—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Land Use Planning ↔ relates to ↔ Nuclear Clean Energy

20 Wikipedia bridge articles confirmed in both vertical ledgers. 252 deterministic cross-vertical edges. 6,572 external source links harvested. Every edge provenance-stamped. Every claim auditable.

20 QID Bridge Articles
252 Cross Edges
6,572 External Sources
280 Wikipedia Articles
21 🌲 Evergreen
193 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Land Use Planning
× Nuclear Clean Energy
QID Bridge Articles
20
confirmed Wikipedia overlap
Total Cross Edges
252
External Sources Harvested
6,572
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
University of Idaho
score: 1.0000  ·  type: exact_title_cross  ·  20 shared tokens
QID Bridge Titles (20)
University of IdahoBureau of ReclamationMicron TechnologyBoise State UniversityNational Environmental Policy ActClean Water ActBuilding codeIrrigationTreasure ValleyWater rightBoise RiverUnited States Environmental Protection AgencyBoise, IdahoAda County, IdahoNampa, IdahoCaldwell, IdahoSnake River PlainCanyon County, IdahoMeridian, IdahoKuna, Idaho
Shared Semantics (20 tokens)
idahoboisemetropolitanpopulationriverlawenvironmentalpublicresearchfederallargestwaterwesternmajorlocalagriculturaladaeastamongapproximately
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:42:46 UTC
Content Hash
25c60bc348373e16
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
20 BRIDGES
U
Q1854488 EXACT TITLE 1.000
QID OVERLAP: Q1854488 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (20): "among", "approximately", "boise", "division", "established", "falls", "graduate", "idaho", "later", "operates", "production", "professional", "public", "research", "rural", "statewide", "students", "uidaho", "undergraduate", "university". | EXACT TITLE in land_use_planning: "University of Idaho". | EXACT TITLE in nuclear_clean_energy: "University of Idaho".
amongapproximatelyboisedivisionestablishedfallsgraduateidaholateroperatesproductionprofessionalpublicresearchruralstatewidestudentsuidahoundergraduateuniversity
niversity comprises ten undergraduate, graduate, and professional schools. It enrolls approximately 12,000 students across its campuses, with 11,000 on the Moscow campus. The university is classified among "R1: Very High Spending and Doctorate Production". Located on the rural Palouse, the university is represented in intercollegiate athletics by the Idaho Vandals, who compete in NCAA Division I, primarily in the Big Sky Conference.
Under the elms Rare Camperdown elms line the walkway between the Music building, Nichols Building (home to Family and Consumer Sciences) and Administration Building. These "upside-down" trees have been on campus for over 80 years and are among few of their kind in the Northwest. The weeping branches and knotty trunk are formed by being grafted upwards. Steam plant Built in 1926, the steam plant provides heat to U of I buildings from a single location. Originally designed to burn coal, then oil, then natural gas, the plant was modified in 1986 to burn waste wood chips left over from local sawmills. The use of wood has significantly reduced the emissions of the plant, as well as cut costs to heat the campus. The plant is shut down twice a year for cleaning and maintenance.
College of Agricultural and Life Sciences (CALS, renamed 2001, formerly Agriculture (1901)) College of Art and Architecture (1981) College of Business and Economics (CBE, 1925) College of Education, Health and Human Sciences (EHH S,1920) College of Engineering (1911) College of Graduate Studies (COGS) College of Law (1909) College of Letters, Arts, and Social Sciences (CLASS, 2002, formed after split of Letters and Science (1900)) College of Natural Resources (CNR, renamed 2000, formerly Forestry, Wildlife, & Range Sciences, originally Forestry (1917)) College of Science (2002, formed after split of Letters and Science, and dissolution of Mines and Earth Resources) School of Health and Medical Professions (SHAMP, 2024) In July 2002, the College of Letters & Science was split into two separate colleges: the College of Science and the College of Letters, Arts, and Social Sciences (CLASS). Concurrently, the College of Mines and Earth Resources was discontinued; its programs were split between the College of Engineering and the new College of Science. The College of Law opened a second campus in Boise in 2010. Initially, the Boise campus only offered third-year classes. It expanded to offer second-year classes in 2014, and as of 2017–18, law students can take their entire three-year curriculum at either location. For the 2024–2025 academic year, the middle 50% of enrolled students scored between 1030 and 1330 on the SAT (with a 50th percentile of 1180), between 510 and 670 on the SAT Evidence-Based Reading and Writing section (50th percentile: 590), and between 520 and 660 on the SAT Math section (50th percentile: 590). Reputation and rankings U.S. News & World Report ranks U of I tied for 89th among the nation's best public universities and tied for 179th among the best national universities in its 2020 report. In 2024, Washington Monthly ranked U of I 83rd among 438 national universities in the U.S. based on U of I's contribution to the public good, as measured by social mobility, research, and promoting public service. In 2025, the Carnegie Classification listed University of Idaho among "R1 Doctoral Universities – Very high research spending and doctorate production", among with other 186 universities. The University of Idaho is included in the 2021 edition of Princeton Review's "Best 386 Colleges." The Princeton Review also ranks U-Idaho as one of the nation's top 286 environmentally responsible colleges. The university was named by the Corporation for National and Community Service to the 2010 President's Higher Education Community Service Honor Roll for exemplary service efforts—more than 3,800 students volunteered more than 150,000 hours to community and service-learning.
Bureau of Reclamation
Q1010548 EXACT TITLE 1.000
QID OVERLAP: Q1010548 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (28): "act", "become", "built", "delivery", "department", "development", "established", "federal", "funding", "government", "irrigation", "june", "largest", "law", "management", "operation", "potential", "power", "program", "projects".... | EXACT TITLE in land_use_planning: "Bureau of Reclamation".
actbecomebuiltdeliverydepartmentdevelopmentestablishedfederalfundinggovernmentirrigationjunelargestlawmanagementoperationpotentialpowerprogramprojectsprovisionsreclamationresourcerevenuesourcesupplywaterwestern
the nation's vegetables and 25% of its fruits and nuts. The bureau is also the second largest producer of hydroelectric power in the western U.S. On June 17, 1902, in accordance with the Reclamation Act, Secretary of the Interior Ethan Allen Hitchcock established the U.S. Reclamation Service within the U.S. Geological Survey (USGS). The new Reclamation Service studied potential water development projects in each western state with federal lands. Revenue from sale of federal lands was the initial source of the program's funding.
ial source of the program's funding. Because Texas had no federal lands, it did not become a Reclamation state until 1906, when Congress passed a law including it in the provisions of the Reclamation Act. History From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
From 1902 to 1907, Reclamation began about 30 projects in Western states. Then, in 1907, the Secretary of the Interior separated the Reclamation Service from the USGS and created an independent bureau within the Department of the Interior. Frederick Haynes Newell was appointed the first director of the new bureau. Beginning with the third person to take over the direction of Reclamation in 1923, David W. Davis, the title was changed from Director to Commissioner. In the early years, many projects encountered problems: lands or soils included in projects were unsuitable for irrigation; land speculation sometimes resulted in poor settlement patterns; proposed repayment schedules could not be met by irrigators who had high land-preparation and facilities-construction costs; settlers were inexperienced in irrigation farming; waterlogging of irrigable lands required expensive drainage projects; and projects were built in areas which could only grow low-value crops. In 1923 the agency was renamed the "Bureau of Reclamation". In 1924, however, in the face of increasing settler unrest and financial woes, the "Fact Finder's Report" spotlighted major problematic issues; the Fact Finders Act in late 1924 sought to resolve some of these problems. In 1928 Congress authorized the Boulder Canyon (Hoover Dam) Project, and large appropriations began, for the first time, to flow to Reclamation from the general funds of the United States. The authorization came only after a hard-fought debate about the pros and cons of public power versus private power. The heyday of Reclamation construction of water facilities occurred during the Depression and the 35 years after World War II. From 1941 to 1947, Civilian Public Service labor was used to carry on projects otherwise interrupted by the war effort. The last major authorization for construction projects occurred in the late 1960s, while a parallel evolution and development of the American environmental movement began to result in strong opposition to water development projects. Even the 1976 failure of Teton Dam as it filled for the first time did not diminish Reclamation's strong international reputation in water development circles. However, this first and only failure of a major Reclamation Bureau dam led to subsequent strengthening of its dam-safety program to avoid similar problems. Even so, the failure of Teton Dam, the environmental movement, and the announcement of President Carter's "hit list" on water projects profoundly affected the direction of Reclamation's programs and activities. Reclamation operates about 180 projects in the 17 western states. The total Reclamation investment for completed project facilities in September 1992 was about $11 billion. Reclamation projects provide agricultural, household, and industrial water to about one‑third of the population of the American West. About 5% of the land area of the West is irrigated, and Reclamation provides water to about one-fifth of that area, some 9,120,000 acres (37,000 km2) in 1992. Reclamation is a major American generator of electricity. As of 2007, Reclamation had 58 power plants on‑line and generated 125,000 GJ of electricity. From 1988 to 1994, Reclamation underwent major reorganization as construction on projects authorized in the 1960s and earlier drew to an end. Reclamation wrote that "The arid West essentially has been reclaimed. The major rivers have been harnessed and facilities are in place or are being completed to meet the most pressing current water demands and those of the immediate future". Emphasis in Reclamation programs shifted from construction to operation and maintenance of existing facilities. Reclamation's redefined official mission is to "manage, develop, and protect water and related resources in an environmentally and economically sound manner in the interest of the American public".
Micron Technology
Q1197548 EXACT TITLE 1.000
QID OVERLAP: Q1197548 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (16): "american", "boise", "consumer", "created", "data", "demand", "idaho", "major", "market", "micron", "owned", "produced", "semiconductor", "served", "technology", "together". | EXACT TITLE in land_use_planning: "Micron Technology". | EXACT TITLE in nuclear_clean_energy: "Micron Technology".
americanboiseconsumercreateddatademandidahomajormarketmicronownedproducedsemiconductorservedtechnologytogether
Micron Technology, Inc. is an American multinational semiconductor company that manufactures computer memory and computer data storage products, including dynamic random-access memory (DRAM), flash memory, High Bandwidth Memory (HBM), and solid-state drives (SSDs). Founded in 1978 in Boise, Idaho, Micron is the only major American computer memory manufacturer. It is one of the "Big Three" computer memory manufacturers, along with the South Korean companies Samsung Electronics and SK Hynix. Micron marketed its consumer products under the brand Crucial, with the sub-brand Ballistix being used to denote products targeting gaming computers, until its disestablishment on 2026. Micron and Intel together created IM Flash Technologies, which produced NAND flash memory. It owned Lexar between 2006 and 2017. Sanjay Mehrotra has served as president and CEO of Micron since 2017. On May 26, 2026, Micron became the latest U.S.
Since 2000 In 2000, Gurtej Singh Sandhu and Trung T. Doan at Micron initiated the development of atomic layer deposition high-k films for DRAM memory devices. This helped drive cost-effective implementation of semiconductor memory, starting with 90 nm node DRAM. Pitch double-patterning was also pioneered by Gurtej Singh Sandhu at Micron during the 2000s, leading to the development of 30-nm class NAND flash memory, and it has since been widely adopted by NAND flash and RAM manufacturers worldwide. In 2002, Micron spun off its personal computer business as MPC Corporation and put it up for sale. The company found the business difficult as the number 12 American computer maker with only 1.3 percent of the market. Micron and Intel created a joint venture in 2005, based in IM Flash Technologies in Lehi, Utah. The two companies formed another joint venture in 2011, IM Flash Singapore, in Singapore. In 2012 Micron became sole owner of this second joint venture. In 2006 Micron acquired Lexar, an American manufacturer of digital media products. The company changed leadership again in June 2007 with COO Mark Durcan becoming president. In 2008, Micron converted the Avezzano chip fab, formerly a Texas Instruments DRAM fab, into a production facility for CMOS image sensors sold by Aptina Imaging. In 2008, Micron spun off Aptina Imaging, which was acquired by ON Semiconductor in 2014. Micron retained a stake in the spinoff. However, the core company suffered setbacks and had to lay off 15 percent of its workforce in October 2008, during which period the company also announced the purchase of Qimonda's 35.6 percent stake in Inotera Memories for $400 million. The trend of layoffs and acquisitions continued in 2009 with the termination of an additional 2,000 employees, and the acquisition of the FLCOS microdisplay company Displaytech. Micron agreed to buy flash-chip maker Numonyx for $1.27 billion in stock in February 2010. On February 3, 2012, CEO Appleton died in a plane crash shortly after takeoff from the Boise Airport. He was the pilot and sole occupant of the Lancair IV aircraft. Mark Durcan replaced Appleton as the CEO shortly thereafter, eliminating his former title of president. In 2013, the Avezzano chip fab was sold to LFoundry. In the 2012 to 2014 period, Micron again went through an acquisition-layoff cycle, becoming the majority shareholder of Inotera Memories, purchasing Elpida Memory for $2 billion and the remaining shares in Rexchip, a PC memory chip manufacturing venture between Powerchip and Elpida Memory for $334 million, while announcing plans to lay off approximately 3,000 workers. Through the Elpida acquisition, Micron became a major supplier to Apple Inc. for the iPhone and iPad. In December 2016 Micron finished acquiring the remaining 67 percent of Inotera, making it a 100 percent subsidiary of Micron. In April 2017, Micron announced Sanjay Mehrotra as the new president and CEO to replace Mark Durcan. In June 2017 Micron announced it was discontinuing the Lexar retail removable media storage business and putting some or all of it up for sale. In August of that year the Lexar brand was acquired by Longsys, a flash memory company based in Shenzhen, China. In May 2018, Micron Technology and Intel launched QLC NAND memory to increase storage density. The company ranked 150th on the Fortune 500 list of largest United States corporations by revenue. In February 2019, the first microSD card with a storage capacity of 1 terabyte (TB) was announced by Micron. As of March 2020 3.84TB Micron 5210 Ion is the cheapest large-capacity SSD in the world. In September 2020 the company introduced the world's fastest discrete graphics memory solution. Working with computing technology leader Nvidia, Micron debuted GDDR6X in the Nvidia GeForce RTX 3090 and GeForce RTX 3080 graphics processing units (GPUs). In November 2020, the company unveiled a new 176-layer 3D NAND module. It offers improved read and write latency and is slated to be used in the production of a new generation of solid-state drives. On October 22, 2021, Micron closed the sale of IM Flash's Lehi, Utah fab to Texas Instruments for a sale price of US$900 million. In February 2022, Micron announced that it would discontinue its Ballistix gaming brand. With the passage of the CHIPS and Science Act, Micron announced its pledge to invest billions in new manufacturing within the United States. In September 2022, Micron announced it would invest $15 billion in a new facility in Boise, Idaho. In October 2022, Micron announced a $100 billion expansion in Clay, New York. Micron Technology owed Netlist, Inc. $445 million in damages for infringing Netlist's patents related to memory-module technology for high-performance computing. The jury found that Micron's semiconductor-memory products violated two of Netlist's patents willfully, potentially allowing the judge to triple the damages. Netlist had sued Micron in 2022, accusing three of its memory-module lines of patent infringement, which Micron denied, also arguing the patents' invalidity. The U.S.
n since 2017. On May 26, 2026, Micron became the latest U.S. company to reach a US$1 trillion market capitalization, amid surging demand for its HBM chips. History 1978–1999 Micron was founded in Boise, Idaho, in 1978 by Ward Parkinson, Joe Parkinson, Dennis Wilson, and Doug Pitman as a semiconductor design consulting company. Startup funding was provided by local Idaho businessmen Tom Nicholson, Allen Noble, Rudolph Nelson, and Ron Yanke. Later it received funding from Idaho billionaire J. R. Simplot, whose fortune was made in the potato business. In 1981, the company moved from consulting to manufacturing with the completion of its first wafer fabrication unit ("Fab 1"), producing 64K DRAM chips. In 1984, the company had its initial public offering. Micron sought to enter the market for RISC processors in 1991 with a product known as FRISC, targeting embedded control and signal processing applications. Running at 80 MHz and described as "a 64-bit processor with fast context-switching time and high floating-point performance", the design supported various features for timely interrupt handling and featured an arithmetic unit capable of handling both integer and floating-point calculations with a claimed throughput of 80 MFLOPS for double-precision arithmetic. Micron aimed to provide a "board-level demonstration supercomputer" in configurations with 256 MB or 1 GB of RAM. Having set up a subsidiary and with the product being designed into graphics cards and accelerators, Micron concluded in 1992 that the effort would not deliver the "best bang for the buck", reassigning engineers to other projects and discontinuing the endeavour. In 1994, founder Joe Parkinson retired as CEO and Steve Appleton took over as Chairman, President, and CEO. A 1996 3-way merger among ZEOS International, Micron Computer, and Micron Custom Manufacturing Services (MCMS) increased the size and scope of the company; this was followed rapidly with the 1997 acquisition of NetFrame Systems, in a bid to enter the mid-range server industry.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (22): "activity", "among", "awards", "boise", "business", "college", "division", "economics", "education", "engineering", "graduate", "health", "idaho", "independent", "master", "program", "programs", "public", "reported", "research".... | EXACT TITLE in land_use_planning: "Boise State University". | EXACT TITLE in nuclear_clean_energy: "Boise State University".
activityamongawardsboisebusinesscollegedivisioneconomicseducationengineeringgraduatehealthidahoindependentmasterprogramprogramspublicreportedresearchuniversitiesuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
National Environmental Policy Act
Q6972479 EXACT TITLE 1.000
QID OVERLAP: Q6972479 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (30): "act", "action", "authority", "council", "created", "december", "decisions", "effects", "environmental", "established", "evaluate", "federal", "final", "government", "impacts", "january", "law", "modeled", "national", "policy".... | EXACT TITLE in land_use_planning: "National Environmental Policy Act".
actactionauthoritycouncilcreateddecemberdecisionseffectsenvironmentalestablishedevaluatefederalfinalgovernmentimpactsjanuarylawmodelednationalpolicypotentialproceduralproposedqualityreportsrequirementrequirementsrequiresresponsibilitysignificant
The National Environmental Policy Act (NEPA) is a United States environmental law designed to promote the enhancement of the environment. It created new laws requiring U.S. federal government agencies to evaluate the environmental impacts of their actions and decisions, and it established the President's Council on Environmental Quality (CEQ). The act was passed by the U.S. Congress in December 1969 and signed into law by President Richard Nixon on January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
Environmental Quality (CEQ). The act was passed by the U.S. Congress in December 1969 and signed into law by President Richard Nixon on January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
January 1, 1970. More than 100 nations around the world have enacted national environmental policies modeled after NEPA. NEPA requires federal agencies to evaluate the environmental effects of their actions. NEPA's most significant outcome was the requirement that all executive federal agencies prepare environmental assessments (EAs) and environmental impact statements (EISs). These reports state the potential environmental effects of proposed federal agency actions. Further, U.S. Congress recognizes that each person has a responsibility to preserve and enhance the environment as trustees for succeeding generations. NEPA's procedural requirements do not apply to the president, Congress, or the federal courts since they are not a "federal agency" by definition.
Clean Water Act
Q2978742 EXACT TITLE 1.000
QID OVERLAP: Q2978742 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (31): "act", "addressing", "administered", "changes", "clean", "conservation", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "groundwater", "law", "maintain", "major", "modern".... | EXACT TITLE in land_use_planning: "Clean Water Act".
actaddressingadministeredchangescleanconservationcontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninggroundwaterlawmaintainmajormodernownedphysicalprotectionprovisionsqualityregulationsresourcetreatmentwastewaterwater+1
The Clean Water Act (CWA) is the primary federal law in the United States governing water pollution. Its objective is to restore and maintain the chemical, physical, and biological integrity of the nation's waters; recognizing the primary responsibilities of the states in addressing pollution and providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
d providing assistance to states to do so, including funding for publicly owned treatment works for the improvement of wastewater treatment; and maintaining the integrity of wetlands. The Clean Water Act was one of the first and most influential modern environmental laws in the United States. Its laws and regulations are primarily administered by the U.S. Environmental Protection Agency (EPA) in coordination with state governments, though some of its provisions, such as those involving filling or dredging, are administered by the U.S. Army Corps of Engineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
ngineers. Its implementing regulations are codified at 40 C.F.R. Subchapters D, N, and O (Parts 100–140, 401–471, and 501–503). Technically, the name of the law is the Federal Water Pollution Control Act. The first FWPCA was enacted in 1948, but took on its modern form when completely rewritten in 1972 in an act entitled the Federal Water Pollution Control Act Amendments of 1972. Major changes have subsequently been introduced via amendatory legislation including the Clean Water Act of 1977 and the Water Quality Act (WQA) of 1987. The Clean Water Act does not directly address groundwater contamination.
Building code
Q2333573 EXACT TITLE 1.000
QID OVERLAP: Q2333573 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (48): "adopted", "approved", "authority", "becomes", "building", "buildings", "code", "codes", "compliance", "construction", "control", "council", "departments", "design", "designers", "developers", "district", "effects", "electrical", "engineers".... | EXACT TITLE in land_use_planning: "Building code".
adoptedapprovedauthoritybecomesbuildingbuildingscodecodescomplianceconstructioncontrolcouncildepartmentsdesigndesignersdevelopersdistricteffectselectricalengineersenvironmentalestategeneralhealthinsuranceintendedinternationaljurisdictionlawlocal+18
velopers, subcontractors, manufacturers of building products and materials, insurance companies, facility managers, tenants, and others. Codes regulate the design and construction of structures where adopted into law. Examples of building codes began in ancient times. In the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
the USA the main codes are the International Building Code or International Residential Code [IBC/IRC], electrical codes and plumbing, mechanical codes. Fifty states and the District of Columbia have adopted the I-Codes at the state or jurisdictional level. In Canada, national model codes are published by the National Research Council of Canada. In the United Kingdom, compliance with Building Regulations is monitored by building control bodies, either Approved Inspectors or Local Authority Building Control departments.
Types The practice of developing, approving, and enforcing building codes varies considerably among nations. In some countries building codes are developed by the government agencies or quasi-governmental standards organizations and then enforced across the country by the central government. Such codes are known as the national building codes (in a sense they enjoy a mandatory nationwide application). In other countries, where the power of regulating construction and fire safety is vested in local authorities, a system of model building codes is used. Model building codes have no legal status unless adopted or adapted by an authority having jurisdiction. The developers of model codes urge public authorities to reference model codes in their laws, ordinances, regulations, and administrative orders. When referenced in any of these legal instruments, a particular model code becomes law. This practice is known as 'adoption by reference'. When an adopting authority decides to delete, add, or revise any portions of the model code adopted, it is usually required by the model code developer to follow a formal adoption procedure in which those modifications can be documented for legal purposes. There are instances when some local jurisdictions choose to develop their own building codes. At some point in time all major cities in the United States had their own building codes. However, due to ever increasing complexity and cost of developing building regulations, virtually all municipalities in the country have chosen to adopt model codes instead. For example, in 2008 New York City abandoned its proprietary 1968 New York City Building Code in favor of a customized version of the International Building Code. The City of Chicago remains the only municipality in America that continues to use a building code the city developed on its own as part of the Municipal Code of Chicago. In Europe, the Eurocode: Basis of structural design, is a pan-European building code that has superseded the older national building codes. Each country now has National Annexes to localize the contents of the Eurocodes. Similarly, in India, each municipality and urban development authority has its own building code, which is mandatory for all construction within their jurisdiction.
Irrigation
Q11453 EXACT TITLE 1.000
QID OVERLAP: Q11453 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (52): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "developed", "directly", "discharge", "distributed", "distribution", "effects", "environmental", "field", "form", "groundwater".... | EXACT TITLE in land_use_planning: "Irrigation". | EXACT TITLE in nuclear_clean_energy: "Irrigation".
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddevelopeddirectlydischargedistributeddistributioneffectsenvironmentalfieldformgroundwatergrowthimprovementsirrigationlandmaintainmanagementmethodsnaturalnetworkoperation+22
Surface irrigation, also known as gravity irrigation, is the oldest form of irrigation and has been in use for thousands of years. In surface (furrow, flood, or level basin) irrigation systems, water moves across the surface of agricultural lands to wet it and infiltrate into the soil. Water moves by following gravity or the slope of the land. Surface irrigation can be subdivided into furrow, border strip, or basin irrigation. It is often called flood irrigation when irrigation results in flooding or near-flooding of the cultivated land. Historically, surface irrigation has been the most common method for irrigating agricultural land in most parts of the world. The water application efficiency of surface irrigation is typically lower than that of other irrigation methods, due in part to limited control over applied depths. Surface irrigation involves significantly lower capital costs and energy requirements than pressurized irrigation systems. Hence, it is often the irrigation choice for developing nations, for low-value crops, and for large fields. Where water levels from the irrigation source permit, they are controlled by dikes (levees), usually plugged with soil. This is often seen in terraced rice fields (rice paddies), where the method is used to flood or control water levels in each distinct field.
Field Water Efficiency (%) = (Water Transpired by Crop ÷ Water Applied to Field) x 100 Increased irrigation efficiency has several positive outcomes for the farmer, the community, and the wider environment. Low application efficiency indicates that the amount of water applied to the field exceeds the crop or field requirements. Increasing the application efficiency means that the amount of crop produced per unit of water increases. Improved efficiency may be achieved by applying less water to an existing field or by using water more wisely, thereby achieving higher yields in the same area of land. In some parts of the world, farmers are charged for irrigation water; hence, over-application has a direct financial cost to the farmer. Irrigation often requires pumping energy (electricity or fossil fuels) to deliver water to the field or to supply the required operating pressure. Hence, increased efficiency will reduce both water and energy costs per unit of agricultural production. A reduction in water use on one field may allow the farmer to irrigate a larger area of land, increasing total agricultural production. Low efficiency usually means that excess water is lost through seepage or runoff, both of which can result in loss of crop nutrients or pesticides with potential adverse impacts on the surrounding environment. Improving the efficiency of irrigation is usually achieved in one of two ways: either by improving the system design or by optimizing the irrigation management. Improving system design includes converting from one form of irrigation to another (e.g., from furrow to drip irrigation) and making small changes to the current system (e.g., adjusting flow rates and operating pressures).
Archaeological investigations have found evidence of irrigation in areas lacking sufficient natural rainfall to support rainfed agriculture. Some of the earliest known use of the technology dates to the 6th millennium BCE in Khuzistan in the south-west of Iran. The site of Choga Mami, in present-day Iraq on the border with Iran, is believed to be the earliest to show the first canal irrigation in operation at about 6000 BCE. Irrigation was used to manipulate water in the alluvial plains of the Indus Valley Civilization, with its application estimated to have begun around 4500 BCE and to have drastically increased the size and prosperity of their agricultural settlements. The Indus Valley Civilization developed sophisticated irrigation and water-storage systems, including artificial reservoirs at Girnar dated to 3000 BCE, and an early canal irrigation system from c. 2600 BCE. Large-scale agriculture was practiced, with an extensive network of canals used for irrigation. Farmers in the Mesopotamian plain used irrigation from at least the third millennium BCE. They developed perennial irrigation, regularly watering crops throughout the growing season by coaxing water through a matrix of small channels formed in the field. Ancient Egyptians practiced basin irrigation using the flooding of the Nile to inundate land plots which had been surrounded by dikes. The flood water remained until the fertile sediment had settled before the engineers returned the surplus to the watercourse. There is evidence of the ancient Egyptian pharaoh Amenemhet III in the twelfth dynasty (about 1800 BCE) using the natural lake of the Faiyum Oasis as a reservoir to store surpluses of water for use during dry seasons.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "eastern", "idaho", "land", "local", "metropolitan", "resources", "river", "rural", "treasure", "valley", "western". | EXACT TITLE in land_use_planning: "Treasure Valley". | EXACT TITLE in nuclear_clean_energy: "Treasure Valley".
agriculturalassociationboiseeasternidaholandlocalmetropolitanresourcesriverruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
W
Q7973730 EXACT TITLE 0.920
QID OVERLAP: Q7973730 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (11): "different", "groundwater", "irrigation", "law", "legal", "physical", "right", "river", "source", "systems", "water". | EXACT TITLE in land_use_planning: "Water right". | EXACT TITLE in nuclear_clean_energy: "Water right".
differentgroundwaterirrigationlawlegalphysicalrightriversourcesystemswater
rid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical. Some systems treat surface water and ground water in the same manner, while others use different principles for each. Types Water rights requires consideration of the context and origin of the right being discussed, or asserted. Traditionally, water rights refers to the utilization of water as an element supporting basic human needs like drinking or irrigation. Water rights could also include the physical occupancy of waterways for purposes of travel, commerce and recreational pursuits. The legal principles and doctrines that form the basis of each type of water rights are not interchangeable and vary according to local and national laws.
In water law, water right is the right of a user to use water from a water source, e.g., a river, stream, pond or source of groundwater. In areas with plentiful water and few users, such systems are generally not complicated or contentious. In other areas, especially arid areas where irrigation is practiced, such systems are often the source of conflict, both legal and physical.
Community-based allocation of water In some jurisdictions, appropriative water rights can be granted directly to communities. Here, water is reserved to provide sufficient capacity for the future growth of that particular community. For example, California provides communities and other water users within watersheds senior status over appropriative (use-based) water rights solely because they are located where the water originates and naturally flows. A second example of community-based water rights is pueblo water rights. As recognized by California, pueblo water rights are grants to individual settlements (i.e. pueblos) over all streams and rivers flowing through the city and to all groundwater aquifers underlying that particular city. The pueblo's claim expands with the needs of the city and may be used to supply the needs of areas that are later annexed to the city. While California recognizes pueblo water rights, pueblo water rights are controversial.
Boise River
Q891080 EXACT TITLE 0.840
QID OVERLAP: Q891080 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "urban", "western". | EXACT TITLE in land_use_planning: "Boise River".
agriculturalapproximatelyboiseidahoriverurbanwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
United States Environmental Protection Agency
Q460173 QID OVERLAP 0.800
QID OVERLAP: Q460173 in land_use_planning (tier:evergreen) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (35): "approved", "assessment", "conducts", "conservation", "december", "department", "education", "engineers", "environmental", "equivalent", "establishing", "federal", "federally", "financial", "government", "hearings", "independent", "information", "january", "legal"....
approvedassessmentconductsconservationdecemberdepartmenteducationengineersenvironmentalequivalentestablishingfederalfederallyfinancialgovernmenthearingsindependentinformationjanuarylegallocalmonitoringnationaloperationpermittingprogramsproposedprotectionpublicregional+5
xon signed an executive order. The order establishing the EPA was ratified by committee hearings in the House and Senate. The agency is led by its administrator, who is appointed by the president and approved by the Senate. Since January 29, 2025, the administrator is Lee Zeldin. The EPA is not a Cabinet department, but the administrator is normally given cabinet rank. The EPA has its headquarters in Washington, D.C. There are regional offices for each of the agency's ten regions, as well as 27 laboratories around the country. The agency conducts environmental assessment, research, and education. It has the responsibility of maintaining and enforcing national standards under a variety of U.S. environmental laws, in consultation with state, tribal, and local governments. EPA enforcement powers include fines, sanctions, and other measures. It delegates some permitting, monitoring, and enforcement responsibility to U.S. states and the federally recognized tribes. The agency also works with industries and all levels of government in a wide variety of voluntary pollution prevention programs and energy conservation efforts. The agency's budgeted employee level in 2023 was 16,204.1 full-time equivalent (FTE).
On July 9, 1970, Nixon proposed an executive reorganization that consolidated many environmental responsibilities of the federal government under one agency, a new Environmental Protection Agency. This proposal included merging pollution control programs from a number of departments, such as the combination of pesticide programs from the United States Department of Agriculture and the United States Department of the Interior. After conducting hearings during that summer, the House and Senate approved the proposal. The EPA was created 90 days before it had to operate, and officially opened its doors on December 2, 1970. The agency's first administrator, William Ruckelshaus, took the oath of office on December 4, 1970. EPA's primary predecessor was the former Environmental Health Divisions of the U.S. Public Health Service (PHS), and its creation caused one of a series of reorganizations of PHS that occurred during 1966–1973. From PHS, EPA absorbed the entire National Air Pollution Control Administration, as well as the Environmental Control Administration's Bureau of Solid Waste Management, Bureau of Water Hygiene, and part of its Bureau of Radiological Health. It also absorbed the Federal Water Quality Administration, which had previously been transferred from PHS to the Department of the Interior in 1966. A few functions from other agencies were also incorporated into EPA: the formerly independent Federal Radiation Council was merged into it; pesticides programs were transferred from the Department of the Interior, Food and Drug Administration, and Agricultural Research Service; and some functions were transferred from the Council on Environmental Quality and Atomic Energy Commission. Upon its creation, EPA inherited 84 sites spread across 26 states, of which 42 sites were laboratories.
1970s In its first year, the EPA had a budget of $1.4 billion and 5,800 employees. At its start, the EPA was primarily a technical assistance agency that set goals and standards. Soon, new acts and amendments passed by Congress gave the agency its regulatory authority. A major expansion of the Clean Air Act was approved in December 1970. EPA staff recall that in the early days there was "an enormous sense of purpose and excitement" and the expectation that "there was this agency which was going to do something about a problem that clearly was on the minds of a lot of people in this country," leading to tens of thousands of resumes from those eager to participate in the mighty effort to clean up America's environment. When EPA first began operation, members of the private sector felt strongly that the environmental protection movement was a passing fad. Ruckelshaus stated that he felt pressure to show a public which was deeply skeptical about government's effectiveness, that EPA could respond effectively to widespread concerns about pollution. The burning Cuyahoga River in Cleveland, Ohio, in 1969 led to a national outcry and criminal charges against major steel companies. The US Justice Department in late 1970 began pollution control litigation in cooperation with the new EPA. Congress enacted the Federal Water Pollution Control Act Amendments of 1972, better known as the Clean Water Act (CWA). The CWA established a national framework for addressing water quality, including mandatory pollution control standards, to be implemented by the agency in partnership with the states. Congress amended the Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) in 1972, requiring EPA to measure every pesticide's risks against its potential benefits. In 1973 President Nixon appointed Russell E. Train to be the next EPA administrator. In 1974 Congress passed the Safe Drinking Water Act, requiring EPA to develop mandatory federal standards for all public water systems, which serve 90% of the US population. The law required EPA to enforce the standards with the cooperation of state agencies. In October 1976, Congress passed the Toxic Substances Control Act (TSCA) which, like FIFRA, related to the manufacture, labeling and usage of commercial products rather than pollution. This act gave the EPA the authority to gather information on chemicals and require producers to test them, gave it the ability to regulate chemical production and use (with specific mention of PCBs), and required the agency to create the National Inventory listing of chemicals. Congress also enacted the Resource Conservation and Recovery Act (RCRA) in 1976, significantly amending the Solid Waste Disposal Act of 1965. It tasked the EPA with setting national goals for waste disposal, conserving energy and natural resources, reducing waste, and ensuring environmentally sound management of waste. Accordingly, the agency developed regulations for solid and hazardous waste that were to be implemented in collaboration with states. President Jimmy Carter appointed Douglas M. Costle as EPA administrator in 1977.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (20): "ada", "annual", "boise", "capital", "counties", "downtown", "east", "employers", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "micron", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalcountiesdowntowneastemployershomeidaholocallymajormanufacturingmetropolitanmicronpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.800
QID OVERLAP: Q109820 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (15): "ada", "boise", "capital", "district", "east", "home", "idaho", "jurisdiction", "largest", "local", "metropolitan", "population", "private", "roads", "streets".
adaboisecapitaldistricteasthomeidahojurisdictionlargestlocalmetropolitanpopulationprivateroadsstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "home", "idaho", "interstate", "meridian", "metropolitan", "nampa", "population", "principal", "university", "western".
boisecanyoncollegehomeidahointerstatemeridianmetropolitannampapopulationprincipaluniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "east", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeeastidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Snake River Plain
Q1396049 QID OVERLAP 0.680
QID OVERLAP: Q1396049 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:evergreen). | SHARED TOKENS (9): "agricultural", "cities", "east", "idaho", "land", "largest", "major", "river", "southern".
agriculturalcitieseastidaholandlargestmajorriversouthern
rs about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
tward from northwest of the state of Wyoming to the Idaho-Oregon border. The plain is a wide, flat bow-shaped depression and covers about a quarter of Idaho. Three major volcanic buttes dot the plain east of Arco, the largest being Big Southern Butte. Most of Idaho's major cities are in the Snake River Plain, as is much of its agricultural land. Geology The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain.
The Snake River Plain can be divided into three sections: western, central, and eastern. The western Snake River Plain is a large tectonic graben or rift valley filled with several kilometers of Lake Idaho sediments; the sediments are underlain by rhyolite and basalt, and overlain by basalt. The western plain began to form around 11–12 Ma (million years ago) with the eruption of rhyolite lavas and ignimbrites. The western plain is not parallel to North American Plate motion and lies at a high angle to the central and eastern Snake River Plain. Its morphology is similar to other volcanic plateaus such as the Chilcotin Group in south-central British Columbia, Canada. The eastern Snake River Plain traces the path of the North American Plate over the Yellowstone hotspot, now centered in Yellowstone National Park. The eastern plain is a topographic depression that cuts across Basin and Range mountain structures, more or less parallel to North American Plate motion. It is underlain almost entirely by basalt erupted from large shield volcanoes. Beneath the basalts are rhyolite lavas and ignimbrites that erupted as the lithosphere passed over the hotspot. The central Snake River plain is similar to the eastern plain but differs by having thick sections of interbedded lacustrine (lake) and fluvial (stream) sediments, including the Hagerman fossil beds. Island Park and Yellowstone Calderas formed as the result of enormous rhyolite ignimbrite eruptions, with single eruptions producing up to 600 cubic miles (2,500 km3) of ash. Henry's Fork Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the largest symmetrical caldera in the world. The caldera formed when a dome of magma built up and then drained away. The center of the dome collapsed, leaving a caldera. Henry's Fork Caldera lies within the older and larger Island Park Caldera, which is 50 miles (80 km) by 65 miles (105 km).
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in land_use_planning (tier:branch) and nuclear_clean_energy (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
232 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP232 edges
🌲 EVERGREEN1 edges
0.610
advocacyalternativescleancollaborationcommunitydifferenteducationidahoidentifymethodsorganizationpowerriver
SHARED TOKENS (13): "advocacy", "alternatives", "clean", "collaboration", "community", "different", "education", "idaho", "identify", "methods", "organization", "power", "river". | URL->B (1): http://snakeriveralliance.org/. | EXACT TITLE in nuclear_clean_energy: "Snake River Alliance".
🌿 BRANCH193 edges
0.590
activityamongfallsidahomeridianpercentprogramspublicresearchstudentsuniversitiesuniversity
SHARED TOKENS (12): "activity", "among", "falls", "idaho", "meridian", "percent", "programs", "public", "research", "students", "universities", "university". | URL->B (1): http://www.isu.edu/. | EXACT TITLE in nuclear_clean_energy: "Idaho State University".
0.500
changingdevelopmentdistributeddistributioneconomiceconomyhistoryhouseholdindustrialpowerprocessprocessesresourcesruralsourcesystemstechnologytransition
SHARED TOKENS (18): "changing", "development", "distributed", "distribution", "economic", "economy", "history", "household", "industrial", "power", "process", "processes", "resources", "rural", "source", "systems", "technology", "transition". | EXACT TITLE in nuclear_clean_energy: "Electrification".
0.500
Cartography ↗ Q42515 EXACT TITLE
boundariesdesigngeographicinformationlandmakingmediamodeledmodernobjectivesphysicalpoliticalpracticereduceroadssciencestudysystems
SHARED TOKENS (18): "boundaries", "design", "geographic", "information", "land", "making", "media", "modeled", "modern", "objectives", "physical", "political", "practice", "reduce", "roads", "science", "study", "systems". | EXACT TITLE in land_use_planning: "Cartography".
0.500
activitiesagriculturalapproximatelychangeclimategroundwaterhouseholdindustrialirrigationmultiplenaturalpresentproducedremainingresourceresourcesriversourcesourcessupply
SHARED TOKENS (22): "activities", "agricultural", "approximately", "change", "climate", "groundwater", "household", "industrial", "irrigation", "multiple", "natural", "present", "produced", "remaining", "resource", "resources", "river", "source", "sources", "supply".... | EXACT TITLE in land_use_planning: "Water resources".
0.500
activitiesactivityattachedcommunitydevelopeddistributioneconomicevenfeaturesformalgeographicgrowinggrowthinformationland-usemetropolitanmodelmodelingmodelsneed
SHARED TOKENS (36): "activities", "activity", "attached", "community", "developed", "distribution", "economic", "even", "features", "formal", "geographic", "growing", "growth", "information", "land-use", "metropolitan", "model", "modeling", "models", "need".... | EXACT TITLE in land_use_planning: "Land-use forecasting".
0.500
Idaho ↗ EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainsdistincteasteasterneconomyforestrygeographicidahoincorporatesisolatedlandlargestlinkedmanufacturing
SHARED TOKENS (33): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "distinct", "east", "eastern", "economy", "forestry", "geographic", "idaho", "incorporates", "isolated", "land", "largest", "linked", "manufacturing".... | EXACT TITLE in land_use_planning: "Idaho". | EXACT TITLE in nuclear_clean_energy: "Idaho".
0.500
builtconditionsconstructedconstructioncontroldepartmentdoeidahomaterialmaterialsnationaloperatedoperationoriginalplannedplantsprogramstructuralsystems
SHARED TOKENS (19): "built", "conditions", "constructed", "construction", "control", "department", "doe", "idaho", "material", "materials", "national", "operated", "operation", "original", "planned", "plants", "program", "structural", "systems". | EXACT TITLE in nuclear_clean_energy: "Transient Reactor Test Facility".
0.500
academicanalysisanotherapplicationsattachedbroaderbusinesscoordinatesdataengineeringforestrygeographicindexinformationinstitutionalinsuranceintegratedknowledgemanagementmethods
SHARED TOKENS (38): "academic", "analysis", "another", "applications", "attached", "broader", "business", "coordinates", "data", "engineering", "forestry", "geographic", "index", "information", "institutional", "insurance", "integrated", "knowledge", "management", "methods".... | EXACT TITLE in land_use_planning: "Geographic information system".
0.500
Groundwater ↗ Q161598 EXACT TITLE
additionallyagriculturalagricultureaquiferbecomecapacitycentralchangecitiescleanclimatecontainsdischargedistributioneffectsenvironmentalfieldformformationgroundwater
SHARED TOKENS (49): "additionally", "agricultural", "agriculture", "aquifer", "become", "capacity", "central", "change", "cities", "clean", "climate", "contains", "discharge", "distribution", "effects", "environmental", "field", "form", "formation", "groundwater".... | EXACT TITLE in land_use_planning: "Groundwater". | EXACT TITLE in nuclear_clean_energy: "Groundwater".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowedbuildingbuildingscombinedeterminedevelopeddevelopmentdifferentformgoverngovernmentgrowthindustriallandland-uselocalpermissionplacesplanning
SHARED TOKENS (36): "activities", "allowed", "building", "buildings", "combine", "determine", "developed", "development", "different", "form", "govern", "government", "growth", "industrial", "land", "land-use", "local", "permission", "places", "planning".... | EXACT TITLE in land_use_planning: "Zoning". | EXACT TITLE in nuclear_clean_energy: "Zoning".
0.500
activitiesadministrativebroadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindustrialinfrastructurelandland-uselargermanagementnationalnetworkplanningplans
SHARED TOKENS (36): "activities", "administrative", "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "industrial", "infrastructure", "land", "land-use", "larger", "management", "national", "network", "planning", "plans".... | EXACT TITLE in land_use_planning: "Regional planning".
0.500
accesschangeclassifyclimatecommunitycomponentsconditionscontemporarycreatedculturaldescribedevelopmentdifferentdistincteconomiceconomyelectricalemergencyenvironmentalfacilities
SHARED TOKENS (51): "access", "change", "classify", "climate", "community", "components", "conditions", "contemporary", "created", "cultural", "describe", "development", "different", "distinct", "economic", "economy", "electrical", "emergency", "environmental", "facilities".... | EXACT TITLE in land_use_planning: "Infrastructure". | EXACT TITLE in nuclear_clean_energy: "Infrastructure".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationbuildingbuiltcleanconcreteconstructiondesigndevelopedengineeringfloodfunctionsgenerategoverninghealthhouseholdimproveincreaseindustrialirrigation
SHARED TOKENS (45): "additional", "application", "building", "built", "clean", "concrete", "construction", "design", "developed", "engineering", "flood", "functions", "generate", "governing", "health", "household", "improve", "increase", "industrial", "irrigation".... | EXACT TITLE in land_use_planning: "Dam". | EXACT TITLE in nuclear_clean_energy: "Dam".
0.500
controlconventionaldegreeefficiencyengineeringfieldformimprovementsphysicalprocessprocessesproductionsafetyscaletogether
SHARED TOKENS (15): "control", "conventional", "degree", "efficiency", "engineering", "field", "form", "improvements", "physical", "process", "processes", "production", "safety", "scale", "together". | EXACT TITLE in nuclear_clean_energy: "Microreactor".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecitiescreatedemanddevelopeddirectlyfallsgroundwaterlandlargemajornaturalplantspopulationpotentialreducerelatedresourcerighttiming
SHARED TOKENS (23): "become", "cities", "create", "demand", "developed", "directly", "falls", "groundwater", "land", "large", "major", "natural", "plants", "population", "potential", "reduce", "related", "resource", "right", "timing".... | EXACT TITLE in land_use_planning: "Stormwater".
0.500
actionactivityanalysisanotherassociatedbuildingbuildingscentralchangescitiescontroldesigndevelopmentdifferentenvironmentalfieldformformationformsfunctions
SHARED TOKENS (43): "action", "activity", "analysis", "another", "associated", "building", "buildings", "central", "changes", "cities", "control", "design", "development", "different", "environmental", "field", "form", "formation", "forms", "functions".... | EXACT TITLE in land_use_planning: "Urban morphology".
0.500
Drought ↗ Q43059 EXACT TITLE
activityaffectedaffectingagricultureannualbecomechangeclimateconditionsdirectlyeconomiceconomyeffectsenvironmentalexperienceforestryfuturehealthhistoryimpacts
SHARED TOKENS (36): "activity", "affected", "affecting", "agriculture", "annual", "become", "change", "climate", "conditions", "directly", "economic", "economy", "effects", "environmental", "experience", "forestry", "future", "health", "history", "impacts".... | EXACT TITLE in nuclear_clean_energy: "Drought".
0.500
architectureconditionsconstructioncontroldesignengineeringenvironmentalestateexpertisegeneralinfrastructurelicenselicensedmanagementmasterplanningpossesspractitionerprivateprocesses
SHARED TOKENS (30): "architecture", "conditions", "construction", "control", "design", "engineering", "environmental", "estate", "expertise", "general", "infrastructure", "license", "licensed", "management", "master", "planning", "possess", "practitioner", "private", "processes".... | EXACT TITLE in land_use_planning: "Landscape architecture".
0.500
addressingbusinessescitiescommunitiesconstructioneconomicgovernmentgrowthhousinginfrastructurelandneighborhoodsprivateprocessprojectspublicrenewalurban
SHARED TOKENS (18): "addressing", "businesses", "cities", "communities", "construction", "economic", "government", "growth", "housing", "infrastructure", "land", "neighborhoods", "private", "process", "projects", "public", "renewal", "urban". | EXACT TITLE in land_use_planning: "Urban renewal".
0.500
applicationapproximatelybehaviorbuiltcurrentdepartmenteasteasternengineeringenvironmentalfacilitiesfallshistoryidahoinstituteknowledgelargestnationalneighboringorganizations
SHARED TOKENS (26): "application", "approximately", "behavior", "built", "current", "department", "east", "eastern", "engineering", "environmental", "facilities", "falls", "history", "idaho", "institute", "knowledge", "largest", "national", "neighboring", "organizations".... | EXACT TITLE in nuclear_clean_energy: "Idaho National Laboratory".
0.500
actalternativesamericanapplicableassessmentassociationauthoritybehaviorcentralchangechangescitiescommunitiescommunitycomprehensiveconditionsconservationcreatingdependdepends
SHARED TOKENS (57): "act", "alternatives", "american", "applicable", "assessment", "association", "authority", "behavior", "central", "change", "changes", "cities", "communities", "community", "comprehensive", "conditions", "conservation", "creating", "depend", "depends".... | EXACT TITLE in land_use_planning: "Land-use planning".
0.500
Substation ↗ Q174814 EXACT TITLE
approximatelycentralchangecommercialconnectedconsumercontroldifferentdistributionelectricalfunctionsgeneratorsindustrialinfrastructurelargelargeroperatedownedplantspower
SHARED TOKENS (23): "approximately", "central", "change", "commercial", "connected", "consumer", "control", "different", "distribution", "electrical", "functions", "generators", "industrial", "infrastructure", "large", "larger", "operated", "owned", "plants", "power".... | EXACT TITLE in nuclear_clean_energy: "Substation".
0.500
boundariescasescertificationcompetencecompletefieldformalleadinglicensemasteroutsidepotentialpracticepractitionersprofessionalregulatedstudysystemtraining
SHARED TOKENS (19): "boundaries", "cases", "certification", "competence", "complete", "field", "formal", "leading", "license", "master", "outside", "potential", "practice", "practitioners", "professional", "regulated", "study", "system", "training". | EXACT TITLE in nuclear_clean_energy: "Apprenticeship".
0.500
alongsideamericancapacitycapitalcitiescombineconnectingconventionalcorridorscostdesignfeaturesflexibilityintegrateinteractlargestnetworkpublicqualityrapid
SHARED TOKENS (26): "alongside", "american", "capacity", "capital", "cities", "combine", "connecting", "conventional", "corridors", "cost", "design", "features", "flexibility", "integrate", "interact", "largest", "network", "public", "quality", "rapid".... | EXACT TITLE in land_use_planning: "Bus rapid transit".
0.500
activitiesagriculturalassessmentconversiondevelopmentdifferenteducationestablishingfuturegovernmentgrowingjointlandlocalnationaloperatedoperationalorganizationsownerplanning
SHARED TOKENS (30): "activities", "agricultural", "assessment", "conversion", "development", "different", "education", "establishing", "future", "government", "growing", "joint", "land", "local", "national", "operated", "operational", "organizations", "owner", "planning".... | EXACT TITLE in land_use_planning: "Farmland preservation".
0.500
analysiscurrentdatadesigndifferentengineeringformformalformsgeographiclargeneitherresearchroutescalestructuresstudiesstudyurban
SHARED TOKENS (19): "analysis", "current", "data", "design", "different", "engineering", "form", "formal", "forms", "geographic", "large", "neither", "research", "route", "scale", "structures", "studies", "study", "urban". | EXACT TITLE in land_use_planning: "Spatial analysis".
0.500
alternativeapplicationsassociatedbuiltcapacitycombinedconstructioncontrolledequivalentexpectedfuturegenerategeneratorslargestmovementnaturalnetoperatedplannedplants
SHARED TOKENS (30): "alternative", "applications", "associated", "built", "capacity", "combined", "construction", "controlled", "equivalent", "expected", "future", "generate", "generators", "largest", "movement", "natural", "net", "operated", "planned", "plants".... | EXACT TITLE in nuclear_clean_energy: "Nuclear power".
0.500
Urban design ↗ Q63100 EXACT TITLE
architecturebuildingscitiescommunityconnectdesigndesignerseconomicenvironmentalfeatureshistoricallocalpagephysicalplanningprocessesprojectpublicregionalrelated
SHARED TOKENS (25): "architecture", "buildings", "cities", "community", "connect", "design", "designers", "economic", "environmental", "features", "historical", "local", "page", "physical", "planning", "processes", "project", "public", "regional", "related".... | EXACT TITLE in land_use_planning: "Urban design". | EXACT TITLE in nuclear_clean_energy: "Urban design".
0.500
Aquifer ↗ Q208791 EXACT TITLE
aquiferbeyondformationgroundwaterhomeindustriallandlayermajormaterialmaterialspresentpressurerelatedsourcestudywaterwells
SHARED TOKENS (18): "aquifer", "beyond", "formation", "groundwater", "home", "industrial", "land", "layer", "major", "material", "materials", "present", "pressure", "related", "source", "study", "water", "wells". | EXACT TITLE in land_use_planning: "Aquifer". | EXACT TITLE in nuclear_clean_energy: "Aquifer".
0.500
administrativedepartmentdistrictfederalfinancialfunctionsgovernmentgrantsimprovelocalmaintainofficeoperatorsprogramsproviderspublicregionalrequirementsstatutorysystems
SHARED TOKENS (23): "administrative", "department", "district", "federal", "financial", "functions", "government", "grants", "improve", "local", "maintain", "office", "operators", "programs", "providers", "public", "regional", "requirements", "statutory", "systems".... | EXACT TITLE in land_use_planning: "Federal Transit Administration".
0.500
businessescapacitychangechangescostdemanddirectdirectlyeconomicgeneralimplicationincentiveslargelimitsmanagementnetnetworksplannedplantspower
SHARED TOKENS (34): "businesses", "capacity", "change", "changes", "cost", "demand", "direct", "directly", "economic", "general", "implication", "incentives", "large", "limits", "management", "net", "networks", "planned", "plants", "power".... | EXACT TITLE in nuclear_clean_energy: "Demand response".
0.500
actactivitiesapplicantsapproximatelycertificationcommissioncomplycomponentsconcernsdecisionsdefinesdepartmentdifferentdispositionenvironmentalevaluateexperiencefacilitiesformhearings
SHARED TOKENS (54): "act", "activities", "applicants", "approximately", "certification", "commission", "comply", "components", "concerns", "decisions", "defines", "department", "different", "disposition", "environmental", "evaluate", "experience", "facilities", "form", "hearings".... | EXACT TITLE in nuclear_clean_energy: "Nuclear material".
0.500
UrbanSim ↗ Q7899833 EXACT TITLE
applicationcoordinatesdevelopeddevelopmentdistributedenvironmentalfederalgrantslandmetropolitanmodelingnationalopenorgplanningplatformsprofessionalprotectionresearchreviews
SHARED TOKENS (28): "application", "coordinates", "developed", "development", "distributed", "environmental", "federal", "grants", "land", "metropolitan", "modeling", "national", "open", "org", "planning", "platforms", "professional", "protection", "research", "reviews".... | EXACT TITLE in land_use_planning: "UrbanSim".
0.500
Wetland ↗ Q170321 EXACT TITLE
actamongassessmentbuildingchangeclimateconservationcontroldifferentdistinctenvironmentalexistfloodformfunctionfunctionsgroundwaterhealthidentifyinfrastructure
SHARED TOKENS (40): "act", "among", "assessment", "building", "change", "climate", "conservation", "control", "different", "distinct", "environmental", "exist", "flood", "form", "function", "functions", "groundwater", "health", "identify", "infrastructure".... | EXACT TITLE in land_use_planning: "Wetland".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesamericancanyoncentralcommercialconstructedconstructioncontrolcreateddevelopedeasteasternfallsfeaturesfloodhabitathistoryidahoirrigationlarge
SHARED TOKENS (42): "activities", "american", "canyon", "central", "commercial", "constructed", "construction", "control", "created", "developed", "east", "eastern", "falls", "features", "flood", "habitat", "history", "idaho", "irrigation", "large".... | EXACT TITLE in nuclear_clean_energy: "Snake River".
0.500
americanbecomeboardcertificationcertifiedcompetencyconsumercontractordesignefficiencyelectricalfebruaryfieldincentivesinternationalknowledgelicensemultipleorganizationpartners
SHARED TOKENS (44): "american", "become", "board", "certification", "certified", "competency", "consumer", "contractor", "design", "efficiency", "electrical", "february", "field", "incentives", "international", "knowledge", "license", "multiple", "organization", "partners".... | EXACT TITLE in nuclear_clean_energy: "North American Board of Certified Energy Practitioners".
0.500
applicationsassociatedbasebeyondconnectionsdatadescriptionsdevelopmentgraphincreasinglyknowledgelinkedmodelnetworksopenprojectsrelationshipsrepresentationresearchscience
SHARED TOKENS (22): "applications", "associated", "base", "beyond", "connections", "data", "descriptions", "development", "graph", "increasingly", "knowledge", "linked", "model", "networks", "open", "projects", "relationships", "representation", "research", "science".... | EXACT TITLE in land_use_planning: "Knowledge graph". | EXACT TITLE in nuclear_clean_energy: "Knowledge graph".
0.500
actagriculturalagricultureassessmentbroaderconservationdepartmenteffectsimproveinvestmentleadinglocalnaturalpartnershipprivateprogramsprojectqualityresourcesrural
SHARED TOKENS (23): "act", "agricultural", "agriculture", "assessment", "broader", "conservation", "department", "effects", "improve", "investment", "leading", "local", "natural", "partnership", "private", "programs", "project", "quality", "resources", "rural".... | EXACT TITLE in land_use_planning: "Natural Resources Conservation Service".
0.500
administrativebuildingcommercialcompletedconnectionsconstructionculturaldegreedesigndeveloperdevelopmentfunctionsinstitutionalintegratedmultipleneighborhoodplanningpolicyprivateprojects
SHARED TOKENS (28): "administrative", "building", "commercial", "completed", "connections", "construction", "cultural", "degree", "design", "developer", "development", "functions", "institutional", "integrated", "multiple", "neighborhood", "planning", "policy", "private", "projects".... | EXACT TITLE in land_use_planning: "Mixed-use development".
0.500
applicationbachelordegreedemonstratesdependseducationenvironmentalexperiencefacilitiesfieldfocusedgeneratorsgovernmenthealthknowledgemakingpotentialpowerproducedprofessional
SHARED TOKENS (31): "application", "bachelor", "degree", "demonstrates", "depends", "education", "environmental", "experience", "facilities", "field", "focused", "generators", "government", "health", "knowledge", "making", "potential", "power", "produced", "professional".... | EXACT TITLE in nuclear_clean_energy: "Health physics".
0.500
barrierscurrentdepartmentdevelopmentenvironmentalgovernmentmeetingnationalofficepowerpromotesregulatoryresearchresourcetechnical
SHARED TOKENS (15): "barriers", "current", "department", "development", "environmental", "government", "meeting", "national", "office", "power", "promotes", "regulatory", "research", "resource", "technical". | EXACT TITLE in nuclear_clean_energy: "Office of Nuclear Energy".
0.500
changeclimatedeliverydemanddirectlydistributionelectricalforecastformsgeneratorsgrowthhomesmeansmethodsplantspowerprocessproducedproductionproposed
SHARED TOKENS (26): "change", "climate", "delivery", "demand", "directly", "distribution", "electrical", "forecast", "forms", "generators", "growth", "homes", "means", "methods", "plants", "power", "process", "produced", "production", "proposed".... | EXACT TITLE in nuclear_clean_energy: "Electricity generation".
0.500
activitiesagriculturalamongapplicationchangeconcernscontinuesdevelopmentenvironmentalformationgeneratorshealthhistoryimpactsincreaselegalmaterialsmethodsmodificationnational
SHARED TOKENS (30): "activities", "agricultural", "among", "application", "change", "concerns", "continues", "development", "environmental", "formation", "generators", "health", "history", "impacts", "increase", "legal", "materials", "methods", "modification", "national".... | EXACT TITLE in nuclear_clean_energy: "Cloud seeding".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilcomponentsconstructiondevelopmentengineeringestablishfeaturesformsgovernmenthistorylandlawlegalmappingownershipplanningpositionsprofessional
SHARED TOKENS (29): "analysis", "boundaries", "civil", "components", "construction", "development", "engineering", "establish", "features", "forms", "government", "history", "land", "law", "legal", "mapping", "ownership", "planning", "positions", "professional".... | EXACT TITLE in land_use_planning: "Surveying".
0.500
affectingamongcapacitycleancombinedconstructedconstructioncreatingdemanddirectelectricalenvironmentallandlargelargestleadinglimitsmakingnaturalplants
SHARED TOKENS (36): "affecting", "among", "capacity", "clean", "combined", "constructed", "construction", "creating", "demand", "direct", "electrical", "environmental", "land", "large", "largest", "leading", "limits", "making", "natural", "plants".... | EXACT TITLE in nuclear_clean_energy: "Hydroelectricity".
0.500
actcommissionestablishedfacilitiesfunctionsgovernmenthealthjanuarylicensingmaterialsoperationspublicregulationregulatoryrelatedrenewalsafety
SHARED TOKENS (17): "act", "commission", "established", "facilities", "functions", "government", "health", "january", "licensing", "materials", "operations", "public", "regulation", "regulatory", "related", "renewal", "safety". | EXACT TITLE in nuclear_clean_energy: "Nuclear Regulatory Commission".
0.500
amongbarriersbuiltcapacitycentercommercialconstructionconventionaldatademanddesignelectricalemergencyexpectedfeaturesfinancialintendedlargemodelsmodern
SHARED TOKENS (34): "among", "barriers", "built", "capacity", "center", "commercial", "construction", "conventional", "data", "demand", "design", "electrical", "emergency", "expected", "features", "financial", "intended", "large", "models", "modern".... | EXACT TITLE in nuclear_clean_energy: "Small modular reactor".
0.500
annualconversioncreatedcurrentefficiencyexpectedgrowthindustriallargemarketmethodsnaturalprocessproducedproductionsourcessupplyuseswater
SHARED TOKENS (19): "annual", "conversion", "created", "current", "efficiency", "expected", "growth", "industrial", "large", "market", "methods", "natural", "process", "produced", "production", "sources", "supply", "uses", "water". | EXACT TITLE in nuclear_clean_energy: "Hydrogen production".
0.500
Cold War ↗ Q8683 EXACT TITLE
anotherchangeconventionaldirectdivisioneasterneconomicfundinginfluenceinternationalmajorplanpoliticalregimeregionalspacesupportsupportedwestern
SHARED TOKENS (19): "another", "change", "conventional", "direct", "division", "eastern", "economic", "funding", "influence", "international", "major", "plan", "political", "regime", "regional", "space", "support", "supported", "western". | EXACT TITLE in nuclear_clean_energy: "Cold War".
0.500
adabaseboisecentercombinedcommercialcommissiondepartmentdowntownfallsfieldfirefunctionsgeneralidahoincreaseinternationaljointnationaloperated
SHARED TOKENS (28): "ada", "base", "boise", "center", "combined", "commercial", "commission", "department", "downtown", "falls", "field", "fire", "functions", "general", "idaho", "increase", "international", "joint", "national", "operated".... | EXACT TITLE in land_use_planning: "Boise Airport".
0.500
activitiesadoptedanalysisanotherarchitecturebroaderbuildingsbuiltbusinesscapitalcategorycitiescivilcodescommunitiescommunitycreatingdesigndevelopmentdifferent
SHARED TOKENS (78): "activities", "adopted", "analysis", "another", "architecture", "broader", "buildings", "built", "business", "capital", "category", "cities", "civil", "codes", "communities", "community", "creating", "design", "development", "different".... | EXACT TITLE in land_use_planning: "Urban planning".
0.500
Annexation ↗ EXACT TITLE
acquisitionactannexationanothercontrolcurrentdescribesdescribingdistinctinternationallawlegalmeansphysicalpoliticalscienceterritorytitle
SHARED TOKENS (18): "acquisition", "act", "annexation", "another", "control", "current", "describes", "describing", "distinct", "international", "law", "legal", "means", "physical", "political", "science", "territory", "title". | EXACT TITLE in land_use_planning: "Annexation". | EXACT TITLE in nuclear_clean_energy: "Annexation".
0.500
accesscannotcleancommissioncontroldifferententityfederalformsgovernmentinfrastructurelargelineslocalmaintainsmarketmodernmultiplenaturaloperates
SHARED TOKENS (36): "access", "cannot", "clean", "commission", "control", "different", "entity", "federal", "forms", "government", "infrastructure", "large", "lines", "local", "maintains", "market", "modern", "multiple", "natural", "operates".... | EXACT TITLE in nuclear_clean_energy: "Public utility".
0.500
actadministeredalternativebuildingscommunitiescommunityconstructioncontrolcostcreatedcreatingdebtdecemberdevelopmenteffectiveemergencyfederalfloodgovernmenthomes
SHARED TOKENS (39): "act", "administered", "alternative", "buildings", "communities", "community", "construction", "control", "cost", "created", "creating", "debt", "december", "development", "effective", "emergency", "federal", "flood", "government", "homes".... | EXACT TITLE in land_use_planning: "National Flood Insurance Program".
0.500
affordabilityaffordableassociateddemandeconomicemergencyexistformalformsgovernmenthomehouseholdhouseholdshousingincreasesindexlocalmarketsnationalownership
SHARED TOKENS (22): "affordability", "affordable", "associated", "demand", "economic", "emergency", "exist", "formal", "forms", "government", "home", "household", "households", "housing", "increases", "index", "local", "markets", "national", "ownership".... | EXACT TITLE in land_use_planning: "Affordable housing".
0.500
Plat ↗ Q831939 EXACT TITLE
anotherbecomeboardcommissiondepartmentdescriptionsgeneralgoverninginformationlandlegallegallylocalofficeplanningportionspublicratherreviewscale
SHARED TOKENS (25): "another", "become", "board", "commission", "department", "descriptions", "general", "governing", "information", "land", "legal", "legally", "local", "office", "planning", "portions", "public", "rather", "review", "scale".... | EXACT TITLE in land_use_planning: "Plat". | EXACT TITLE in nuclear_clean_energy: "Plat".
0.500
conservationconversioneconomyefficiencyelectricallandscapingnetpotentialpowerprocessproducesreducingsourcetransportationwork
SHARED TOKENS (15): "conservation", "conversion", "economy", "efficiency", "electrical", "landscaping", "net", "potential", "power", "process", "produces", "reducing", "source", "transportation", "work". | EXACT TITLE in nuclear_clean_energy: "Energy efficiency".
0.500
Canal ↗ Q12284 EXACT TITLE
buildingbuiltcasescontrolcreatecurrentdescribefeaturesfloodincreaseirrigationmanagementmodernnaturalneededpressureresourcesriversourcesources
SHARED TOKENS (23): "building", "built", "cases", "control", "create", "current", "describe", "features", "flood", "increase", "irrigation", "management", "modern", "natural", "needed", "pressure", "resources", "river", "source", "sources".... | EXACT TITLE in land_use_planning: "Canal".
0.500
conventionaldemandelectricalformformslargelatermethodsmultiplepotentialpowerprocessproducedproductionprovidereducereservoirscale
SHARED TOKENS (18): "conventional", "demand", "electrical", "form", "forms", "large", "later", "methods", "multiple", "potential", "power", "process", "produced", "production", "provide", "reduce", "reservoir", "scale". | EXACT TITLE in nuclear_clean_energy: "Energy storage".
0.500
applicationsbuiltcapacitychangeclimatecommercialcontinuingconversionconvertcostcurrentdevelopeddirectlyfinancinghomesintegrationinternationallargelargestneeded
SHARED TOKENS (30): "applications", "built", "capacity", "change", "climate", "commercial", "continuing", "conversion", "convert", "cost", "current", "developed", "directly", "financing", "homes", "integration", "international", "large", "largest", "needed".... | EXACT TITLE in nuclear_clean_energy: "Solar power".
0.500
Site plan ↗ Q1284677 EXACT TITLE
analysisarrangementboundariesbuildingbuildingscodesconditionsconstructioncontractorcountiescreatingdesigndevelopmentengineerengineersfacilitiesfeatureshistoricalimprovementsinfrastructure
SHARED TOKENS (49): "analysis", "arrangement", "boundaries", "building", "buildings", "codes", "conditions", "construction", "contractor", "counties", "creating", "design", "development", "engineer", "engineers", "facilities", "features", "historical", "improvements", "infrastructure".... | EXACT TITLE in land_use_planning: "Site plan". | EXACT TITLE in nuclear_clean_energy: "Site plan".
0.500
activitiesagriculturalagricultureannualapprovalcommissioncontrolleddevelopmentevenformsirrigationlandmeansnaturalorganizationpresentproductionrequirerequireszoning
SHARED TOKENS (20): "activities", "agricultural", "agriculture", "annual", "approval", "commission", "controlled", "development", "even", "forms", "irrigation", "land", "means", "natural", "organization", "present", "production", "require", "requires", "zoning". | EXACT TITLE in land_use_planning: "Agricultural land".
0.500
buildingsbuiltcivilcomponentsconstructiondepartmentsdesigndistinguishengineeringfirmsfocusedgovernmentinfrastructurelocallymunicipalnationalphysicalprivateprofessionalpublic
SHARED TOKENS (24): "buildings", "built", "civil", "components", "construction", "departments", "design", "distinguish", "engineering", "firms", "focused", "government", "infrastructure", "locally", "municipal", "national", "physical", "private", "professional", "public".... | EXACT TITLE in land_use_planning: "Civil engineering".
0.500
academicadaboardboisecanyoncareercollegecommunitycomprehensivecountiescwidevelopmenteasterneducationgovernedidaholargenampapopulationprograms
SHARED TOKENS (33): "academic", "ada", "board", "boise", "canyon", "career", "college", "community", "comprehensive", "counties", "cwi", "development", "eastern", "education", "governed", "idaho", "large", "nampa", "population", "programs".... | EXACT TITLE in land_use_planning: "College of Western Idaho". | EXACT TITLE in nuclear_clean_energy: "College of Western Idaho".
0.500
Light rail ↗ Q1268865 EXACT TITLE
broadercapacityconditionsdifferentequivalentexistflexibilityformmultiplenetworksoperatesoperatingoperationsrapidrightrights-of-waystreetssystemsystemstechnology
SHARED TOKENS (25): "broader", "capacity", "conditions", "different", "equivalent", "exist", "flexibility", "form", "multiple", "networks", "operates", "operating", "operations", "rapid", "right", "rights-of-way", "streets", "system", "systems", "technology".... | EXACT TITLE in land_use_planning: "Light rail".
0.500
Data center ↗ Q671224 EXACT TITLE
academicactaloneassociatedbuildingcentercleancomponentsconcernsconditionsconnectioncontainscontroldatadefinesdemanddifferentedgeelectricalenvironmental
SHARED TOKENS (61): "academic", "act", "alone", "associated", "building", "center", "clean", "components", "concerns", "conditions", "connection", "contains", "control", "data", "defines", "demand", "different", "edge", "electrical", "environmental".... | EXACT TITLE in nuclear_clean_energy: "Data center".
0.500
activityapplicationsapproximatelyconditionsdesigndifferenteastidahoindustrialisolatedmaterialsmultiplenationaloperatesphysicalplantspositionspowerpressureproduced
SHARED TOKENS (27): "activity", "applications", "approximately", "conditions", "design", "different", "east", "idaho", "industrial", "isolated", "materials", "multiple", "national", "operates", "physical", "plants", "positions", "power", "pressure", "produced".... | EXACT TITLE in nuclear_clean_energy: "Advanced Test Reactor".
0.500
adoptedassociationauthoritycasescodecomplianceelectricalengineersevenfederalfiregoverninginstitutejurisdictionlawlineslocalnationalpowerprivate
SHARED TOKENS (27): "adopted", "association", "authority", "cases", "code", "compliance", "electrical", "engineers", "even", "federal", "fire", "governing", "institute", "jurisdiction", "law", "lines", "local", "national", "power", "private".... | EXACT TITLE in nuclear_clean_energy: "National Electrical Code".
0.500
activitiesallowedcommunitycompatibilitycomprehensivecurrentdevelopmentdocumentestablishinggeneralgoalsgrowthhousinginstrumentslandlargelong-termmasterneighborhoodplan
SHARED TOKENS (33): "activities", "allowed", "community", "compatibility", "comprehensive", "current", "development", "document", "establishing", "general", "goals", "growth", "housing", "instruments", "land", "large", "long-term", "master", "neighborhood", "plan".... | EXACT TITLE in land_use_planning: "Comprehensive planning". | EXACT TITLE in nuclear_clean_energy: "Comprehensive planning".
0.500
alternativesassessmentbusinessescomprehensivedesignevaluationfacilitiesfuturegoalsgovernmentimpactsincorporatesinfluencelinesmovemovementplanningprivateprocesspublic
SHARED TOKENS (24): "alternatives", "assessment", "businesses", "comprehensive", "design", "evaluation", "facilities", "future", "goals", "government", "impacts", "incorporates", "influence", "lines", "move", "movement", "planning", "private", "process", "public".... | EXACT TITLE in land_use_planning: "Transportation planning".
0.480
Floodplain ↗ Q193110 EXACT TITLE
advantageagriculturalbasecontroldevelopeddischargeexperiencefloodlandriskriverurbanvalleywater
SHARED TOKENS (14): "advantage", "agricultural", "base", "control", "developed", "discharge", "experience", "flood", "land", "risk", "river", "urban", "valley", "water". | EXACT TITLE in land_use_planning: "Floodplain".
0.480
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclimatecommunitiesconditionsdifferentformationleadingphysicalprovideresourcestudywater
SHARED TOKENS (14): "agriculture", "annual", "change", "climate", "communities", "conditions", "different", "formation", "leading", "physical", "provide", "resource", "study", "water". | EXACT TITLE in nuclear_clean_energy: "Snowpack".
0.480
alternativeamericanbuiltfacilitiesgeneratorsindexinternationaljanuaryoperatesplantspowerproductionsuppliestechnology
SHARED TOKENS (14): "alternative", "american", "built", "facilities", "generators", "index", "international", "january", "operates", "plants", "power", "production", "supplies", "technology". | EXACT TITLE in nuclear_clean_energy: "Ormat Technologies".
0.460
Wastewater ↗ Q336191 EXACT TITLE
activitiesagriculturalanotherapplicationscommercialcommunityindustrialmunicipalprocessesproducedsewerwastewaterwater
SHARED TOKENS (13): "activities", "agricultural", "another", "applications", "commercial", "community", "industrial", "municipal", "processes", "produced", "sewer", "wastewater", "water". | EXACT TITLE in land_use_planning: "Wastewater". | EXACT TITLE in nuclear_clean_energy: "Wastewater".
0.460
businessdistributioneasternelectricalidahonaturaloperatesplantspowerregulatedriversouthernutility
SHARED TOKENS (13): "business", "distribution", "eastern", "electrical", "idaho", "natural", "operates", "plants", "power", "regulated", "river", "southern", "utility". | EXACT TITLE in nuclear_clean_energy: "Idaho Power".
0.460
commercialcommunitiesdevelopersdevelopmenthousingindependentlyindustriallandlargeownedparcelsretailsingle
SHARED TOKENS (13): "commercial", "communities", "developers", "development", "housing", "independently", "industrial", "land", "large", "owned", "parcels", "retail", "single". | EXACT TITLE in land_use_planning: "Subdivision (land)".
0.460
administrativeappliesboardbuildingcodedevelopmentlandmunicipalordinanceregulationsrulesstandardszoning
SHARED TOKENS (13): "administrative", "applies", "board", "building", "code", "development", "land", "municipal", "ordinance", "regulations", "rules", "standards", "zoning". | EXACT TITLE in land_use_planning: "Variance (land use)".
0.440
commissionidahooperatedownedpowerprovidepublicregulateregulatesutilitiesutilitywater
SHARED TOKENS (12): "commission", "idaho", "operated", "owned", "power", "provide", "public", "regulate", "regulates", "utilities", "utility", "water". | EXACT TITLE in nuclear_clean_energy: "Idaho Public Utilities Commission".
0.440
Easement ↗ Q448405 EXACT TITLE
accessamonganotheritselflandlawownedpropertypublicrealrightrights
SHARED TOKENS (12): "access", "among", "another", "itself", "land", "law", "owned", "property", "public", "real", "right", "rights". | EXACT TITLE in land_use_planning: "Easement".
0.440
anotherapplicationengineeringexpectedfuturegeneratemeanspercentprocessessciencesystemstogether
SHARED TOKENS (12): "another", "application", "engineering", "expected", "future", "generate", "means", "percent", "processes", "science", "systems", "together". | EXACT TITLE in nuclear_clean_energy: "Nuclear engineering".
0.440
commercialcompleteconventionalcreatedevelopedeconomymaterialmaterialsmethodsoperatedoperatingreduced
SHARED TOKENS (12): "commercial", "complete", "conventional", "create", "developed", "economy", "material", "materials", "methods", "operated", "operating", "reduced". | EXACT TITLE in nuclear_clean_energy: "Breeder reactor".
0.420
departmentfederalfundingfutureidahoinfrastructureoperationsorganizationplanningprogramstransportation
SHARED TOKENS (11): "department", "federal", "funding", "future", "idaho", "infrastructure", "operations", "organization", "planning", "programs", "transportation". | EXACT TITLE in land_use_planning: "Idaho Transportation Department".
0.420
agriculturalcombineddivisioneastidaholargermajornationalrecreationrivervalley
SHARED TOKENS (11): "agricultural", "combined", "division", "east", "idaho", "larger", "major", "national", "recreation", "river", "valley". | EXACT TITLE in nuclear_clean_energy: "Payette River".
0.420
Drainage ↗ Q7481320 EXACT TITLE
agriculturalconditionsgrowthimprovelandnaturalneedproductionremovalsupplieswater
SHARED TOKENS (11): "agricultural", "conditions", "growth", "improve", "land", "natural", "need", "production", "removal", "supplies", "water". | EXACT TITLE in land_use_planning: "Drainage".
0.420
applicablefederallawprivateprocesspropertyprovideregulationsregulatoryrightsvalue
SHARED TOKENS (11): "applicable", "federal", "law", "private", "process", "property", "provide", "regulations", "regulatory", "rights", "value". | EXACT TITLE in land_use_planning: "Regulatory taking".
0.400
connectionfacilitieslawmarketsnetworknetworksphysicalregulatoryrequirementstraffic
SHARED TOKENS (10): "connection", "facilities", "law", "markets", "network", "networks", "physical", "regulatory", "requirements", "traffic". | EXACT TITLE in nuclear_clean_energy: "Interconnection".
0.400
coordinatescouncildevelopmentdivisionenvironmentalfederalofficepolicyqualityworks
SHARED TOKENS (10): "coordinates", "council", "development", "division", "environmental", "federal", "office", "policy", "quality", "works". | EXACT TITLE in land_use_planning: "Council on Environmental Quality".
0.400
describesdistincteconomygovernmentinfrastructurenationalprivateprotectionspecialstrategic
SHARED TOKENS (10): "describes", "distinct", "economy", "government", "infrastructure", "national", "private", "protection", "special", "strategic". | EXACT TITLE in nuclear_clean_energy: "Critical infrastructure".
0.380
Reservoir ↗ Q131681 EXACT TITLE
buildingbuiltcontrollingcreatedformpowerreservoirspacewater
SHARED TOKENS (9): "building", "built", "controlling", "created", "form", "power", "reservoir", "space", "water". | EXACT TITLE in land_use_planning: "Reservoir". | EXACT TITLE in nuclear_clean_energy: "Reservoir".
0.380
boisedepartmentenvironmentalfederalgovernmentidahoqualityregionalregulations
SHARED TOKENS (9): "boise", "department", "environmental", "federal", "government", "idaho", "quality", "regional", "regulations". | EXACT TITLE in land_use_planning: "Idaho Department of Environmental Quality". | EXACT TITLE in nuclear_clean_energy: "Idaho Department of Environmental Quality".
0.380
buildingdecemberidahonationalopenplantspowerproducedresearch
SHARED TOKENS (9): "building", "december", "idaho", "national", "open", "plants", "power", "produced", "research". | EXACT TITLE in nuclear_clean_energy: "Experimental Breeder Reactor I".
0.380
allowedapplicableauthorizesdistrictlandordinancepermituseszoning
SHARED TOKENS (9): "allowed", "applicable", "authorizes", "district", "land", "ordinance", "permit", "uses", "zoning". | EXACT TITLE in land_use_planning: "Special-use permit".
0.360
administrativeauthoritygovernmentpowerprocedureprocessreviewseparation
SHARED TOKENS (8): "administrative", "authority", "government", "power", "procedure", "process", "review", "separation". | EXACT TITLE in land_use_planning: "Judicial review".
0.360
applicationconcreteformindustrialprocessprocessesprocessingprovide
SHARED TOKENS (8): "application", "concrete", "form", "industrial", "process", "processes", "processing", "provide". | EXACT TITLE in nuclear_clean_energy: "Process heat".
0.320
containsgeneratematerialpowerproducessingle
SHARED TOKENS (6): "contains", "generate", "material", "power", "produces", "single". | EXACT TITLE in nuclear_clean_energy: "Nuclear fuel".
0.300
Smart growth ↗ Q1320100 KW CROSS HIGH
communitycompleteculturaldescribedevelopmentemploymentgoalsgovernmentgrowthhealthhousinglandnaturalneighborhoodplanningpublicregionalresourcesstreetstransportation
SHARED TOKENS (21): "community", "complete", "cultural", "describe", "development", "employment", "goals", "government", "growth", "health", "housing", "land", "natural", "neighborhood", "planning", "public", "regional", "resources", "streets", "transportation"....
0.300
Nuclear fusion ↗ Q13082 KW CROSS HIGH
amongapplicationscombineconditionsformlargelargerpathwayspowerprocessprocessesproducesproductionrequiresources
SHARED TOKENS (15): "among", "applications", "combine", "conditions", "form", "large", "larger", "pathways", "power", "process", "processes", "produces", "production", "require", "sources".
0.300
actamericanamongapproximatelyconservationcreateddepartmentestatefederalfuturegeneralgovernmentheadquarteredhealthidaholandmanagementnationalofficepermits
SHARED TOKENS (28): "act", "american", "among", "approximately", "conservation", "created", "department", "estate", "federal", "future", "general", "government", "headquartered", "health", "idaho", "land", "management", "national", "office", "permits"....
0.300
accessassociatedcannotconcernsconditionsconsequencesdefinesdesignersdifferentfacilitiesinternationalmaterialmaterialsoperatingplantspotentialpowerproposedprotectionpublic
SHARED TOKENS (30): "access", "associated", "cannot", "concerns", "conditions", "consequences", "defines", "designers", "different", "facilities", "international", "material", "materials", "operating", "plants", "potential", "power", "proposed", "protection", "public"....
0.300
amongapproximatelybarriersbehaviorconcerningconcernscontainscontinuescontrolconversioncostevaluationfeasibilityformationformsfuturegroundwaterhealthidentifiedimpacts
SHARED TOKENS (45): "among", "approximately", "barriers", "behavior", "concerning", "concerns", "contains", "continues", "control", "conversion", "cost", "evaluation", "feasibility", "formation", "forms", "future", "groundwater", "health", "identified", "impacts"....
0.300
concernsentityfacilitiesgenerateindependentindustrialoperatespowerprocesspublicruralsystemusableutilitiesutilitywater
SHARED TOKENS (16): "concerns", "entity", "facilities", "generate", "independent", "industrial", "operates", "power", "process", "public", "rural", "system", "usable", "utilities", "utility", "water".
0.300
americanbuildingcollaborationcommissioncontrolcostdesigndevelopeddevelopmentdistrictdocumentsengineerengineersequivalentfacilitiesformationgeneraljanuarylinesmajor
SHARED TOKENS (44): "american", "building", "collaboration", "commission", "control", "cost", "design", "developed", "development", "district", "documents", "engineer", "engineers", "equivalent", "facilities", "formation", "general", "january", "lines", "major"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
associatedbecomebuildingcitiescommercialconsequencesdevelopmentenvironmentalexpansionformgeographicgrowthhousingindustrialinfrastructurelandlargemodernplanningpopulation
SHARED TOKENS (37): "associated", "become", "building", "cities", "commercial", "consequences", "development", "environmental", "expansion", "form", "geographic", "growth", "housing", "industrial", "infrastructure", "land", "large", "modern", "planning", "population"....
0.300
changechangesdemanddistributionelectricalgeneratorsimproveintegratedlargemanagementmarketmarketspowerpresentpublicreduceregulatedsupplysystemvertically
SHARED TOKENS (20): "change", "changes", "demand", "distribution", "electrical", "generators", "improve", "integrated", "large", "management", "market", "markets", "power", "present", "public", "reduce", "regulated", "supply", "system", "vertically".
0.300
actualadditionallyaffectingcapacityconditionsconstraintsdesigndifferentelectricallocalmarketnetoperationoperationalpowerproductionreducedregulatorysource
SHARED TOKENS (19): "actual", "additionally", "affecting", "capacity", "conditions", "constraints", "design", "different", "electrical", "local", "market", "net", "operation", "operational", "power", "production", "reduced", "regulatory", "source".
0.300
Street network ↗ Q358078 KW CROSS HIGH
affectanalysisbecomecitiesconnectedcreatingedgeslinesmovementnationalnetworknetworksroadsroutesciencestreetssystemtraffictransportation
SHARED TOKENS (19): "affect", "analysis", "become", "cities", "connected", "creating", "edges", "lines", "movement", "national", "network", "networks", "roads", "route", "science", "streets", "system", "traffic", "transportation".
0.300
additionalagriculturalapplicationsboundariesbuiltcapacityconditionscostdepartmentdistrictformationindustrialplantspowerprocessesreduceresourcessourcespacesupply
SHARED TOKENS (21): "additional", "agricultural", "applications", "boundaries", "built", "capacity", "conditions", "cost", "department", "district", "formation", "industrial", "plants", "power", "processes", "reduce", "resources", "source", "space", "supply"....
0.300
Nuclear reactor ↗ Q80877 KW CROSS HIGH
absorbbuiltchaincommercialcontrolledcostdesigndevelopeddiscoverydistricteffectsefficiencyelectricalindustrialmajormovementmultipleoperatedoperationoperator
SHARED TOKENS (33): "absorb", "built", "chain", "commercial", "controlled", "cost", "design", "developed", "discovery", "district", "effects", "efficiency", "electrical", "industrial", "major", "movement", "multiple", "operated", "operation", "operator"....
0.300
Wind power ↗ Q43302 KW CROSS HIGH
agreementcapacitychangeclimateconnectedelectricalgenerategoalsplantspotentialpowerproducedsourcesourcessouthernsupplyvisualwork
SHARED TOKENS (18): "agreement", "capacity", "change", "climate", "connected", "electrical", "generate", "goals", "plants", "potential", "power", "produced", "source", "sources", "southern", "supply", "visual", "work".
0.300
alternativesapplicationscapacitychainconservationcostdefinesdemanddistrictefficiencyevaluatesexpectedformgrowthinfluenceintegratedlawlong-termmeansmethodology
SHARED TOKENS (33): "alternatives", "applications", "capacity", "chain", "conservation", "cost", "defines", "demand", "district", "efficiency", "evaluates", "expected", "form", "growth", "influence", "integrated", "law", "long-term", "means", "methodology"....
0.300
Net metering ↗ Q2685471 KW CROSS HIGH
annualarrangementconnectioncurrentdecemberevenfeegenerateinvestmentlatermechanismnetpolicypowerprivateprocedurerequirerequiresretailsettlement
SHARED TOKENS (24): "annual", "arrangement", "connection", "current", "december", "even", "fee", "generate", "investment", "later", "mechanism", "net", "policy", "power", "private", "procedure", "require", "requires", "retail", "settlement"....
0.300
authoritybasecapitalcleancombinedcostcouncildemandefficiencyopenplacesplantspowerrapidlyreducedreplaceseekingsupply
SHARED TOKENS (18): "authority", "base", "capital", "clean", "combined", "cost", "council", "demand", "efficiency", "open", "places", "plants", "power", "rapidly", "reduced", "replace", "seeking", "supply".
0.300
additionallyapplicationscentralcleancomponentscontrolcreatecreatedfacilitiesimproveindustrialinsideintegratedlargemaintainmanufacturingmaterialmaterialsmodernneed
SHARED TOKENS (32): "additionally", "applications", "central", "clean", "components", "control", "create", "created", "facilities", "improve", "industrial", "inside", "integrated", "large", "maintain", "manufacturing", "material", "materials", "modern", "need"....
0.300
affectedassociationauthoritybecomecapacitychangesconcernsconstructionenvironmentalevenexistfacilitiesinternationallargelargestpolicypowerproducedprojectsrequires
SHARED TOKENS (29): "affected", "association", "authority", "become", "capacity", "changes", "concerns", "construction", "environmental", "even", "exist", "facilities", "international", "large", "largest", "policy", "power", "produced", "projects", "requires"....
0.300
adaboisecanyoncitiescombinedcountieshomeidaholargerlargestmeridianmetropolitannampapercentpopulationtreasurevalleywider
SHARED TOKENS (18): "ada", "boise", "canyon", "cities", "combined", "counties", "home", "idaho", "larger", "largest", "meridian", "metropolitan", "nampa", "percent", "population", "treasure", "valley", "wider".
0.300
actadministeredauthoritycodecomprehensiveconservationdecemberdependdevelopmentdifferentdirectseconomicfederalgrowthinternationallawmeansnationalneededpreservation
SHARED TOKENS (27): "act", "administered", "authority", "code", "comprehensive", "conservation", "december", "depend", "development", "different", "directs", "economic", "federal", "growth", "international", "law", "means", "national", "needed", "preservation"....
0.300
approximatelyassociationcommercialconnectedcoordinatescostdecemberdesigndevelopeddevelopmentefficiencyfacilitiesfundingfutureintendedinternationalmakingmodelsoperationoperational
SHARED TOKENS (31): "approximately", "association", "commercial", "connected", "coordinates", "cost", "december", "design", "developed", "development", "efficiency", "facilities", "funding", "future", "intended", "international", "making", "models", "operation", "operational"....
0.300
Smart grid ↗ Q689855 KW CROSS HIGH
capacitycodeconcernsconnectcontrolcreatecurrentdeliverydemanddistributeddistributionefficiencyelectricalevenfinancedfinancingflexibilityfocusedfunctiongeneral
SHARED TOKENS (54): "capacity", "code", "concerns", "connect", "control", "create", "current", "delivery", "demand", "distributed", "distribution", "efficiency", "electrical", "even", "financed", "financing", "flexibility", "focused", "function", "general"....
0.300
approvalbuildingcannotcodecodescomplianceconstructiondevelopmenteconomyemploymentexpansionfinancinggovernmentlawleadinglocalnationalneededpermissionpermit
SHARED TOKENS (29): "approval", "building", "cannot", "code", "codes", "compliance", "construction", "development", "economy", "employment", "expansion", "financing", "government", "law", "leading", "local", "national", "needed", "permission", "permit"....
0.300
accessactadditionallyapplicablebroadercostdatadevelopmentestablishexistformgeneralgovernmentinformationinstitutionslegalmakingmeanspolicypractice
SHARED TOKENS (29): "access", "act", "additionally", "applicable", "broader", "cost", "data", "development", "establish", "exist", "form", "general", "government", "information", "institutions", "legal", "making", "means", "policy", "practice"....
0.300
buildingbusinesscentercentraldevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepromotespublicreducingresidentialscaleservingspace
SHARED TOKENS (21): "building", "business", "center", "central", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "promotes", "public", "reducing", "residential", "scale", "serving", "space"....
0.300
anotherarrangementbecomechaincombineconsolidationdifferentdirectlyeconomyfinalfirmintegratedintegrationinternationallargemakingmanagementmarketneedneeded
SHARED TOKENS (36): "another", "arrangement", "become", "chain", "combine", "consolidation", "different", "directly", "economy", "final", "firm", "integrated", "integration", "international", "large", "making", "management", "market", "need", "needed"....
0.300
activitiesactivityadministrativeanotherbuiltchangescivilcontrolcoordinatecreateddecisionsdivisioneconomiceducationenvironmentalgoverninggovernmentincreaseinfluenceinternational
SHARED TOKENS (35): "activities", "activity", "administrative", "another", "built", "changes", "civil", "control", "coordinate", "created", "decisions", "division", "economic", "education", "environmental", "governing", "government", "increase", "influence", "international"....
0.300
authorityboundariescreateddistrictentitygeographicgovernmentirrigationlargelocalpowerprojectspublictaxwater
SHARED TOKENS (15): "authority", "boundaries", "created", "district", "entity", "geographic", "government", "irrigation", "large", "local", "power", "projects", "public", "tax", "water".
0.300
analysisbuildingbuildingscapacitycommercialcomponentscomprehensivedistributedelectricalformhouseholdsindustriallargemanagementmonitoringnetpowerresidentialscalestructure
SHARED TOKENS (23): "analysis", "building", "buildings", "capacity", "commercial", "components", "comprehensive", "distributed", "electrical", "form", "households", "industrial", "large", "management", "monitoring", "net", "power", "residential", "scale", "structure"....
0.300
actionamongannexationboundariescitiescontroldistinctgovernmentjurisdictionlawlocalmunicipalneighboringprocessresponseseekterritoryurbanwork
SHARED TOKENS (19): "action", "among", "annexation", "boundaries", "cities", "control", "distinct", "government", "jurisdiction", "law", "local", "municipal", "neighboring", "process", "response", "seek", "territory", "urban", "work".
0.300
Photovoltaics ↗ Q192127 KW CROSS HIGH
additionalallowedapplicationscapacitychangeclimateconstraintsconversioncostcoveringcurrentdemanddirectdistributionefficiencyelectricalexpectedfinancialfinancinggenerate
SHARED TOKENS (55): "additional", "allowed", "applications", "capacity", "change", "climate", "constraints", "conversion", "cost", "covering", "current", "demand", "direct", "distribution", "efficiency", "electrical", "expected", "financial", "financing", "generate"....
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycasesconservationcreateddifferentestategovernmentlandlegallineslocaloriginalownerownershipphysicalprivaterealrightrightsrights-of-way
SHARED TOKENS (28): "authority", "cases", "conservation", "created", "different", "estate", "government", "land", "legal", "lines", "local", "original", "owner", "ownership", "physical", "private", "real", "right", "rights", "rights-of-way"....
0.300
adaboisebuiltcanyoncompletedconcretecountiesengineersidahoirrigationoperatedreclamationrivertreasurevalleywaterwestern
SHARED TOKENS (17): "ada", "boise", "built", "canyon", "completed", "concrete", "counties", "engineers", "idaho", "irrigation", "operated", "reclamation", "river", "treasure", "valley", "water", "western".
0.300
Solar tracker ↗ Q938237 KW CROSS HIGH
applicationscapacitycomponentsdirectefficiencyincreasesmarketplacespowerproducedprojectsreducingsystemsthereforetoward
SHARED TOKENS (15): "applications", "capacity", "components", "direct", "efficiency", "increases", "market", "places", "power", "produced", "projects", "reducing", "systems", "therefore", "toward".
0.300
approximatelyassociationconductsconstructioncontractorscostdataelectricalgovernmentinsideinternationaljointnationalnetworksprogramspublicrelatedrepresentstrainingutilities
SHARED TOKENS (22): "approximately", "association", "conducts", "construction", "contractors", "cost", "data", "electrical", "government", "inside", "international", "joint", "national", "networks", "programs", "public", "related", "represents", "training", "utilities"....
0.300
actactionactivitiesadministrativecommissionconcernsdepartmentdevelopmentestablishedfacilitiesfederalfunctionslaterlawmajormaterialsnoticepowerproductionregulation
SHARED TOKENS (29): "act", "action", "activities", "administrative", "commission", "concerns", "department", "development", "established", "facilities", "federal", "functions", "later", "law", "major", "materials", "notice", "power", "production", "regulation"....
0.300
additionalbuildingconservationcreatedcurrentdepartmentdevelopmentdirectlydirectsdoefebruaryfederalgovernmentmaterialnationaloriginatingphysicalpolicypositionpower
SHARED TOKENS (28): "additional", "building", "conservation", "created", "current", "department", "development", "directly", "directs", "doe", "february", "federal", "government", "material", "national", "originating", "physical", "policy", "position", "power"....
0.300
actualagriculturalcommunityconservationcontrolledcreatedevelopmentenvironmentalgrowthlandmanagementnaturalopenownedplanningpreservationprivateresourcesruralspace
SHARED TOKENS (23): "actual", "agricultural", "community", "conservation", "controlled", "create", "development", "environmental", "growth", "land", "management", "natural", "open", "owned", "planning", "preservation", "private", "resources", "rural", "space"....
0.300
americanbuiltcompletedconcretecontrolfallsfloodidahoirrigationitselforiginalpowerprojectreclamationrecreationreservoirresidentsriverstructurewestern
SHARED TOKENS (20): "american", "built", "completed", "concrete", "control", "falls", "flood", "idaho", "irrigation", "itself", "original", "power", "project", "reclamation", "recreation", "reservoir", "residents", "river", "structure", "western".
0.300
Cogeneration ↗ Q221620 KW CROSS HIGH
buildingbuildingscentralcombinedcostdistributeddistrictefficiencyelectricalgeneratelargeofficeoperationsplantspopulationpowerprocesssafetyspacesupply
SHARED TOKENS (22): "building", "buildings", "central", "combined", "cost", "distributed", "district", "efficiency", "electrical", "generate", "large", "office", "operations", "plants", "population", "power", "process", "safety", "space", "supply"....
0.300
changescommercialcontrolledcurrentdevelopeddifferentdirecteconomyequivalentformindependentlylinesmodernnetworknetworkspowerrapidrequiresourcesystem
SHARED TOKENS (24): "changes", "commercial", "controlled", "current", "developed", "different", "direct", "economy", "equivalent", "form", "independently", "lines", "modern", "network", "networks", "power", "rapid", "require", "source", "system"....
0.300
accessbecomebuiltcombinedconcernsconnectedconnectingcurrentdeliverydistributionelectricalgeneratorsgrowingincreaseslargemarketsneedneedednetworkpopulation
SHARED TOKENS (27): "access", "become", "built", "combined", "concerns", "connected", "connecting", "current", "delivery", "distribution", "electrical", "generators", "growing", "increases", "large", "markets", "need", "needed", "network", "population"....
0.300
Arrowrock Dam ↗ Q117911 KW CROSS HIGH
agricultureamericanboisecivilconcretecountieseastengineeringengineersidahoirrigationnationaloperatedprovidereclamationreservoirriverwaterwestern
SHARED TOKENS (19): "agriculture", "american", "boise", "civil", "concrete", "counties", "east", "engineering", "engineers", "idaho", "irrigation", "national", "operated", "provide", "reclamation", "reservoir", "river", "water", "western".
0.300
activitiesauthoritybehaviorcapacitycasesfederalgeneralgovernmenthealthinterstatejurisdictionlawlegalmeansmethodsneedphysicalpowerpublicregulate
SHARED TOKENS (27): "activities", "authority", "behavior", "capacity", "cases", "federal", "general", "government", "health", "interstate", "jurisdiction", "law", "legal", "means", "methods", "need", "physical", "power", "public", "regulate"....
0.300
affordabilityaffordableamonganotherbuildingsbuiltcasescitiescodecommunitiesconstructedcontrolcontrolscostcreatedevelopersdevelopmenteffectsfeesfinancial
SHARED TOKENS (48): "affordability", "affordable", "among", "another", "buildings", "built", "cases", "cities", "code", "communities", "constructed", "control", "controls", "cost", "create", "developers", "development", "effects", "fees", "financial"....
0.300
firmheadquarteredlargestmajorsupply
SHARED TOKENS (5): "firm", "headquartered", "largest", "major", "supply". | EXACT TITLE in land_use_planning: "Sekisui House".
0.300
activityamongapproximatelyassociationboisecanyoncapacitycentercompletedconservationcontainscountiescreatedcreatesdirectlyeastedgefebruaryfederalformation
SHARED TOKENS (40): "activity", "among", "approximately", "association", "boise", "canyon", "capacity", "center", "completed", "conservation", "contains", "counties", "created", "creates", "directly", "east", "edge", "february", "federal", "formation"....
0.300
affectcommunitiescreatingdistributionenvironmentalfeaturesfunctionslandmanagementnaturalplanningplansprocessprogramsprojectsqualityresourcesrightsseekspecialists
SHARED TOKENS (23): "affect", "communities", "creating", "distribution", "environmental", "features", "functions", "land", "management", "natural", "planning", "plans", "process", "programs", "projects", "quality", "resources", "rights", "seek", "specialists"....
0.300
accessaffectsassetbuildingbusinesscoordinatecreateddepartmentdevelopmentemergencyfederalfundinggovernmenthousinginfrastructurelocalmajormanagementpersonnelplan
SHARED TOKENS (29): "access", "affects", "asset", "building", "business", "coordinate", "created", "department", "development", "emergency", "federal", "funding", "government", "housing", "infrastructure", "local", "major", "management", "personnel", "plan"....
0.300
actapproximatelyconstructedcoverageenvironmentalestablishesfacilitiesfederalgeneralgovernmentgovernsincreaselawpolicypowerprivateproductionpublicstudysystem
SHARED TOKENS (22): "act", "approximately", "constructed", "coverage", "environmental", "establishes", "facilities", "federal", "general", "government", "governs", "increase", "law", "policy", "power", "private", "production", "public", "study", "system"....
0.300
actionactualadministrativeappliesapprovalassessmentassociationcommitmentsconsequencesdecisionsdefinesdevelopmentdocumentationeffectsenvironmentalgovernedidentifyingimpactsinternationalmajor
SHARED TOKENS (41): "action", "actual", "administrative", "applies", "approval", "assessment", "association", "commitments", "consequences", "decisions", "defines", "development", "documentation", "effects", "environmental", "governed", "identifying", "impacts", "international", "major"....
0.300
acquisitionactactivityanotherassetsbusinesscapitalcentralcombinecombinedcommissionconsolidationcontrolcorporatecreatedepartmentdirecteffectsentityfederal
SHARED TOKENS (47): "acquisition", "act", "activity", "another", "assets", "business", "capital", "central", "combine", "combined", "commission", "consolidation", "control", "corporate", "create", "department", "direct", "effects", "entity", "federal"....
0.300
allowedamericanbuildingcodescommercialdevelopeddevelopmentdistrictenvironmentalflexibilityhousingindustriallandopenplannedplanningplanspreservationprocessrecreation
SHARED TOKENS (28): "allowed", "american", "building", "codes", "commercial", "developed", "development", "district", "environmental", "flexibility", "housing", "industrial", "land", "open", "planned", "planning", "plans", "preservation", "process", "recreation"....
0.300
administrativeanotherapprovedcompletecontrolfacilitiesfinalfuturegrowingindustrialleadinglicensematerialsoperatingownerplanprocessprotectionregulatoryremains
SHARED TOKENS (27): "administrative", "another", "approved", "complete", "control", "facilities", "final", "future", "growing", "industrial", "leading", "license", "materials", "operating", "owner", "plan", "process", "protection", "regulatory", "remains"....
0.300
assessmentcategoriescommissiondataeffectsemergencyhealthinternationallimitsmeansoccupationalpresentprotectionsafetysignificantsourceunits
SHARED TOKENS (17): "assessment", "categories", "commission", "data", "effects", "emergency", "health", "international", "limits", "means", "occupational", "present", "protection", "safety", "significant", "source", "units".
0.300
buildingcleanconstructedconstructioncontainscontrolcontrolledcontrollingcostcreatedeliverydischargeelectricalevenfeaturesintegrateditselfmanufacturingmodeloffice
SHARED TOKENS (35): "building", "clean", "constructed", "construction", "contains", "control", "controlled", "controlling", "cost", "create", "delivery", "discharge", "electrical", "even", "features", "integrated", "itself", "manufacturing", "model", "office"....
0.300
americancapacitycentercentralcompletedconditionsdecemberdevelopmentfederalgovernmentgrowthhomejanuarylargestoverviewpermittingpowerprocessproductionprojects
SHARED TOKENS (26): "american", "capacity", "center", "central", "completed", "conditions", "december", "development", "federal", "government", "growth", "home", "january", "largest", "overview", "permitting", "power", "process", "production", "projects"....
0.300
alongsidecategorychaincommercialconstructedconvertefficiencyfuturehistoricallargestmaintainmaterialnationaloperatedoperationalpowerproposedreducingrequirerequires
SHARED TOKENS (24): "alongside", "category", "chain", "commercial", "constructed", "convert", "efficiency", "future", "historical", "largest", "maintain", "material", "national", "operated", "operational", "power", "proposed", "reducing", "require", "requires"....
0.300
Right to property ↗ KW CROSS HIGH
civilculturaleconomicgeneralinternationallegalnaturalownershippoliticalprivatepropertyprotectionrightrightssignificantspecified
SHARED TOKENS (16): "civil", "cultural", "economic", "general", "international", "legal", "natural", "ownership", "political", "private", "property", "protection", "right", "rights", "significant", "specified".
0.300
actionadditionallyaffectagriculturalagriculturechangecivilclimatecommunitiesconnectconservationconstructioncontrolcorridorengineeringenvironmentalevenfloodgroundwaterhabitat
SHARED TOKENS (47): "action", "additionally", "affect", "agricultural", "agriculture", "change", "civil", "climate", "communities", "connect", "conservation", "construction", "control", "corridor", "engineering", "environmental", "even", "flood", "groundwater", "habitat"....
0.300
actactivitiesadministeredadministrativeamongassociatedchangecleanclimatecontrolcoordinationcreatedependenvironmentalfacilitiesfederalhazardousindustrialintendedlaw
SHARED TOKENS (41): "act", "activities", "administered", "administrative", "among", "associated", "change", "clean", "climate", "control", "coordination", "create", "depend", "environmental", "facilities", "federal", "hazardous", "industrial", "intended", "law"....
0.300
boisecontainscoveringcreatedfacilitieshomeidaholandmaintainmultiplenationalpercentrecreationresourcesriverunitswaterwildlife
SHARED TOKENS (18): "boise", "contains", "covering", "created", "facilities", "home", "idaho", "land", "maintain", "multiple", "national", "percent", "recreation", "resources", "river", "units", "water", "wildlife".
0.300
distributionfacilitiesinfrastructurelargestlocalmajormarketmarketsnationalownedpowerproviderspublicregulatedregulationutilitiesutility
SHARED TOKENS (17): "distribution", "facilities", "infrastructure", "largest", "local", "major", "market", "markets", "national", "owned", "power", "providers", "public", "regulated", "regulation", "utilities", "utility".
0.300
affordabilityamongauthoritycasescitiesconcernsconstructiondistricteconomiceconomyenvironmentalgrowinghomeshousingincreasejurisdictionlandlimitslocalmajor
SHARED TOKENS (39): "affordability", "among", "authority", "cases", "cities", "concerns", "construction", "district", "economic", "economy", "environmental", "growing", "homes", "housing", "increase", "jurisdiction", "land", "limits", "local", "major"....
0.300
adaboisebuiltcompletedconcreteconstructioncontroldirectlyeastengineersfederalfloodformsidahoirrigationmultipleoperatingoperationalpowerprivate
SHARED TOKENS (27): "ada", "boise", "built", "completed", "concrete", "construction", "control", "directly", "east", "engineers", "federal", "flood", "forms", "idaho", "irrigation", "multiple", "operating", "operational", "power", "private"....
0.300
combinedconnectscurrentdeliverydirectdirectlydistinctdistributioneasternefficiencyelectricalevenformgeneratorsincreaselineslocalmajormarketmovement
SHARED TOKENS (28): "combined", "connects", "current", "delivery", "direct", "directly", "distinct", "distribution", "eastern", "efficiency", "electrical", "even", "form", "generators", "increase", "lines", "local", "major", "market", "movement"....
0.300
accessboisebuiltcanyoncapacityconcretecontainscontractorfallsfinalidahoinformationlargestoperatedownedpowerprojectreservoirriverunits
SHARED TOKENS (21): "access", "boise", "built", "canyon", "capacity", "concrete", "contains", "contractor", "falls", "final", "idaho", "information", "largest", "operated", "owned", "power", "project", "reservoir", "river", "units"....
0.300
communitydevelopmentdirectlydistricteconomicfinancingfutureincreasesinfrastructureinvestmentneedoriginalprivateprogramprojectprojectspropertypublicrelatedrevenue
SHARED TOKENS (23): "community", "development", "directly", "district", "economic", "financing", "future", "increases", "infrastructure", "investment", "need", "original", "private", "program", "project", "projects", "property", "public", "related", "revenue"....
0.300
activitiesactivityanalysisbecomesboundariescasesdesigndocumentationengineerengineeringengineersestablishedgeneralgovernmentlegallicenselicensedlocaloverviewplans
SHARED TOKENS (39): "activities", "activity", "analysis", "becomes", "boundaries", "cases", "design", "documentation", "engineer", "engineering", "engineers", "established", "general", "government", "legal", "license", "licensed", "local", "overview", "plans"....
0.300
alternativeapplicationapproximatelybusinessescitiescombinedconnectedconstructioncontainsdemanddesigndevelopeddifferentdischargeengineersevenexpectedfieldhouseholdsincorporates
SHARED TOKENS (47): "alternative", "application", "approximately", "businesses", "cities", "combined", "connected", "construction", "contains", "demand", "design", "developed", "different", "discharge", "engineers", "even", "expected", "field", "households", "incorporates"....
0.300
Superfund ↗ Q3504641 KW CROSS HIGH
acquisitionactactionactivitiesactualadditionaladministeredapproximatelyassessmentauthorizesbusinesscannotcleancomprehensiveconservationcontainscontrolscostcreatedcultural
SHARED TOKENS (70): "acquisition", "act", "action", "activities", "actual", "additional", "administered", "approximately", "assessment", "authorizes", "business", "cannot", "clean", "comprehensive", "conservation", "contains", "controls", "cost", "created", "cultural"....
0.300
activityadvantageannualapplicationapplicationsapproximatelyboundariescapacitycontainsconversiondirectefficiencyevenformationgroundwaterneededoriginalsource
SHARED TOKENS (18): "activity", "advantage", "annual", "application", "applications", "approximately", "boundaries", "capacity", "contains", "conversion", "direct", "efficiency", "even", "formation", "groundwater", "needed", "original", "source".
0.300
analysisassessmentcapacitycombinedcostcurrentdatademandemploymentengineeringenvironmentalfinancialforecastfutureimpactsinfrastructuremodelnoiseplannedplanning
SHARED TOKENS (28): "analysis", "assessment", "capacity", "combined", "cost", "current", "data", "demand", "employment", "engineering", "environmental", "financial", "forecast", "future", "impacts", "infrastructure", "model", "noise", "planned", "planning"....
0.300
actactivitiesadministeredapproximatelyauthoritybuildingbusinesscapacitycivilcleancombinedcomponentsconstructconstructioncontroldepartmentdesigndirectdirectlyeast
SHARED TOKENS (67): "act", "activities", "administered", "approximately", "authority", "building", "business", "capacity", "civil", "clean", "combined", "components", "construct", "construction", "control", "department", "design", "direct", "directly", "east"....
0.300
allowedapproximatelyconstructiondesigndevelopeddirectlyelectricalformgeneralinsidenationalpowerpresentpressureriverseparationsourcewater
SHARED TOKENS (18): "allowed", "approximately", "construction", "design", "developed", "directly", "electrical", "form", "general", "inside", "national", "power", "present", "pressure", "river", "separation", "source", "water".
0.300
agriculturalaquifereasteasternfallsgroundwateridahoirrigationlargereservoirriverseparatesourcesouthernwaterwestern
SHARED TOKENS (16): "agricultural", "aquifer", "east", "eastern", "falls", "groundwater", "idaho", "irrigation", "large", "reservoir", "river", "separate", "source", "southern", "water", "western".
0.300
agriculturalagriculturebuildingcostdegreedesigndevelopeddeveloperdevelopmententitygeneralgovernmentlandlimitsnaturalopenoperatoropportunityprivatepublic
SHARED TOKENS (26): "agricultural", "agriculture", "building", "cost", "degree", "design", "developed", "developer", "development", "entity", "general", "government", "land", "limits", "natural", "open", "operator", "opportunity", "private", "public"....
0.300
actconditionsdecemberdepartmenteducationeffectsemploymentestablishedfederalfirmhealthlawoccupationalratesratingsreduceregulationsregulatorysafetystandards
SHARED TOKENS (21): "act", "conditions", "december", "department", "education", "effects", "employment", "established", "federal", "firm", "health", "law", "occupational", "rates", "ratings", "reduce", "regulations", "regulatory", "safety", "standards"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionactionanotherapplicationbuildingsconnectdevelopmentevenfeefinalfunctionsgovernmentlandlaterlegalnetworksownerownersownershippower
SHARED TOKENS (32): "acquisition", "action", "another", "application", "buildings", "connect", "development", "even", "fee", "final", "functions", "government", "land", "later", "legal", "networks", "owner", "owners", "ownership", "power"....
0.300
alternativeanotherbecomesbeyondcapacitychangeconnectedcostdemandeconomiceconomicselectricalexperienceflexibilityformformslargelargestlaterlong-duration
SHARED TOKENS (36): "alternative", "another", "becomes", "beyond", "capacity", "change", "connected", "cost", "demand", "economic", "economics", "electrical", "experience", "flexibility", "form", "forms", "large", "largest", "later", "long-duration"....
0.300
associationcapacityconsumerconventionaldemandefficiencyelectricalformincreasesinternationalmarketnetplantspotentialpowerprocessreportedreservoirrevenueriver
SHARED TOKENS (25): "association", "capacity", "consumer", "conventional", "demand", "efficiency", "electrical", "form", "increases", "international", "market", "net", "plants", "potential", "power", "process", "reported", "reservoir", "revenue", "river"....
0.300
Spot zoning ↗ Q3494193 KW CROSS HIGH
actanotherapplicationauthorityboundariesbuildingchangecommercialcommissioncommunitycontrolcouncilcreatingcurrentdistrictgeneralgoalsgovernmentindustrialland
SHARED TOKENS (50): "act", "another", "application", "authority", "boundaries", "building", "change", "commercial", "commission", "community", "control", "council", "creating", "current", "district", "general", "goals", "government", "industrial", "land"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldevelopmentexpansionfinancefinancialfinancingfirmfirmsgeneralgoalsinvestmentlong-termmanagementoperationalownershipprivate
SHARED TOKENS (27): "business", "capital", "category", "changes", "control", "development", "expansion", "finance", "financial", "financing", "firm", "firms", "general", "goals", "investment", "long-term", "management", "operational", "ownership", "private"....
0.300
alternativesassociatedbeyondcontrolledcostexistfacilitiesfocusedformmaterialmeansnaturalpersonnelplanspowerprocessprocessesprogramregulatedrequires
SHARED TOKENS (25): "alternatives", "associated", "beyond", "controlled", "cost", "exist", "facilities", "focused", "form", "material", "means", "natural", "personnel", "plans", "power", "process", "processes", "program", "regulated", "requires"....
0.300
agreementagreementsassetassetsbuildingbuiltbusinessbusinessescommercialcontractsdirectlydistributedfinancingfirmsformgeneratorsgovernmentindependentlylong-termmaintains
SHARED TOKENS (30): "agreement", "agreements", "asset", "assets", "building", "built", "business", "businesses", "commercial", "contracts", "directly", "distributed", "financing", "firms", "form", "generators", "government", "independently", "long-term", "maintains"....
0.300
capacityconnectioncontrolcostdemandelectricalevenextendingformgrowinginsidelargelargestopenoperatingplantspowerrapidlyreducereduced
SHARED TOKENS (28): "capacity", "connection", "control", "cost", "demand", "electrical", "even", "extending", "form", "growing", "inside", "large", "largest", "open", "operating", "plants", "power", "rapidly", "reduce", "reduced"....
0.300
actagricultureallowedamericanapproximatelyboardboisecapacitycentercompletedconcreteconstructiondecemberdesignfallshomeidahoirrigationlawmaterials
SHARED TOKENS (35): "act", "agriculture", "allowed", "american", "approximately", "board", "boise", "capacity", "center", "completed", "concrete", "construction", "december", "design", "falls", "home", "idaho", "irrigation", "law", "materials"....
0.300
administrativeagreementagricultureapplicablearrangementchaincomplianceconservationcontinuescorridorscreatesdevelopmentdocumententityestablishedestatefederalfinancialforestryfuture
SHARED TOKENS (61): "administrative", "agreement", "agriculture", "applicable", "arrangement", "chain", "compliance", "conservation", "continues", "corridors", "creates", "development", "document", "entity", "established", "estate", "federal", "financial", "forestry", "future"....
0.300
commissioncreateddepartmentfederalgovernmentindependentinterstatelicensingnaturalpipelinepoliticalprojectsregulatesregulatoryreviewsserving
SHARED TOKENS (16): "commission", "created", "department", "federal", "government", "independent", "interstate", "licensing", "natural", "pipeline", "political", "projects", "regulates", "regulatory", "reviews", "serving".
0.300
activitiesboundariescannotcategoriescontainscreatedcurrentdependsdevelopedeconomicgovernmenthazardoushealthinternationaljointlong-termmanagementmaterialmaterialsplants
SHARED TOKENS (33): "activities", "boundaries", "cannot", "categories", "contains", "created", "current", "depends", "developed", "economic", "government", "hazardous", "health", "international", "joint", "long-term", "management", "material", "materials", "plants"....
0.300
activitiesbehaviordesigndocumenteconomicseconomyengineeringfieldfunctiongrowingimpactsindustrialintegratedmaterialmodernmultiplenaturalnetworkprocessesresearch
SHARED TOKENS (25): "activities", "behavior", "design", "document", "economics", "economy", "engineering", "field", "function", "growing", "impacts", "industrial", "integrated", "material", "modern", "multiple", "natural", "network", "processes", "research"....
0.300
New Urbanism ↗ Q735901 KW CROSS HIGH
affordablearchitectureassociatedbuildingcommunityconcretecontemporarycreatingdesigndevelopmentestatefacilitiesgoalshousingincreaseinfrastructurelandland-usemovementmunicipal
SHARED TOKENS (35): "affordable", "architecture", "associated", "building", "community", "concrete", "contemporary", "creating", "design", "development", "estate", "facilities", "goals", "housing", "increase", "infrastructure", "land", "land-use", "movement", "municipal"....
0.300
accesscommunitycompletedesigneconomicengineersenvironmentalhealthhomeoperatedplannedpolicypractitionerspublicrelatedrequiressafetystreetstraffictransportation
SHARED TOKENS (21): "access", "community", "complete", "design", "economic", "engineers", "environmental", "health", "home", "operated", "planned", "policy", "practitioners", "public", "related", "requires", "safety", "streets", "traffic", "transportation"....
0.300
actcommissiondatadevelopmentfacilitiesfederalgovernmentinformationlawmaterialsprivateprocessesproductionprogramprovisionsregulationregulatorysupporttechnicaluses
SHARED TOKENS (20): "act", "commission", "data", "development", "facilities", "federal", "government", "information", "law", "materials", "private", "processes", "production", "program", "provisions", "regulation", "regulatory", "support", "technical", "uses".
0.300
constraintsconvertscostcurrentdelivereddirectdirectlyelectricallargermodernneighborhoodpowerproviderequiressizesuppliessupply
SHARED TOKENS (17): "constraints", "converts", "cost", "current", "delivered", "direct", "directly", "electrical", "larger", "modern", "neighborhood", "power", "provide", "requires", "size", "supplies", "supply".
0.300
acquireactapprovalapprovalsapprovedbuildingcommercialconstructioncontractorscreatesdesigndeterminedeveloperdevelopersdevelopmentdifferenteconomicengineersenvironmentalestate
SHARED TOKENS (47): "acquire", "act", "approval", "approvals", "approved", "building", "commercial", "construction", "contractors", "creates", "design", "determine", "developer", "developers", "development", "different", "economic", "engineers", "environmental", "estate"....
0.300
authoritybuildingbuildingsbusinesscapitalcombinecommercialestatefunctionsgeneratehousingintendedinvestmentlandlocalmaintainmultipleofficepropertyreal
SHARED TOKENS (29): "authority", "building", "buildings", "business", "capital", "combine", "commercial", "estate", "functions", "generate", "housing", "intended", "investment", "land", "local", "maintain", "multiple", "office", "property", "real"....
🫐 BERRY38 edges
0.280
aloneapplicationscostdemandexpectedmarketmaterialmodeloperatingpowerproductionsafetyspecificvalue
SHARED TOKENS (14): "alone", "applications", "cost", "demand", "expected", "market", "material", "model", "operating", "power", "production", "safety", "specific", "value".
0.280
Parcel ↗ EXACT TITLE
deliverylandmodernparcels
SHARED TOKENS (4): "delivery", "land", "modern", "parcels". | EXACT TITLE in land_use_planning: "Parcel". | EXACT TITLE in nuclear_clean_energy: "Parcel".
0.280
agriculturalamericanhouseholdindustriallegalmerelyownershipremainingrightrightssourcesubsequentsystemwater
SHARED TOKENS (14): "agricultural", "american", "household", "industrial", "legal", "merely", "ownership", "remaining", "right", "rights", "source", "subsequent", "system", "water".
0.280
Septic tank ↗ Q386300 KW CROSS HIGH
concreteconnectedefficiencyfieldgroundwaterprocessesreduceruralsystemsystemsthereforetreatmentunitswastewater
SHARED TOKENS (14): "concrete", "connected", "efficiency", "field", "groundwater", "processes", "reduce", "rural", "system", "systems", "therefore", "treatment", "units", "wastewater".
0.280
civilformalgovernmentlaw
SHARED TOKENS (4): "civil", "formal", "government", "law". | EXACT TITLE in land_use_planning: "Hearing (law)". | EXACT TITLE in nuclear_clean_energy: "Hearing (law)".
0.260
departmentfallsgovernmentidahonationaloperatespersonnelplantspowerprocessingremainingsupportedtraining
SHARED TOKENS (13): "department", "falls", "government", "idaho", "national", "operates", "personnel", "plants", "power", "processing", "remaining", "supported", "training".
0.260
informationmappingprocess
SHARED TOKENS (3): "information", "mapping", "process". | EXACT TITLE in land_use_planning: "Soil survey".
0.260
advantageamongbuildingsefficiencylargeproviderequirementsourcesystemsystemstransferunitswater
SHARED TOKENS (13): "advantage", "among", "buildings", "efficiency", "large", "provide", "requirement", "source", "system", "systems", "transfer", "units", "water".
0.260
Solar inverter ↗ Q129316 KW CROSS HIGH
commercialconvertscurrentdirectelectricalfunctionslocalnetworkpowerprotectionspecialsystemutility
SHARED TOKENS (13): "commercial", "converts", "current", "direct", "electrical", "functions", "local", "network", "power", "protection", "special", "system", "utility".
0.260
associatedcommercialconnecteddesigngeneratorsinsidelinkedmaintainoperatedoriginalpowerpressurewater
SHARED TOKENS (13): "associated", "commercial", "connected", "design", "generators", "inside", "linked", "maintain", "operated", "original", "power", "pressure", "water".
0.260
boisecitiesdowntownfallshomeidahointerstatemajormetropolitanriverrouteroutesserves
SHARED TOKENS (13): "boise", "cities", "downtown", "falls", "home", "idaho", "interstate", "major", "metropolitan", "river", "route", "routes", "serves".
0.240
americanbuiltdecemberdeliveredgeneralinformationinstitutionsmajorpreferredprogramresearchtitle
SHARED TOKENS (12): "american", "built", "december", "delivered", "general", "information", "institutions", "major", "preferred", "program", "research", "title".
0.240
approximatelyboisedatadistrictevengovernmentidaholimitspopulationresidentssinglesubsequent
SHARED TOKENS (12): "approximately", "boise", "data", "district", "even", "government", "idaho", "limits", "population", "residents", "single", "subsequent".
0.240
activitybuiltdevelopedenvironmentalhealthimpactslandnaturalpublicrisktransitionurban
SHARED TOKENS (12): "activity", "built", "developed", "environmental", "health", "impacts", "land", "natural", "public", "risk", "transition", "urban".
0.240
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistricteastgrowingidahometropolitanneighboringpopulationrapidlystar
SHARED TOKENS (12): "ada", "boise", "canyon", "district", "east", "growing", "idaho", "metropolitan", "neighboring", "population", "rapidly", "star".
0.240
departmentdepartmentsdevelopmentdirectlyfederalfinancinggovernmenthomehousingprogramreportsurban
SHARED TOKENS (12): "department", "departments", "development", "directly", "federal", "financing", "government", "home", "housing", "program", "reports", "urban".
0.220
additionalattachedcaseshomeprincipalpropertyprovidereceiveresidentialseparatesupport
SHARED TOKENS (11): "additional", "attached", "cases", "home", "principal", "property", "provide", "receive", "residential", "separate", "support".
0.220
applicationsconventionaldevelopmentoperatesoperatingoperationpowerprocessproductionproposeduses
SHARED TOKENS (11): "applications", "conventional", "development", "operates", "operating", "operation", "power", "process", "production", "proposed", "uses".
0.220
actallowedcomprehensivedistrictestablishedfederaljurisdictionlawnationalpolicyprogram
SHARED TOKENS (11): "act", "allowed", "comprehensive", "district", "established", "federal", "jurisdiction", "law", "national", "policy", "program".
0.220
December 20 ↗ Q2455 EXACT TITLE
decemberremain
SHARED TOKENS (2): "december", "remain". | EXACT TITLE in land_use_planning: "December 20". | EXACT TITLE in nuclear_clean_energy: "December 20".
0.220
applicationsbehaviorcivilconstructionengineeringknowledgematerialsoverlappingrelatedstudyuses
SHARED TOKENS (11): "applications", "behavior", "civil", "construction", "engineering", "knowledge", "materials", "overlapping", "related", "study", "uses".
0.180
builteasternelectricalidahonationalpowersafetysupplywater
SHARED TOKENS (9): "built", "eastern", "electrical", "idaho", "national", "power", "safety", "supply", "water".
0.180
materialmultipleoperatedoperationpowerprojectsresearchsizetechnology
SHARED TOKENS (9): "material", "multiple", "operated", "operation", "power", "projects", "research", "size", "technology".
0.160
basecapacityconstructioncostdemandefficiencyplantspower
SHARED TOKENS (8): "base", "capacity", "construction", "cost", "demand", "efficiency", "plants", "power".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
actionchangeeffectivemakingratherrelationshipssystemsystems
SHARED TOKENS (8): "action", "change", "effective", "making", "rather", "relationships", "system", "systems".
0.160
becomedifferentfuturemajormakespowersourcewater
SHARED TOKENS (8): "become", "different", "future", "major", "makes", "power", "source", "water".
0.160
constructionimproveitselfliensmaterialspropertyrealtitle
SHARED TOKENS (8): "construction", "improve", "itself", "liens", "materials", "property", "real", "title".
0.140
actualcurrentestatemarketpropertyrealvalue
SHARED TOKENS (7): "actual", "current", "estate", "market", "property", "real", "value".
0.140
chainmanufacturingopenoperationpreparationprocessproduction
SHARED TOKENS (7): "chain", "manufacturing", "open", "operation", "preparation", "process", "production".
0.140
actconservationfederalgoverninghazardouslawresource
SHARED TOKENS (7): "act", "conservation", "federal", "governing", "hazardous", "law", "resource".
0.140
americandevelopmentheadquarteredinstituteprivatesciencetechnology
SHARED TOKENS (7): "american", "development", "headquartered", "institute", "private", "science", "technology".
0.140
businessdevelopmentestateindustrialofficeplannedrather
SHARED TOKENS (7): "business", "development", "estate", "industrial", "office", "planned", "rather".
0.120
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboisedowntowneagleidahopopulation
SHARED TOKENS (6): "ada", "boise", "downtown", "eagle", "idaho", "population".
0.100
Brownlee Dam ↗ Q4976595 KW CROSS HIGH
canyonidahoreservoirriverwestern
SHARED TOKENS (5): "canyon", "idaho", "reservoir", "river", "western".
0.100
commissionpowerprogramsafetyspecial
SHARED TOKENS (5): "commission", "power", "program", "safety", "special".
0.100
developmentgeneratehistorypowerproject
SHARED TOKENS (5): "development", "generate", "history", "power", "project".
0.100
cannotconservationhabitatmanagementpractice
SHARED TOKENS (5): "cannot", "conservation", "habitat", "management", "practice".
◈ Frequently Asked Questions
Land Use Planning × Nuclear Clean Energy — Treasure Valley
HAIKU · HIGH GATE
How do Ada County zoning decisions affect where nuclear facilities could be sited in the Treasure Valley?
Ada County land use codes determine which parcels permit industrial energy infrastructure, directly controlling whether nuclear clean energy projects can locate near Boise or Nampa. The National Environmental Policy Act requires county planning documents to assess environmental impacts before issuing permits for such facilities. Building codes established locally must accommodate nuclear containment and safety specifications, making zoning alignment essential before any project advancement.
What role does the Boise River's water availability play in land use planning for nuclear energy development?
The Clean Water Act and water right allocations administered by the Bureau of Reclamation determine whether the Boise River can supply cooling water for nuclear facilities in the Treasure Valley. Local irrigation demands and senior water rights holders must be considered in land use plans that reserve water for energy production. Boise State University and University of Idaho research on regional water balance informs whether nuclear development is hydrologically feasible under current allocation frameworks.
How do federal environmental reviews under NEPA shape Treasure Valley land use plans for nuclear projects?
The National Environmental Policy Act mandates that the United States Environmental Protection Agency and Bureau of Reclamation review environmental impacts before Ada County or Nampa can approve nuclear facility siting through local comprehensive plans. These federal reviews examine effects on the Boise River, regional water rights, and public lands, potentially restricting development in specific zones. Building code compliance and zoning amendments in the metropolitan Boise area must align with EPA findings before implementation.
What coordination between Boise State University research and Ada County planning supports nuclear energy land use decisions?
Boise State University conducts research on nuclear safety, water systems, and environmental law that informs Ada County comprehensive plans and zoning decisions for energy infrastructure in the Treasure Valley. University of Idaho similarly provides technical data on irrigation systems and the Boise River that shape whether land can accommodate nuclear facilities without violating water right agreements. County planners use these research outputs to evaluate building code amendments and permit conditions specific to nuclear development near Boise and Nampa.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Land Use Planning × Nuclear Clean Energy 20 QID bridges 252 edges 6,572 ext links 2026-07-17 21:42:46 UTC 89ff3c00fe76d728
Land Use Planning corridor ↗ Nuclear Clean Energy corridor ↗ Nuclear Clean Energy × Land Use Planning ↗ boisestandard.org/standard ↗
Parent Corridors
Land Use Planning × All Other Verticals