncontroldesignenvironmentalerosionestateexpertiseinfrastructurelicenselicensesmanagementparksplanningprivatepublicrangerecreationresource
SHARED TOKENS (24): "agencies", "conditions", "construction", "control", "design", "environmental", "erosion", "estate", "expertise", "infrastructure", "license", "licenses", "management", "parks", "planning", "private", "public", "range", "recreation", "resource".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
authoritycentralchangecommunitiescommunityconditionsconflictsconservationcreatingdefinitiondependsdesigndevelopmentdistrictseconomicenvironmentalexposurefacilitieslandmeans
SHARED TOKENS (31): "authority", "central", "change", "communities", "community", "conditions", "conflicts", "conservation", "creating", "definition", "depends", "design", "development", "districts", "economic", "environmental", "exposure", "facilities", "land", "means".... | EXACT TITLE in land_use_planning: "Land-use planning".
0.500
americacapacitycapitalconnectingcorridorsdesigndesignedfeaturesinteractintersectionsmillionnetworkpublicqualityridesinglesystemsystemstraffictransportation
SHARED TOKENS (20): "america", "capacity", "capital", "connecting", "corridors", "design", "designed", "features", "interact", "intersections", "million", "network", "public", "quality", "ride", "single", "system", "systems", "traffic", "transportation". | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
beyondboiseconnectseagleidahomunicipalitiesparksriverriversideroadroutessystemtrailtransportationurban
SHARED TOKENS (15): "beyond", "boise", "connects", "eagle", "idaho", "municipalities", "parks", "river", "riverside", "road", "routes", "system", "trail", "transportation", "urban". | EXACT TITLE in outdoor_recreation: "Boise River Greenbelt".
0.500
activitiesagenciesdesigneddevelopmentdifferentdistrictseasementseducationestablishingexamplesgovernmentlandlocalnationaloperatedoperationalorganizationsplanningpreservationpreserve
SHARED TOKENS (24): "activities", "agencies", "designed", "development", "different", "districts", "easements", "education", "establishing", "examples", "government", "land", "local", "national", "operated", "operational", "organizations", "planning", "preservation", "preserve".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
Urban design ↗ Q63100 EXACT TITLE
communityconnectdesigneconomicenvironmentalfeatureshistoricalimportantlocalpagephysicalplanningprojectpublicrangeregionalrelatedspacespacesstreet
SHARED TOKENS (23): "community", "connect", "design", "economic", "environmental", "features", "historical", "important", "local", "page", "physical", "planning", "project", "public", "range", "regional", "related", "space", "spaces", "street".... | EXACT TITLE in land_use_planning: "Urban design".
0.500
administrationagenciesagencycommuterdepartmentdistrictfederalfinancialgovernmentlocalofficeofficesoperatorsprogramsproviderspublicregionalrequirementssystemstransportation
SHARED TOKENS (21): "administration", "agencies", "agency", "commuter", "department", "district", "federal", "financial", "government", "local", "office", "offices", "operators", "programs", "providers", "public", "regional", "requirements", "systems", "transportation".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
administrationagenciesagencydesigneddevelopeddevelopmentdistributedenvironmentalfederalfoundationfundedlandnationalopenorgplanningprotectionsourcesouthsupport
SHARED TOKENS (24): "administration", "agencies", "agency", "designed", "developed", "development", "distributed", "environmental", "federal", "foundation", "funded", "land", "national", "open", "org", "planning", "protection", "source", "south", "support".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Hunting ↗ EXACT TITLE
activitiesagainstbecomecapacityconservationcontrolevenformimportantlawmanagementmeansnaturalparksproductsprogramsproviderecreationtargetsthem
SHARED TOKENS (22): "activities", "against", "become", "capacity", "conservation", "control", "even", "form", "important", "law", "management", "means", "natural", "parks", "products", "programs", "provide", "recreation", "targets", "them".... | EXACT TITLE in outdoor_recreation: "Hunting".
0.500
Wetland ↗ Q170321 EXACT TITLE
americaamongchangeconservationcontroldifferentenvironmentalexamplesexistfloodplainsforminfrastructurelandsmethodsprotectprotectionprovidepublicqualityrange
SHARED TOKENS (27): "america", "among", "change", "conservation", "control", "different", "environmental", "examples", "exist", "floodplains", "form", "infrastructure", "lands", "methods", "protect", "protection", "provide", "public", "quality", "range".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
agenciesagencybroaderconservationdepartmentlandslocalnaturalpartnershipprivateprogramsprojectprotectqualityresourcesusdawater
SHARED TOKENS (17): "agencies", "agency", "broader", "conservation", "department", "lands", "local", "natural", "partnership", "private", "programs", "project", "protect", "quality", "resources", "usda", "water". | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
agencycommercialcompletedconstructiondesigndevelopmentinstitutionalmultipleneighborhoodpedestrianphysicallyplanningprivatesinglesitespaceurban
SHARED TOKENS (17): "agency", "commercial", "completed", "construction", "design", "development", "institutional", "multiple", "neighborhood", "pedestrian", "physically", "planning", "private", "single", "site", "space", "urban". | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
activitiesadditionalagenciesallowsdatadevelopedfacilitiesfederalgovgovernmentinformationlistingspermitsplanningplatformrecreationsitesitessystemtravel
SHARED TOKENS (21): "activities", "additional", "agencies", "allows", "data", "developed", "facilities", "federal", "gov", "government", "information", "listings", "permits", "planning", "platform", "recreation", "site", "sites", "system", "travel".... | EXACT TITLE in outdoor_recreation: "Recreation.gov".
0.500
Surveying ↗ Q816425 EXACT TITLE
constructiondefinitiondevelopmentfeaturesformsgovernmenthistoryimportantlandlawmappingmapsownershipplanningstructuralthemtransportation
SHARED TOKENS (17): "construction", "definition", "development", "features", "forms", "government", "history", "important", "land", "law", "mapping", "maps", "ownership", "planning", "structural", "them", "transportation". | EXACT TITLE in land_use_planning: "Surveying".
0.500
adaboisecentercommercialdepartmentdowntownfireidahomillionnationaloperatedoperatesprotectionrequiringsouthsupportwesternwildfire
SHARED TOKENS (18): "ada", "boise", "center", "commercial", "department", "downtown", "fire", "idaho", "million", "national", "operated", "operates", "protection", "requiring", "south", "support", "western", "wildfire". | EXACT TITLE in land_use_planning: "Boise Airport".
0.500
accessibilityactivitiesadministrationanotherbroaderbuiltbusinesscapitalcategorycommunitiescommunitycontextscreatingdesigndevelopmentdifferentdistributioneconomicenvironmentalgeography
SHARED TOKENS (45): "accessibility", "activities", "administration", "another", "broader", "built", "business", "capital", "category", "communities", "community", "contexts", "creating", "design", "development", "different", "distribution", "economic", "environmental", "geography".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
agenciesagencyapplyauthoritydecisionsdefinitiondesignedenvironmentalfederalgovernmentlawnationalpreservequalityreportsrequirementsrequiresrequiring
SHARED TOKENS (18): "agencies", "agency", "apply", "authority", "decisions", "definition", "designed", "environmental", "federal", "government", "law", "national", "preserve", "quality", "reports", "requirements", "requires", "requiring". | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
0.500
agencyarmycleanconservationcontrolcoordinationcorpsdirectlyengineersenvironmentalfederalformlawmajorphysicalprotectionqualityresourcesafewater
SHARED TOKENS (21): "agency", "army", "clean", "conservation", "control", "coordination", "corps", "directly", "engineers", "environmental", "federal", "form", "law", "major", "physical", "protection", "quality", "resource", "safe", "water".... | EXACT TITLE in land_use_planning: "Clean Water Act".
0.500
applyauthoritybecomesbeganconstructioncontroldepartmentsdesigndistrictengineersenvironmentalestateexamplesjurisdictionjurisdictionallawlocalnationalplanningprivate
SHARED TOKENS (28): "apply", "authority", "becomes", "began", "construction", "control", "departments", "design", "district", "engineers", "environmental", "estate", "examples", "jurisdiction", "jurisdictional", "law", "local", "national", "planning", "private".... | EXACT TITLE in land_use_planning: "Building code".
0.500
administrationagainstagencycommunitiescommunityconstructioncontrolcreatingdesigneddevelopmentemergencyenforcementfederalfloodplaingovernmenthazardlandmanagementmillionnational
SHARED TOKENS (25): "administration", "against", "agency", "communities", "community", "construction", "control", "creating", "designed", "development", "emergency", "enforcement", "federal", "floodplain", "government", "hazard", "land", "management", "million", "national".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomedepartmentinformationlandlandslocalmapofficeplanningpublicratherscaleshowsubdivisionthemurban
SHARED TOKENS (17): "another", "become", "department", "information", "land", "lands", "local", "map", "office", "planning", "public", "rather", "scale", "show", "subdivision", "them", "urban". | EXACT TITLE in land_use_planning: "Plat". | EXACT TITLE in outdoor_recreation: "Plat".
0.500
Irrigation ↗ Q11453 EXACT TITLE
centralconditionscontroldevelopeddirectlydistributeddistributionenvironmentalformgrowthlandmanagementmethodsnaturalnetworkoperationsprotectqualityrequiringriver
SHARED TOKENS (27): "central", "conditions", "control", "developed", "directly", "distributed", "distribution", "environmental", "form", "growth", "land", "management", "methods", "natural", "network", "operations", "protect", "quality", "requiring", "river".... | EXACT TITLE in land_use_planning: "Irrigation".
0.500
Canal ↗ Q12284 EXACT TITLE
builtcontrolcreatecurrentdestinationfeaturesmanagementnaturalrequiringresourcesriverseriessourcesourcesvalleywater
SHARED TOKENS (16): "built", "control", "create", "current", "destination", "features", "management", "natural", "requiring", "resources", "river", "series", "source", "sources", "valley", "water". | EXACT TITLE in land_use_planning: "Canal".
0.500
Site plan ↗ Q1284677 EXACT TITLE
conditionsconstructioncreatingdesigndevelopmentengineersfacilitiesfeaturesgardenhistoricalinfrastructurelandmajorparkingplanningprojectresourceroadsroutesshow
SHARED TOKENS (26): "conditions", "construction", "creating", "design", "development", "engineers", "facilities", "features", "garden", "historical", "infrastructure", "land", "major", "parking", "planning", "project", "resource", "roads", "routes", "show".... | EXACT TITLE in land_use_planning: "Site plan".
0.500
Open space ↗ Q1451377 EXACT TITLE
businesschaincommunityconservationcorridordesigndevelopmentgenericlandmakesopenparkplanningpublicrockspacespacesstructuresurban
SHARED TOKENS (19): "business", "chain", "community", "conservation", "corridor", "design", "development", "generic", "land", "makes", "open", "park", "planning", "public", "rock", "space", "spaces", "structures", "urban". | EXACT TITLE in land_use_planning: "Open space". | EXACT TITLE in outdoor_recreation: "Open space".
0.500
agenciesbuiltconstructiondepartmentsdesigngovernmentinfrastructurelocallymunicipalnationalphysicalprivatepublicroadsstructuralsystems
SHARED TOKENS (16): "agencies", "built", "construction", "departments", "design", "government", "infrastructure", "locally", "municipal", "national", "physical", "private", "public", "roads", "structural", "systems". | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
adaboisecanyonclassescommunitydevelopmenteducationgovernedidahonampaprogramspublicresidentssouthwestthroughouttreasurevalleywestern
SHARED TOKENS (18): "ada", "boise", "canyon", "classes", "community", "development", "education", "governed", "idaho", "nampa", "programs", "public", "residents", "southwest", "throughout", "treasure", "valley", "western". | EXACT TITLE in land_use_planning: "College of Western Idaho".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdifferentexistformmultipleoperatesoperatingoperationssystemsystemstogethertrafficurban
SHARED TOKENS (15): "broader", "capacity", "conditions", "different", "exist", "form", "multiple", "operates", "operating", "operations", "system", "systems", "together", "traffic", "urban". | EXACT TITLE in land_use_planning: "Light rail".
0.500
activitiescommunitycompatibilitycontinuitycurrentdevelopmentestablishingfoundationgrowthimportantlandlong-termneighborhoodplanningprovidepublicrangerecreationregionaltransportation
SHARED TOKENS (21): "activities", "community", "compatibility", "continuity", "current", "development", "establishing", "foundation", "growth", "important", "land", "long-term", "neighborhood", "planning", "provide", "public", "range", "recreation", "regional", "transportation".... | EXACT TITLE in land_use_planning: "Comprehensive planning".
0.480
Idaho ↗ EXACT TITLE
approximatelyboisecapitaleconomyidaholandmethodsmillionnationalofficialproductsriversouthwestern
SHARED TOKENS (14): "approximately", "boise", "capital", "economy", "idaho", "land", "methods", "million", "national", "official", "products", "river", "south", "western". | EXACT TITLE in land_use_planning: "Idaho". | EXACT TITLE in outdoor_recreation: "Idaho".
0.480
Fishing ↗ Q14373 EXACT TITLE
activitiesactivityadditionalcommercialdirectemploymentimportantlong-termmillionnaturalparkprovidewaterwildlife
SHARED TOKENS (14): "activities", "activity", "additional", "commercial", "direct", "employment", "important", "long-term", "million", "natural", "park", "provide", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Fishing".
0.480
activitiescontextdevelopmentevenformsgrazinglandlandsmeansnaturalorganizationrequirerequiresrequiring
SHARED TOKENS (14): "activities", "context", "development", "even", "forms", "grazing", "land", "lands", "means", "natural", "organization", "require", "requires", "requiring". | EXACT TITLE in land_use_planning: "Agricultural land".
0.460
adaarmyboisecorpsdiscoveryengineershomeidahoparkpublicrecreationriverwaters
SHARED TOKENS (13): "ada", "army", "boise", "corps", "discovery", "engineers", "home", "idaho", "park", "public", "recreation", "river", "waters". | EXACT TITLE in outdoor_recreation: "Lucky Peak State Park".
0.460
businessescommunitiesconstructioneconomicgovernmentgrowthinfrastructurelandneighborhoodsprivatepublicspacesurban
SHARED TOKENS (13): "businesses", "communities", "construction", "economic", "government", "growth", "infrastructure", "land", "neighborhoods", "private", "public", "spaces", "urban". | EXACT TITLE in land_use_planning: "Urban renewal".
0.460
Picnic ↗ Q506294 EXACT TITLE
differenteventformformshomeinformalparkparkspublicrequiresscenicviewwater
SHARED TOKENS (13): "different", "event", "form", "forms", "home", "informal", "park", "parks", "public", "requires", "scenic", "view", "water". | EXACT TITLE in outdoor_recreation: "Picnic".
0.460
Floodplain ↗ Q193110 EXACT TITLE
controldevelopedexperiencefloodplainfloodplainsimportantlandriskriverurbanvalleywaterwaters
SHARED TOKENS (13): "control", "developed", "experience", "floodplain", "floodplains", "important", "land", "risk", "river", "urban", "valley", "water", "waters". | EXACT TITLE in land_use_planning: "Floodplain". | EXACT TITLE in outdoor_recreation: "Floodplain".
0.460
economicemergencyexistformsgovernmenthomeinformallocalmarketsnationalownershiprentalresponse
SHARED TOKENS (13): "economic", "emergency", "exist", "forms", "government", "home", "informal", "local", "markets", "national", "ownership", "rental", "response". | EXACT TITLE in land_use_planning: "Affordable housing".
0.440
amongapproximatelyboiseextensionidahoofficesoperatesparkpublicrepresentedschoolsstatewide
SHARED TOKENS (12): "among", "approximately", "boise", "extension", "idaho", "offices", "operates", "park", "public", "represented", "schools", "statewide". | EXACT TITLE in land_use_planning: "University of Idaho".
0.440
beyonddatadevelopmenteventsgraphincreasinglyknowledgelearningopenreasoningrelationshipssystems
SHARED TOKENS (12): "beyond", "data", "development", "events", "graph", "increasingly", "knowledge", "learning", "open", "reasoning", "relationships", "systems". | EXACT TITLE in land_use_planning: "Knowledge graph". | EXACT TITLE in outdoor_recreation: "Knowledge graph".
0.440
agenciesapplybusinessesdesignfacilitiesgovernmentplanningprivatepublicrangesystemtransportation
SHARED TOKENS (12): "agencies", "apply", "businesses", "design", "facilities", "government", "planning", "private", "public", "range", "system", "transportation". | EXACT TITLE in land_use_planning: "Transportation planning".
0.420
boisecoursedepartmenteventsfacilitiesidahoparkparksrecreationriverurban
SHARED TOKENS (11): "boise", "course", "department", "events", "facilities", "idaho", "park", "parks", "recreation", "river", "urban". | EXACT TITLE in outdoor_recreation: "Ann Morrison Park".
0.420
Easement ↗ Q448405 EXACT TITLE
accessamonganothereasementsitselflandlawpublicrealroadtakes
SHARED TOKENS (11): "access", "among", "another", "easements", "itself", "land", "law", "public", "real", "road", "takes". | EXACT TITLE in land_use_planning: "Easement". | EXACT TITLE in outdoor_recreation: "Easement".
0.400
agencydepartmentfederalidahoinfrastructureoperationsorganizationplanningprogramstransportation
SHARED TOKENS (10): "agency", "department", "federal", "idaho", "infrastructure", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.400
Trail ↗ Q628179 EXACT TITLE
americacommunitiesnaturalpathpedestrianplacesroadroutetrailtravel
SHARED TOKENS (10): "america", "communities", "natural", "path", "pedestrian", "places", "road", "route", "trail", "travel". | EXACT TITLE in land_use_planning: "Trail". | EXACT TITLE in outdoor_recreation: "Trail".
0.400
currentdatadesigndifferentformformsroutescalestructuresurban
SHARED TOKENS (10): "current", "data", "design", "different", "form", "forms", "route", "scale", "structures", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.400
Aquifer ↗ Q208791 EXACT TITLE
beyondformationhomelandlayermajorrelatedrocksourcewater
SHARED TOKENS (10): "beyond", "formation", "home", "land", "layer", "major", "related", "rock", "source", "water". | EXACT TITLE in land_use_planning: "Aquifer".
0.400
activityamongboisebusinesseducationidahomillionprogramspublicuniversities
SHARED TOKENS (10): "activity", "among", "boise", "business", "education", "idaho", "million", "programs", "public", "universities". | EXACT TITLE in land_use_planning: "Boise State University".
0.400
Splash pad ↗ Q7578390 EXACT TITLE
featuresfireneedparkplaypublicqualityrecreationriskwater
SHARED TOKENS (10): "features", "fire", "need", "park", "play", "public", "quality", "recreation", "risk", "water". | EXACT TITLE in outdoor_recreation: "Splash pad".
0.380
boisecanyondepartmentfloodplainsidahomanagementriverwaterwildlife
SHARED TOKENS (9): "boise", "canyon", "department", "floodplains", "idaho", "management", "river", "water", "wildlife". | EXACT TITLE in outdoor_recreation: "Fort Boise Wildlife Management Area".
0.380
centralexamplesgovernmentlandlocalnationalpublicrangesystem
SHARED TOKENS (9): "central", "examples", "government", "land", "local", "national", "public", "range", "system". | EXACT TITLE in outdoor_recreation: "Public land".
0.380
activitybecomeconditionsdevelopedfeaturesfeetparticipationsinglespecialized
SHARED TOKENS (9): "activity", "become", "conditions", "developed", "features", "feet", "participation", "single", "specialized". | EXACT TITLE in outdoor_recreation: "Snowboarding".
0.380
Rafting ↗ Q207238 EXACT TITLE
activitiesactivitybecomedifferenteventexperienceriskriverwater
SHARED TOKENS (9): "activities", "activity", "become", "different", "event", "experience", "risk", "river", "water". | EXACT TITLE in land_use_planning: "Rafting". | EXACT TITLE in outdoor_recreation: "Rafting".
0.360
Cartography ↗ Q42515 EXACT TITLE
designinformationlandmapmapsphysicalroadssystems
SHARED TOKENS (8): "design", "information", "land", "map", "maps", "physical", "roads", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.360
boisedataidahomajormarketproductssouthtogether
SHARED TOKENS (8): "boise", "data", "idaho", "major", "market", "products", "south", "together". | EXACT TITLE in land_use_planning: "Micron Technology".
0.360
conflictdifferentlawphysicalriversourcesystemswater
SHARED TOKENS (8): "conflict", "different", "law", "physical", "river", "source", "systems", "water". | EXACT TITLE in land_use_planning: "Water right".
0.360
commercialcommunitiesdevelopmentlandparksretailsinglesubdivision
SHARED TOKENS (8): "commercial", "communities", "development", "land", "parks", "retail", "single", "subdivision". | EXACT TITLE in land_use_planning: "Subdivision (land)". | EXACT TITLE in outdoor_recreation: "Subdivision (land)".
0.340
Hiking ↗ Q12014035 EXACT TITLE
activitydescribesdevelopedformsorganizationsparkurban
SHARED TOKENS (7): "activity", "describes", "developed", "forms", "organizations", "park", "urban". | EXACT TITLE in outdoor_recreation: "Hiking".
0.340
Wastewater ↗ Q336191 EXACT TITLE
activitiesanothercommercialcommunitydefinitionmunicipalwater
SHARED TOKENS (7): "activities", "another", "commercial", "community", "definition", "municipal", "water". | EXACT TITLE in land_use_planning: "Wastewater".
0.340
agenciesdevelopmentenvironmentalfederalofficeofficesquality
SHARED TOKENS (7): "agencies", "development", "environmental", "federal", "office", "offices", "quality". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.340
Annexation ↗ EXACT TITLE
anothercontrolcurrentdescribeslawmeansphysical
SHARED TOKENS (7): "another", "control", "current", "describes", "law", "means", "physical". | EXACT TITLE in land_use_planning: "Annexation".
0.340
bureauconservationlandlandsmanagementnationalrestrictions
SHARED TOKENS (7): "bureau", "conservation", "land", "lands", "management", "national", "restrictions". | EXACT TITLE in outdoor_recreation: "National Conservation Area".
0.340
Disc golf ↗ Q876737 EXACT TITLE
completecoursecoursesdifferentpathrulestoward
SHARED TOKENS (7): "complete", "course", "courses", "different", "path", "rules", "toward". | EXACT TITLE in outdoor_recreation: "Disc golf".
0.320
Campsite ↗ Q832778 EXACT TITLE
facilitiesgroupmeansparkrelatedroad
SHARED TOKENS (6): "facilities", "group", "means", "park", "related", "road". | EXACT TITLE in outdoor_recreation: "Campsite".
0.320
Drainage ↗ Q7481320 EXACT TITLE
conditionsgrowthlandnaturalneedwater
SHARED TOKENS (6): "conditions", "growth", "land", "natural", "need", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.320
federallawprivateprovideregulatoryvalue
SHARED TOKENS (6): "federal", "law", "private", "provide", "regulatory", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.320
Trout ↗ Q2258881 EXACT TITLE
genericimportantlargerproviderelatedsource
SHARED TOKENS (6): "generic", "important", "larger", "provide", "related", "source". | EXACT TITLE in outdoor_recreation: "Trout".
0.320
Ski resort ↗ Q130003 EXACT TITLE
activityamericadestinationdevelopedexistsystem
SHARED TOKENS (6): "activity", "america", "destination", "developed", "exist", "system". | EXACT TITLE in outdoor_recreation: "Ski resort".
0.320
bicyclecategoriesdesignedfeatureslargertrail
SHARED TOKENS (6): "bicycle", "categories", "designed", "features", "larger", "trail". | EXACT TITLE in outdoor_recreation: "Mountain biking".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
americacommunitycompletedevelopmentemploymentgovernmentgrowthlandnaturalneighborhoodplanningpreservepublicrangeregionalresourcesschoolstransportationurban
SHARED TOKENS (19): "america", "community", "complete", "development", "employment", "government", "growth", "land", "natural", "neighborhood", "planning", "preserve", "public", "range", "regional", "resources", "schools", "transportation", "urban".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencybecomecommercialdevelopmentenvironmentalexpansionformgrowthinfrastructurelandnearbyplanningprivateprotectionrequirerevenueroadssupporttransportationtravel
SHARED TOKENS (21): "agency", "become", "commercial", "development", "environmental", "expansion", "form", "growth", "infrastructure", "land", "nearby", "planning", "private", "protection", "require", "revenue", "roads", "support", "transportation", "travel"....
0.300
activitiesagencyamongbeyondcommunityconservationcontrolgovernmentlicenselicenseslicensingmanagementnaturalregulatoryrequirerequiringresourcerevenue
SHARED TOKENS (18): "activities", "agency", "among", "beyond", "community", "conservation", "control", "government", "license", "licenses", "licensing", "management", "natural", "regulatory", "require", "requiring", "resource", "revenue".
0.300
agenciesauthorityconservationdesigneddevelopmentdifferentdirectseconomicfederalgrowthlawmeansnationalpreservationprotectrequiresruleswildlife
SHARED TOKENS (18): "agencies", "authority", "conservation", "designed", "development", "different", "directs", "economic", "federal", "growth", "law", "means", "national", "preservation", "protect", "requires", "rules", "wildlife".
0.300
Sagebrush steppe ↗ KW CROSS HIGH
becomecommunityerosionfireformhabitatimportantlandlocalopenqualityrecreationrisksourcewaterwildlife
SHARED TOKENS (16): "become", "community", "erosion", "fire", "form", "habitat", "important", "land", "local", "open", "quality", "recreation", "risk", "source", "water", "wildlife".
0.300
accessadditionallybroaderdatadesigneddevelopmentexistformgovernmentinformationmeansprivateprotectionpublicresponsesupportthem
SHARED TOKENS (17): "access", "additionally", "broader", "data", "designed", "development", "exist", "form", "government", "information", "means", "private", "protection", "public", "response", "support", "them".
0.300
businesscentercentraldesigneddevelopmentformgrowthlandnetworkplanningprivatepromotespublicscaleservingspaceurban
SHARED TOKENS (17): "business", "center", "central", "designed", "development", "form", "growth", "land", "network", "planning", "private", "promotes", "public", "scale", "serving", "space", "urban".
0.300
anotherbecomebeganchaindifferentdirectlyeconomymanagementmarketneedopenownershipproductsratherrelatedriversuppliersvertical
SHARED TOKENS (18): "another", "become", "began", "chain", "different", "directly", "economy", "management", "market", "need", "open", "ownership", "products", "rather", "related", "river", "suppliers", "vertical".
0.300
activitiesactivityadministrationagenciesanotherbuiltcontroldecisionseconomiceducationenforcementenvironmentalgovernmentitselflawpublicrulesspecializedstructuresystem
SHARED TOKENS (20): "activities", "activity", "administration", "agencies", "another", "built", "control", "decisions", "economic", "education", "enforcement", "environmental", "government", "itself", "law", "public", "rules", "specialized", "structure", "system".
0.300
agencybureaubusinessdepartmentdevelopmentfederallandlandsmajormanagementmillionnationalofficeoperationsparkprivatesystemwildlife
SHARED TOKENS (18): "agency", "bureau", "business", "department", "development", "federal", "land", "lands", "major", "management", "million", "national", "office", "operations", "park", "private", "system", "wildlife".
0.300
becomechangeconditionconditionsconservationcurrenthabitathistoricalimportantlocalmethodsqualityratherrepairrestorationspacesupportwater
SHARED TOKENS (18): "become", "change", "condition", "conditions", "conservation", "current", "habitat", "historical", "important", "local", "methods", "quality", "rather", "repair", "restoration", "space", "support", "water".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritybicycleconservationcontextsdifferentestategovernmentlandlocalownershippathphysicalprivaterealroadroadsrouteroutesstatusthem
SHARED TOKENS (23): "authority", "bicycle", "conservation", "contexts", "different", "estate", "government", "land", "local", "ownership", "path", "physical", "private", "real", "road", "roads", "route", "routes", "status", "them"....
0.300
adaarmyboisebuiltbureaucanyoncompletedcorpsengineersidahooperatedreclamationrivertreasurevalleywaterwestern
SHARED TOKENS (17): "ada", "army", "boise", "built", "bureau", "canyon", "completed", "corps", "engineers", "idaho", "operated", "reclamation", "river", "treasure", "valley", "water", "western".
0.300
actualcommunityconservationcreatedevelopmentdistrictsenvironmentalgrowthlandmanagementnaturalopenplanningpreservationpreserveprivateresourcesspaceurbanwater
SHARED TOKENS (20): "actual", "community", "conservation", "create", "development", "districts", "environmental", "growth", "land", "management", "natural", "open", "planning", "preservation", "preserve", "private", "resources", "space", "urban", "water".
0.300
activitiesauthoritycapacityconflictscontextsenforcementexercisefederalgovernmentjurisdictionlawmeansmethodsneedphysicalpublicrelatedsafety
SHARED TOKENS (18): "activities", "authority", "capacity", "conflicts", "contexts", "enforcement", "exercise", "federal", "government", "jurisdiction", "law", "means", "methods", "need", "physical", "public", "related", "safety".
0.300
allowsamonganotherbuiltcommunitiescontrolcreatedevelopmentfinanciallocalmakesmunicipalmunicipalitiesneedneighborhoodneighborhoodsplanningprojectproviderather
SHARED TOKENS (24): "allows", "among", "another", "built", "communities", "control", "create", "development", "financial", "local", "makes", "municipal", "municipalities", "need", "neighborhood", "neighborhoods", "planning", "project", "provide", "rather"....
0.300
accommodateconflictconflictscreatingdepartmentdesigneddifferentevenexamplespathpathwayprovideroutetravelurban
SHARED TOKENS (15): "accommodate", "conflict", "conflicts", "creating", "department", "designed", "different", "even", "examples", "path", "pathway", "provide", "route", "travel", "urban".
0.300
accommodateactivitiesconditionsdesigneddifferentemergencyevenformformsprotectionproviderequiresafetyspecializedsupportthemwater
SHARED TOKENS (17): "accommodate", "activities", "conditions", "designed", "different", "emergency", "even", "form", "forms", "protection", "provide", "require", "safety", "specialized", "support", "them", "water".
0.300
environmentalfoundationparkingspacewater
SHARED TOKENS (5): "environmental", "foundation", "parking", "space", "water". | EXACT TITLE in outdoor_recreation: "Boat ramp".
0.300
activityamongapproximatelyboisebureaucanyoncapacitycentercompletedconservationcreatesdirectlyedgefederalfeetformationidahoimportantlocalnampa
SHARED TOKENS (36): "activity", "among", "approximately", "boise", "bureau", "canyon", "capacity", "center", "completed", "conservation", "creates", "directly", "edge", "federal", "feet", "formation", "idaho", "important", "local", "nampa"....
0.300
agenciescommunitiescreatingdistributionenvironmentalfeatureslandmanagementnaturalplanningplayprogramsqualityresourceswaterwatershed
SHARED TOKENS (16): "agencies", "communities", "creating", "distribution", "environmental", "features", "land", "management", "natural", "planning", "play", "programs", "quality", "resources", "water", "watershed".
0.300
approximatelycompletedfeetformnationalofficialparkparksroutescenicsouthstatussystemtrailwestern
SHARED TOKENS (15): "approximately", "completed", "feet", "form", "national", "official", "park", "parks", "route", "scenic", "south", "status", "system", "trail", "western".
0.300
accessadministrationaffectsagencyassetbusinessdepartmentdevelopmentemergencyfederalgovernmentinfrastructurelocalmajormanagementprovideresourcesresponsespacespecialized
SHARED TOKENS (24): "access", "administration", "affects", "agency", "asset", "business", "department", "development", "emergency", "federal", "government", "infrastructure", "local", "major", "management", "provide", "resources", "response", "space", "specialized"....
0.300
accessibilityactivityapproximatelybecomebicycledesigneddistributionenvironmentalexpansionmobilityoperatingoperationalphysicalprovidepublicregulatoryrentalservingsystemsystems
SHARED TOKENS (23): "accessibility", "activity", "approximately", "become", "bicycle", "designed", "distribution", "environmental", "expansion", "mobility", "operating", "operational", "physical", "provide", "public", "regulatory", "rental", "serving", "system", "systems"....
0.300
actualcontextdecisionsdefinesdevelopmentenvironmentalgovernedmajormanagementparticipationprojectpublicratherrequirerules
SHARED TOKENS (15): "actual", "context", "decisions", "defines", "development", "environmental", "governed", "major", "management", "participation", "project", "public", "rather", "require", "rules".
0.300
activityanotherassetsbusinesscapitalcentralcontrolcreatedepartmentdirectentityfederalgovernedgovernmentlawmanagementmarketoperatingoperationsorganization
SHARED TOKENS (26): "activity", "another", "assets", "business", "capital", "central", "control", "create", "department", "direct", "entity", "federal", "governed", "government", "law", "management", "market", "operating", "operations", "organization"....
0.300
commercialdesigneddevelopeddevelopmentdistrictenvironmentallandopenparksplannedplanningpreservationrecreationsitespacessubdivisionurban
SHARED TOKENS (17): "commercial", "designed", "developed", "development", "district", "environmental", "land", "open", "parks", "planned", "planning", "preservation", "recreation", "site", "spaces", "subdivision", "urban".
0.300
agencybeganconservationdepartmenteducationenforcementengineersenvironmentalestablishingfederalfinancialgovernmentinformationlocalmonitoringnationalofficesprogramsprotectionpublic
SHARED TOKENS (21): "agency", "began", "conservation", "department", "education", "enforcement", "engineers", "environmental", "establishing", "federal", "financial", "government", "information", "local", "monitoring", "national", "offices", "programs", "protection", "public"....
0.300
againstamericaamongauthoritybeganconstructiondistrictdistrictseconomiceconomyenvironmentalexerciseexplicitlyjurisdictionlandlocalmajorneighborhoodsoperatingplanning
SHARED TOKENS (26): "against", "america", "among", "authority", "began", "construction", "district", "districts", "economic", "economy", "environmental", "exercise", "explicitly", "jurisdiction", "land", "local", "major", "neighborhoods", "operating", "planning"....
0.300
adaarmybeganboisebuiltbureaucompletedconstructioncontrolcorpsdirectlyengineersfederalfeetformsidahomultiplenearbyoperatingoperational
SHARED TOKENS (28): "ada", "army", "began", "boise", "built", "bureau", "completed", "construction", "control", "corps", "directly", "engineers", "federal", "feet", "forms", "idaho", "multiple", "nearby", "operating", "operational"....
0.300
communitydevelopmentdirectlydistricteconomicinfrastructuremunicipalitiesneedprivateprojectpublicrelatedrevenuetowardvalue
SHARED TOKENS (15): "community", "development", "directly", "district", "economic", "infrastructure", "municipalities", "need", "private", "project", "public", "related", "revenue", "toward", "value".
0.300
approximatelybusinessesconnectedconstructiondesigndevelopeddifferentengineersevenlandmanagementmunicipalneednetworkoperatingqualityrangerequirementssystemsurban
SHARED TOKENS (21): "approximately", "businesses", "connected", "construction", "design", "developed", "different", "engineers", "even", "land", "management", "municipal", "need", "network", "operating", "quality", "range", "requirements", "systems", "urban"....
0.300
accesscleancontroldifferententityfederalformsgovernmentinfrastructurelocalmaintainsmarketmultiplenaturaloperatesorganizationproductspublicscalestatewide
SHARED TOKENS (23): "access", "clean", "control", "different", "entity", "federal", "forms", "government", "infrastructure", "local", "maintains", "market", "multiple", "natural", "operates", "organization", "products", "public", "scale", "statewide"....
0.300
Outdoor gym ↗ Q692630 EXACT TITLE
builtconstructionexerciseparkpublic
SHARED TOKENS (5): "built", "construction", "exercise", "park", "public". | EXACT TITLE in outdoor_recreation: "Outdoor gym".
0.300
amenitydesigndevelopeddevelopmententitygovernmentlandlandsnaturalopenoperatoropportunityprivatepublicratherrelatedsitesitesurban
SHARED TOKENS (19): "amenity", "design", "developed", "development", "entity", "government", "land", "lands", "natural", "open", "operator", "opportunity", "private", "public", "rather", "related", "site", "sites", "urban".
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
anotherauthoritychangecommercialcommunitycontrolcreatingcurrentdistrictdistrictsexercisegovernmentlandlargerlayerlocalmakesprotectprovidepublic
SHARED TOKENS (24): "another", "authority", "change", "commercial", "community", "control", "creating", "current", "district", "districts", "exercise", "government", "land", "larger", "layer", "local", "makes", "protect", "provide", "public"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorycontroldevelopmentexpansionfinanciallong-termmanagementoperationalownershipprivateproductsprovidepublicratherrolespecialized
SHARED TOKENS (18): "business", "capital", "category", "control", "development", "expansion", "financial", "long-term", "management", "operational", "ownership", "private", "products", "provide", "public", "rather", "role", "specialized".
0.300
Cycling ↗ Q53121 EXACT TITLE
activitybalancebicycleexerciserecreation
SHARED TOKENS (5): "activity", "balance", "bicycle", "exercise", "recreation". | EXACT TITLE in outdoor_recreation: "Cycling".
0.300
approximatelybeganboisebureaucapacitycentercompletedconstructiondesignfeethomeidaholawmonthsnationaloperatedprovidereclamationreservoirresource
SHARED TOKENS (27): "approximately", "began", "boise", "bureau", "capacity", "center", "completed", "construction", "design", "feet", "home", "idaho", "law", "months", "national", "operated", "provide", "reclamation", "reservoir", "resource"....
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
communitycoverscreatingdesigndevelopmentestatefacilitiesinfrastructurelandmunicipalneighborhoodopenplanningpreservationpromotesrangerealregionalridesafe
SHARED TOKENS (24): "community", "covers", "creating", "design", "development", "estate", "facilities", "infrastructure", "land", "municipal", "neighborhood", "open", "planning", "preservation", "promotes", "range", "real", "regional", "ride", "safe"....
0.300
accesscommunitycompletedesigndesignedeconomicengineersenvironmentalhomeoperatedplannedpublicrelatedrequiressafesafetytraffictransportationtravelurban
SHARED TOKENS (20): "access", "community", "complete", "design", "designed", "economic", "engineers", "environmental", "home", "operated", "planned", "public", "related", "requires", "safe", "safety", "traffic", "transportation", "travel", "urban".
0.300
conditionsdefinedifferenteventeventsformformshistoryinformallargermethodspatternplayshapestatusstructurestakes
SHARED TOKENS (17): "conditions", "define", "different", "event", "events", "form", "forms", "history", "informal", "larger", "methods", "pattern", "play", "shape", "status", "structures", "takes".
0.300
commercialconstructioncontextcreatesdesigndeterminedevelopmentdifferenteconomicengineersenvironmentalestatefinancialgrowthlandpermitsplanningpublicrealregulatory
SHARED TOKENS (25): "commercial", "construction", "context", "creates", "design", "determine", "development", "different", "economic", "engineers", "environmental", "estate", "financial", "growth", "land", "permits", "planning", "public", "real", "regulatory"....
0.300
authoritybusinesscapitalcommercialestatelandlocalmultipleofficeofficesrealrentalretailspaceurban
SHARED TOKENS (15): "authority", "business", "capital", "commercial", "estate", "land", "local", "multiple", "office", "offices", "real", "rental", "retail", "space", "urban".
🫐 BERRY56 edges
0.280
Street network ↗ Q358078 KW CROSS HIGH
becomeconnectedcreatingedgesfoundationnationalnetworknodesroadsroutestreetsystemtraffictransportation
SHARED TOKENS (14): "become", "connected", "creating", "edges", "foundation", "national", "network", "nodes", "roads", "route", "street", "system", "traffic", "transportation".
0.280
Boating ↗ Q2141830 EXACT TITLE
activitiesactivityitselftravel
SHARED TOKENS (4): "activities", "activity", "itself", "travel". | EXACT TITLE in outdoor_recreation: "Boating".
0.280
activitiesconservationmanagementwildlife
SHARED TOKENS (4): "activities", "conservation", "management", "wildlife". | EXACT TITLE in outdoor_recreation: "Wildlife management area".
0.280
activityformmethodspublic
SHARED TOKENS (4): "activity", "form", "methods", "public". | EXACT TITLE in outdoor_recreation: "Birdwatching".
0.280
governedroadtakestrail
SHARED TOKENS (4): "governed", "road", "takes", "trail". | EXACT TITLE in outdoor_recreation: "Trail running".
0.280
Eminent domain ↗ Q166332 KW CROSS HIGH
anotherconnectdevelopmenteasementsevenexercisegovernmentlandmunicipalitiesownershipprivatepublicrequireroads
SHARED TOKENS (14): "another", "connect", "development", "easements", "even", "exercise", "government", "land", "municipalities", "ownership", "private", "public", "require", "roads".
0.280
activityrecreationshapewater
SHARED TOKENS (4): "activity", "recreation", "shape", "water". | EXACT TITLE in outdoor_recreation: "Tubing (recreation)".
0.280
developmentlandmunicipalrules
SHARED TOKENS (4): "development", "land", "municipal", "rules". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.260
eagleidahopark
SHARED TOKENS (3): "eagle", "idaho", "park". | EXACT TITLE in outdoor_recreation: "Eagle Island State Park".
0.260
constructiondevelopmenteconomyemploymentexpansiongovernmentlawlocalnationalpermitsplanningregionalurban
SHARED TOKENS (13): "construction", "development", "economy", "employment", "expansion", "government", "law", "local", "national", "permits", "planning", "regional", "urban".
0.260
agencygovernmentlaw
SHARED TOKENS (3): "agency", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)".
0.260
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
boisebureauengineersfeetidahonationaloperatedprovidereclamationreservoirriverwaterwestern
SHARED TOKENS (13): "boise", "bureau", "engineers", "feet", "idaho", "national", "operated", "provide", "reclamation", "reservoir", "river", "water", "western".
0.260
authoritygovernmentunusually
SHARED TOKENS (3): "authority", "government", "unusually". | EXACT TITLE in land_use_planning: "Judicial review".
0.260
capacitycurrentdataemploymentenvironmentalfinancialinfrastructureplannedplanningroadtraffictransportationtravel
SHARED TOKENS (13): "capacity", "current", "data", "employment", "environmental", "financial", "infrastructure", "planned", "planning", "road", "traffic", "transportation", "travel".
0.250
agencydepartmentidahopreservingwildlife
SHARED TOKENS (5): "agency", "department", "idaho", "preserving", "wildlife". | URL->B (1): https://idfg.idaho.gov/.
0.240
bicyclecategoriescontrollicensinglocalneedphysicalrangeratherrequiresafetythem
SHARED TOKENS (12): "bicycle", "categories", "control", "licensing", "local", "need", "physical", "range", "rather", "require", "safety", "them".
0.240
Trailhead ↗ Q7832815 KW CROSS HIGH
accessdefinesdistributionentityfeaturesmajormapsparkingpathwaysspacetraffictrail
SHARED TOKENS (12): "access", "defines", "distribution", "entity", "features", "major", "maps", "parking", "pathways", "space", "traffic", "trail".
0.220
activityallowsdatadistributionexampleshabitatinformationrecreationreportingspecializedwildlife
SHARED TOKENS (11): "activity", "allows", "data", "distribution", "examples", "habitat", "information", "recreation", "reporting", "specialized", "wildlife".
0.220
Parcel ↗ EXACT TITLE
geographyland
SHARED TOKENS (2): "geography", "land". | EXACT TITLE in land_use_planning: "Parcel".
0.220
informationmapping
SHARED TOKENS (2): "information", "mapping". | EXACT TITLE in land_use_planning: "Soil survey".
0.220
approximatelyboisedatadistrictdistrictsevengovernmentidahoresidentssinglesouth
SHARED TOKENS (11): "approximately", "boise", "data", "district", "districts", "even", "government", "idaho", "residents", "single", "south".
0.220
districtland
SHARED TOKENS (2): "district", "land". | EXACT TITLE in land_use_planning: "Special-use permit".
0.220
Skiing ↗ Q130949 EXACT TITLE
activityevents
SHARED TOKENS (2): "activity", "events". | EXACT TITLE in outdoor_recreation: "Skiing".
0.210
major
SHARED TOKENS (1): "major". | EXACT TITLE in land_use_planning: "Sekisui House".
0.210
Kayaking ↗ Q2094083 EXACT TITLE
water
SHARED TOKENS (1): "water". | EXACT TITLE in outdoor_recreation: "Kayaking".
0.200
adaboisecanyonhomeidaholargermeridiannampatreasurevalley
SHARED TOKENS (10): "ada", "boise", "canyon", "home", "idaho", "larger", "meridian", "nampa", "treasure", "valley".
0.200
authoritydistrictdistrictsentitygovernmentlandslocalpublicsubdivisionwater
SHARED TOKENS (10): "authority", "district", "districts", "entity", "government", "lands", "local", "public", "subdivision", "water".
0.200
completecontextcoursecoursesfeaturesfeetriskrocksingletravel
SHARED TOKENS (10): "complete", "context", "course", "courses", "features", "feet", "risk", "rock", "single", "travel".
0.200
amongcontrolexamplesgovernmentjurisdictionlawlocalmunicipalresponseurban
SHARED TOKENS (10): "among", "control", "examples", "government", "jurisdiction", "law", "local", "municipal", "response", "urban".
0.200
activitybuiltdevelopedenvironmentallandnaturalpublicriskurbanwildfire
SHARED TOKENS (10): "activity", "built", "developed", "environmental", "land", "natural", "public", "risk", "urban", "wildfire".
0.200
agencydepartmentdepartmentsdevelopmentdirectlyfederalgovernmenthomereportsurban
SHARED TOKENS (10): "agency", "department", "departments", "development", "directly", "federal", "government", "home", "reports", "urban".
0.180
Leave No Trace ↗ Q559348 KW CROSS HIGH
centerconservationcreateframeworkrecreationresourcesresponsetravelwildlife
SHARED TOKENS (9): "center", "conservation", "create", "framework", "recreation", "resources", "response", "travel", "wildlife".
0.180
Nordic skiing ↗ Q216613 KW CROSS HIGH
allowsattachedeventeventsjurisdictionrequirementsrequiresrulestraining
SHARED TOKENS (9): "allows", "attached", "event", "events", "jurisdiction", "requirements", "requires", "rules", "training".
0.180
boisedowntownhomeidahomajorrangeriverrouteroutes
SHARED TOKENS (9): "boise", "downtown", "home", "idaho", "major", "range", "river", "route", "routes".
0.160
backcommunitydesigneddifferentexperiencerequiresriverwater
SHARED TOKENS (8): "back", "community", "designed", "different", "experience", "requires", "river", "water".
0.160
Fly fishing ↗ Q898886 KW CROSS HIGH
differentformshabitatnaturalopenspecializedtargetswater
SHARED TOKENS (8): "different", "forms", "habitat", "natural", "open", "specialized", "targets", "water".
0.160
Bicycle safety ↗ Q516366 KW CROSS HIGH
bicycleeventinfrastructuremultipleriskroadsafetytraffic
SHARED TOKENS (8): "bicycle", "event", "infrastructure", "multiple", "risk", "road", "safety", "traffic".
0.160
businessdevelopmentestateofficeofficesparkplannedrather
SHARED TOKENS (8): "business", "development", "estate", "office", "offices", "park", "planned", "rather".
0.140
activitiesbeyondconstructioncontextseventsroadstransportation
SHARED TOKENS (7): "activities", "beyond", "construction", "contexts", "events", "roads", "transportation".
0.140
Nampa, Idaho ↗ Q622633 KW CROSS HIGH
boisecanyonhomeidahomeridiannampawestern
SHARED TOKENS (7): "boise", "canyon", "home", "idaho", "meridian", "nampa", "western".
0.140
Snowshoe ↗ Q214724 KW CROSS HIGH
allowsratherrecreationrolespecializedthemtravel
SHARED TOKENS (7): "allows", "rather", "recreation", "role", "specialized", "them", "travel".
0.140
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahoschoolsstar
SHARED TOKENS (7): "ada", "boise", "canyon", "district", "idaho", "schools", "star".
0.140
Green belt ↗ KW CROSS HIGH
developmentlandparkplanningspaceurbanwildlife
SHARED TOKENS (7): "development", "land", "park", "planning", "space", "urban", "wildlife".
0.140
activitiescommerciallicenselicensinglocalmanagementwestern
SHARED TOKENS (7): "activities", "commercial", "license", "licensing", "local", "management", "western".
0.120
actualcurrentestatemarketrealvalue
SHARED TOKENS (6): "actual", "current", "estate", "market", "real", "value".
0.120
additionalattachedgardenhomeprovidesupport
SHARED TOKENS (6): "additional", "attached", "garden", "home", "provide", "support".
0.120
changecontextsratherrelationshipssystemsystems
SHARED TOKENS (6): "change", "contexts", "rather", "relationships", "system", "systems".
0.120
groupinformationnationalpromotesurbanwater
SHARED TOKENS (6): "group", "information", "national", "promotes", "urban", "water".
0.120
approximatelyboisecaldwellcanyonidaholocally
SHARED TOKENS (6): "approximately", "boise", "caldwell", "canyon", "idaho", "locally".
0.120
Swimming hole ↗ Q7658373 KW CROSS HIGH
activitybecomehistorynaturalriverwater
SHARED TOKENS (6): "activity", "become", "history", "natural", "river", "water".
0.100
coversidaholandmajorriver
SHARED TOKENS (5): "covers", "idaho", "land", "major", "river".
0.100
merelyownershipsourcesystemwater
SHARED TOKENS (5): "merely", "ownership", "source", "system", "water".
0.100
Native species ↗ Q169480 KW CROSS HIGH
economicenvironmentalhistorylocalnatural
SHARED TOKENS (5): "economic", "environmental", "history", "local", "natural".
0.100
Right to property ↗ KW CROSS HIGH
economicnaturalownershipprivateprotection
SHARED TOKENS (5): "economic", "natural", "ownership", "private", "protection".
0.100
conservationhabitatmanagementprotectrange
SHARED TOKENS (5): "conservation", "habitat", "management", "protect", "range".
0.100
Wild camping ↗ Q2755308 KW CROSS HIGH
formmeansopensitestrail
SHARED TOKENS (5): "form", "means", "open", "sites", "trail".
◈ Frequently Asked Questions
Land Use Planning × Outdoor Recreation — Treasure Valley
HAIKU · HIGH GATE
How do Ada County and Canyon County land use plans affect public access to the Boise River?
Ada County and Canyon County coordinate zoning decisions that determine whether riparian zones along the Boise River remain public or transition to private development. The Bureau of Reclamation manages water delivery through this corridor, and local planners must balance irrigation infrastructure with public recreation corridors that connect Boise, Garden City, Eagle, Kuna, and Meridian.
What role does the Boise National Forest play in Treasure Valley outdoor recreation planning?
The Boise National Forest supplies the primary mountain recreation destinations for Ada County residents within a 30-minute drive, making its federal management agreements directly relevant to local land use decisions about trail connectivity and access points. Ada County and Canyon County planners coordinate lower-elevation trail networks that feed into national forest boundaries to create continuous outdoor recreation systems.
How do conservation easements in the Treasure Valley preserve land for outdoor recreation?
Conservation easements across Ada County and Canyon County restrict development on private lands while allowing public recreation uses like hiking and fishing, creating buffers around the Boise River and its riparian zones. These easements often involve coordination between local governments in Eagle, Meridian, and Boise and federal agencies like the United States Army Corps of Engineers to maintain water management access for both irrigation and recreation.
Why does the Bureau of Reclamation's infrastructure affect land use planning for recreation in the Treasure Valley?
The Bureau of Reclamation operates dams and irrigation systems throughout the Treasure Valley that determine water levels in the Boise River, which directly constrains when and where water-based recreation occurs in Ada County and Canyon County. Local land use plans in Boise, Garden City, and other municipalities must schedule trail maintenance, event permits, and access improvements around the Bureau's operational schedules rather than year-round availability.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Land Use Planning × Outdoor Recreation 14 QID bridges 196 edges 5,049 ext links 2026-07-17 21:42:54 UTC c1212c49e3697c59
Land Use Planning corridor ↗ Outdoor Recreation corridor ↗ Outdoor Recreation × Land Use Planning ↗ boisestandard.org/standard ↗
Parent Corridors
Land Use Planning × All Other Verticals