—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Insurance Coverage ↔ relates to ↔ Education

11 Wikipedia bridge articles confirmed in both vertical ledgers. 249 deterministic cross-vertical edges. 6,601 external source links harvested. Every edge provenance-stamped. Every claim auditable.

11 QID Bridge Articles
249 Cross Edges
6,601 External Sources
285 Wikipedia Articles
13 🌲 Evergreen
139 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Insurance Coverage
× Education
QID Bridge Articles
11
confirmed Wikipedia overlap
Total Cross Edges
249
External Sources Harvested
6,601
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
College of Western Idaho
score: 1.1500  ·  type: exact_title_cross  ·  26 shared tokens
QID Bridge Titles (11)
College of Western IdahoContinuing educationBoise State UniversityTreasure ValleyBoise, IdahoNampa, IdahoAda County, IdahoCanyon County, IdahoMeridian, IdahoCaldwell, IdahoEagle, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationadacollegecanyoneducationnampaprogramstreasurevalleywesternuniversitywestcapitalhomenorthwestacademiccreditdevelopment
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:28:11 UTC
Content Hash
6acfc4c0a587be83
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
11 BRIDGES
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in insurance_coverage (tier:evergreen) and education (tier:evergreen). | SHARED TOKENS (26): "academic", "ada", "board", "boise", "campus", "canyon", "college", "credit", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "residents".... | URL->A (1): https://cwi.edu/. | URL->B (1): https://cwi.edu/. | EXACT TITLE in insurance_coverage: "College of Western Idaho". | EXACT TITLE in education: "College of Western Idaho".
academicadaboardboisecampuscanyoncollegecreditcwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicresidentsstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in insurance_coverage (tier:evergreen) and education (tier:evergreen). | SHARED TOKENS (23): "academic", "agencies", "college", "continuing", "credit", "curriculum", "development", "economic", "education", "either", "general", "government", "least", "online", "personal", "professional", "programs", "students", "support", "training".... | EXACT TITLE in insurance_coverage: "Continuing education". | EXACT TITLE in education: "Continuing education".
academicagenciescollegecontinuingcreditcurriculumdevelopmenteconomiceducationeithergeneralgovernmentleastonlinepersonalprofessionalprogramsstudentssupporttrainingtypeuniversityworkforce
t programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
History In the United Kingdom, Oxford University's Department for Continuing Education was founded in 1878, and the Institute of Continuing Education of Cambridge University dates back to 1873. In the United States, the Chautauqua Institution, originally the Chautauqua Lake Sunday School Assembly, was founded in 1874 "as an educational experiment in out-of-school, vacation learning. It was successful and broadened almost immediately beyond courses for Sunday school teachers to include academic subjects, music, art and physical education." Harvard University traces its origins in continuing education to 1835 when John Lowell Jr. established the Lowell Institute with a mission to provide free public lectures in Boston. In 1909, then-Harvard President A. Lawrence Lowell, who was also a trustee of the Lowell Institute, expanded plans to offer Lowell Institute public courses directly with Harvard. In 1910, Lowell formally established the Havard Extension School, then referred to as the Commission on Extension Courses. The Harvard Extension School now operates under the Faculty of Arts and Sciences and is one of the 13 degree-granting schools that make up Harvard University. The School has remained in continuous operation since 1910. Cornell University was among higher education institutions that began offering university-based continuing education, primarily to teachers, through extension courses in the 1870s. As noted in the Cornell Era of February 16, 1877, the university offered a "Tour of the Great Lakes" program for "teachers and others" under the direction of Professor Theodore B. Comstock, head of Cornell's department of geology. The University of Wisconsin–Madison began its continuing education program in 1907. The New School for Social Research, founded in 1919, was initially devoted to adult education. In 1969, Empire State College, a unit of the State University of New York, was the first institution in the US to exclusively focus on providing higher education to adult learners. In 1976 the University of Florida created its own Division of Continuing Education and most courses were offered on evenings or weekends to accommodate the schedules of working students. The method of delivery of continuing education can include traditional types of classroom lectures and laboratories.
ainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in insurance_coverage (tier:evergreen) and education (tier:evergreen). | SHARED TOKENS (19): "activity", "boise", "business", "classified", "college", "education", "engineering", "founded", "health", "idaho", "independent", "member", "million", "program", "programs", "public", "research", "university", "west". | EXACT TITLE in insurance_coverage: "Boise State University". | EXACT TITLE in education: "Boise State University".
activityboisebusinessclassifiedcollegeeducationengineeringfoundedhealthidahoindependentmembermillionprogramprogramspublicresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
CAA Division I as a member of the Mountain West Conference. History The school became Idaho's third state university in 1974, after the University of Idaho (1889) and Idaho State University (1963). Boise State awards associate, bachelor's, master's, and doctoral degrees, and is accredited by the Northwest Commission on Colleges and Universities. As of 2010, it has over 75,000 living alumni. Campus The 285-acre (1.15 km2) campus is located near downtown Boise, on the south bank of the Boise River, opposite Julia Davis Park. With more than 170 buildings, the campus is at an elevation of 2,700 feet (825 m) above sea level, bounded by Capitol Boulevard on the west and Broadway Avenue to the east.
Treasure Valley
Q7836726 EXACT TITLE 0.920
QID OVERLAP: Q7836726 in insurance_coverage (tier:evergreen) and education (tier:evergreen). | SHARED TOKENS (11): "boise", "commerce", "idaho", "land", "local", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in insurance_coverage: "Treasure Valley". | EXACT TITLE in education: "Treasure Valley".
boisecommerceidaholandlocalregionresourcesrivertreasurevalleywestern
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
icultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "major", "manufacturing", "north", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalemployershomeidahomajormanufacturingnorthpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Nampa, Idaho
Q622633 QID OVERLAP 0.740
QID OVERLAP: Q622633 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (12): "boise", "canyon", "college", "home", "idaho", "meridian", "nampa", "northwest", "population", "university", "west", "western".
boisecanyoncollegehomeidahomeridiannampanorthwestpopulationuniversitywestwestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Ada County, Idaho
Q109820 QID OVERLAP 0.680
QID OVERLAP: Q109820 in insurance_coverage (tier:branch) and education (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "capital", "home", "idaho", "local", "northwest", "population", "private".
adaboisecapitalhomeidaholocalnorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "making", "nampa", "population".
boisecaldwellcanyonidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.640
QID OVERLAP: Q1085274 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (7): "ada", "boise", "capital", "idaho", "making", "meridian", "population".
adaboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.640
QID OVERLAP: Q849592 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "college", "idaho", "population", "west".
boisecaldwellcanyoncollegeidahopopulationwest
the county seat of Canyon County, Idaho, United States. Caldwell is the 5th most populous city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in insurance_coverage (tier:branch) and education (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "northwest", "population".
adaboiseeagleidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
238 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP238 edges
🌲 EVERGREEN2 edges
0.650
actadministeredadministrationaprilassistancebuildingsconstructioncostcreditdecemberdevelopmentfederalgovernmentlandmakingmanagementmillionnationaloctoberpolicy
SHARED TOKENS (24): "act", "administered", "administration", "april", "assistance", "buildings", "construction", "cost", "credit", "december", "development", "federal", "government", "land", "making", "management", "million", "national", "october", "policy".... | URL->A (1): http://www.floodsmart.gov/. | EXACT TITLE in insurance_coverage: "National Flood Insurance Program".
0.610
educationfoundedmodelnorthwestofferingsonlineprivateprofessionalsschoolsuniversityuseswesternworking
SHARED TOKENS (13): "education", "founded", "model", "northwest", "offerings", "online", "private", "professionals", "schools", "university", "uses", "western", "working". | URL->B (1): http://www.wgu.edu/. | EXACT TITLE in education: "Western Governors University".
🌿 BRANCH139 edges
0.570
campuscollegefoundedidahointernationalmedicalmeridianownedprivatestudentsuniversity
SHARED TOKENS (11): "campus", "college", "founded", "idaho", "international", "medical", "meridian", "owned", "private", "students", "university". | URL->B (1): http://www.icom.edu/. | EXACT TITLE in education: "Idaho College of Osteopathic Medicine".
0.530
boisecampusfamilyidahonetworkoperatespublicresearchuniversity
SHARED TOKENS (9): "boise", "campus", "family", "idaho", "network", "operates", "public", "research", "university". | URL->B (1): https://www.boisestatepublicradio.org/. | EXACT TITLE in education: "Boise State Public Radio".
0.530
commercedecisionsdepartmentestablishedidaholaborlegislatureresponsiblesystem
SHARED TOKENS (9): "commerce", "decisions", "department", "established", "idaho", "labor", "legislature", "responsible", "system". | URL->A (1): https://iic.idaho.gov/. | EXACT TITLE in insurance_coverage: "Idaho Industrial Commission".
0.500
buildingbusinessescapitalcommercedemanddepartmentdesignhigherhumaninformationinfrastructuremanagementmarketingnetoperationspartnersplanplanningresearchsystem
SHARED TOKENS (21): "building", "businesses", "capital", "commerce", "demand", "department", "design", "higher", "human", "information", "infrastructure", "management", "marketing", "net", "operations", "partners", "plan", "planning", "research", "system".... | EXACT TITLE in education: "Supply chain management".
0.500
boisecampuscampusesclassifiedestablishedidahomainofficesoperatesprofessionalpublicresearchschoolsstatewidestudentsuniversity
SHARED TOKENS (16): "boise", "campus", "campuses", "classified", "established", "idaho", "main", "offices", "operates", "professional", "public", "research", "schools", "statewide", "students", "university". | EXACT TITLE in education: "University of Idaho".
0.500
academicadministrationcaldwellcollegecreditcurriculumeducationeitherenrollmentfoundedidahomajormedicalprivateprofessionalprogramsselectstandardstudents
SHARED TOKENS (19): "academic", "administration", "caldwell", "college", "credit", "curriculum", "education", "either", "enrollment", "founded", "idaho", "major", "medical", "private", "professional", "programs", "select", "standard", "students". | EXACT TITLE in education: "College of Idaho".
0.500
americacollegefreegovernedgovernsmajormembersnationalnorthprofessionalschoolsselectedsinglesouthsupport
SHARED TOKENS (15): "america", "college", "free", "governed", "governs", "major", "members", "national", "north", "professional", "schools", "selected", "single", "south", "support". | EXACT TITLE in education: "College football".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturebestboisecapitaleconomyidahojulylandmanufacturingmillionnationalnorthnorthwestpopulationpriorriversouthtechnologyuseswest
SHARED TOKENS (22): "agriculture", "best", "boise", "capital", "economy", "idaho", "july", "land", "manufacturing", "million", "national", "north", "northwest", "population", "prior", "river", "south", "technology", "uses", "west".... | EXACT TITLE in insurance_coverage: "Idaho". | EXACT TITLE in education: "Idaho".
0.500
boisecampusfoundedhistoryhomehostedidaholocalnamingpriorpurchasedschoolsuniversitywestwestern
SHARED TOKENS (15): "boise", "campus", "founded", "history", "home", "hosted", "idaho", "local", "naming", "prior", "purchased", "schools", "university", "west", "western". | EXACT TITLE in education: "Albertsons Stadium".
0.500
accreditationamericabetterbureaubusinessbusinessescodefoundedindustryinternationaljulylocalmarketingmissionnorthoperatingorganizationpolicyprivatespecific
SHARED TOKENS (22): "accreditation", "america", "better", "bureau", "business", "businesses", "code", "founded", "industry", "international", "july", "local", "marketing", "mission", "north", "operating", "organization", "policy", "private", "specific".... | EXACT TITLE in insurance_coverage: "Better Business Bureau".
0.500
academicadministrationanalysisapplicationbroaderbusinesseseconomicexperiencefoundedgovernmentinstitutionsmanagementorganizationpolicyprivateprogramsproposedpublicrelationshipsrelevant
SHARED TOKENS (22): "academic", "administration", "analysis", "application", "broader", "businesses", "economic", "experience", "founded", "government", "institutions", "management", "organization", "policy", "private", "programs", "proposed", "public", "relationships", "relevant".... | EXACT TITLE in education: "Public administration".
0.500
administrationboardcouncildatadepartmentemployerexperienceheadquarteredinformationlabornationaloperatesorganizationratesupports
SHARED TOKENS (15): "administration", "board", "council", "data", "department", "employer", "experience", "headquartered", "information", "labor", "national", "operates", "organization", "rate", "supports". | EXACT TITLE in insurance_coverage: "National Council on Compensation Insurance".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addclassifiedcreatesdirecteconomicequipmentfiregrowthhealthhumanlandmanagementphysicaltypewater
SHARED TOKENS (15): "add", "classified", "creates", "direct", "economic", "equipment", "fire", "growth", "health", "human", "land", "management", "physical", "type", "water". | EXACT TITLE in insurance_coverage: "Wildfire".
0.500
academiccapacitycoreeducationexternalfactshigherinquirylegalmattersmembersmissionmodelprofessionalresearchuniversity
SHARED TOKENS (16): "academic", "capacity", "core", "education", "external", "facts", "higher", "inquiry", "legal", "matters", "members", "mission", "model", "professional", "research", "university". | EXACT TITLE in education: "Academic freedom".
0.500
applyclassifiedcorporatecreditdatadecisionsdesigndevelopmentengineeringfinancialhealthinstitutionsinternationallegalmanagementnationalorganizationprofessionalprogrampublic
SHARED TOKENS (25): "apply", "classified", "corporate", "credit", "data", "decisions", "design", "development", "engineering", "financial", "health", "institutions", "international", "legal", "management", "national", "organization", "professional", "program", "public".... | EXACT TITLE in insurance_coverage: "Risk management".
0.500
academicadministrationbusinesscoursedevelopmentgovernmentgraduatesmanagementpolicyprivateprofessionalprogrampublicrequiresstudentstraininguniversitywork
SHARED TOKENS (18): "academic", "administration", "business", "course", "development", "government", "graduates", "management", "policy", "private", "professional", "program", "public", "requires", "students", "training", "university", "work". | EXACT TITLE in education: "Master of Public Administration".
0.500
administeredamericabenefitbusinesscarecoveragecoveringemployergovernmenthealthindividualsmedicalmembernationalorganizationpolicyprivateproviderpublicresult
SHARED TOKENS (24): "administered", "america", "benefit", "business", "care", "coverage", "covering", "employer", "government", "health", "individuals", "medical", "member", "national", "organization", "policy", "private", "provider", "public", "result".... | EXACT TITLE in insurance_coverage: "Health insurance".
0.500
additionalapplybusinesscapacityclosecoverageeithergeneraloperationsorganizationoriginalpersonalpolicypurchasedsectionstandardstatustype
SHARED TOKENS (18): "additional", "apply", "business", "capacity", "close", "coverage", "either", "general", "operations", "organization", "original", "personal", "policy", "purchased", "section", "standard", "status", "type". | EXACT TITLE in insurance_coverage: "Additional insured".
0.500
annualapprovedboardboisebusinesscampuscapitalcentercollegeeducationeitheremploymentenrollmentenvironmentalestablishedgraduatesidahoinstructionlawlegislature
SHARED TOKENS (33): "annual", "approved", "board", "boise", "business", "campus", "capital", "center", "college", "education", "either", "employment", "enrollment", "environmental", "established", "graduates", "idaho", "instruction", "law", "legislature".... | EXACT TITLE in education: "University of Idaho College of Law".
0.500
NPR ↗ EXACT TITLE
annualcorporatefeesgovernmentheadquarteredindependentmarchmediamembermillionnationalnetworknewsonlineoperatesorganizationownedpaidprimaryprograms
SHARED TOKENS (24): "annual", "corporate", "fees", "government", "headquartered", "independent", "march", "media", "member", "million", "national", "network", "news", "online", "operates", "organization", "owned", "paid", "primary", "programs".... | EXACT TITLE in education: "NPR".
0.500
Yelp ↗ Q2299611 EXACT TITLE
annualbusinessbusinessescomdecemberdirectoryexternalfoundedheadquarteredinformationmarchmilliononlineoperatespublicreviewsitesystem
SHARED TOKENS (18): "annual", "business", "businesses", "com", "december", "directory", "external", "founded", "headquartered", "information", "march", "million", "online", "operates", "public", "review", "site", "system". | EXACT TITLE in insurance_coverage: "Yelp".
0.500
actamericacreditsdevelopmentecosystemequipmentfederalhumanindustryinvestmentlawlegislationlimitedmanufacturingmarchpublicresearchtechnologytitletraining
SHARED TOKENS (21): "act", "america", "credits", "development", "ecosystem", "equipment", "federal", "human", "industry", "investment", "law", "legislation", "limited", "manufacturing", "march", "public", "research", "technology", "title", "training".... | EXACT TITLE in education: "CHIPS and Science Act".
0.500
applicationcomplexcurrentdepartmentdirectorengineeringenvironmentalfacilitieshistoryidahoknowledgenationalresearchsitesouthwestwestern
SHARED TOKENS (17): "application", "complex", "current", "department", "director", "engineering", "environmental", "facilities", "history", "idaho", "knowledge", "national", "research", "site", "south", "west", "western". | EXACT TITLE in education: "Idaho National Laboratory".
0.500
accessalreadybestbusinessescapacitydevelopmenteconomiceducationemployersfoundedgovernmenthistoryhomeindustryleastneednetworkprogramspublicrecent
SHARED TOKENS (28): "access", "already", "best", "businesses", "capacity", "development", "economic", "education", "employers", "founded", "government", "history", "home", "industry", "least", "need", "network", "programs", "public", "recent".... | EXACT TITLE in education: "Workforce development".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
affordablebenefitcareclassifieddirecteitherhealthinformationlinksofficepharmacyprimarypriorprofessionalprofessionalswork
SHARED TOKENS (16): "affordable", "benefit", "care", "classified", "direct", "either", "health", "information", "links", "office", "pharmacy", "primary", "prior", "professional", "professionals", "work". | EXACT TITLE in insurance_coverage: "Pharmacy". | EXACT TITLE in education: "Pharmacy".
0.500
Accounting ↗ Q4116214 EXACT TITLE
accountinganalysisboardbusinessbusinessescostcouncileconomicexternalfinancialhistoryhumaninformationinternationalmajormanagementoperationsorganizationprocessprofessional
SHARED TOKENS (22): "accounting", "analysis", "board", "business", "businesses", "cost", "council", "economic", "external", "financial", "history", "human", "information", "international", "major", "management", "operations", "organization", "process", "professional".... | EXACT TITLE in insurance_coverage: "Accounting". | EXACT TITLE in education: "Accounting".
0.500
academicagriculturebuildingsbusinessconstructioneducationeducationalequipmentfederalgovernmentlawmanufacturingmedicalprogramssoftwarespecificstudentstechnicaltechnologyworkforce
SHARED TOKENS (20): "academic", "agriculture", "buildings", "business", "construction", "education", "educational", "equipment", "federal", "government", "law", "manufacturing", "medical", "programs", "software", "specific", "students", "technical", "technology", "workforce". | EXACT TITLE in education: "Career and technical education".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactaffordableannualaveragecarecostcoverageeconomiceligibilityestablishedfederalfinancialgeneralgovernmenthealthhealthcarehomelimitedline
SHARED TOKENS (37): "access", "act", "affordable", "annual", "average", "care", "cost", "coverage", "economic", "eligibility", "established", "federal", "financial", "general", "government", "health", "healthcare", "home", "limited", "line".... | EXACT TITLE in insurance_coverage: "Medicaid".
0.500
actcoveragedirectlyenrollmenthealthlabormedicalmembersoptionsoriginalplanpriorprivatespecifictype
SHARED TOKENS (15): "act", "coverage", "directly", "enrollment", "health", "labor", "medical", "members", "options", "original", "plan", "prior", "private", "specific", "type". | EXACT TITLE in insurance_coverage: "Medicare Advantage".
0.500
actadditionalaffordablecarecommercecoverageeducationeligibilityemployerfederalhealthhealthcareheldincreasesindividualslawlegalmajormarchmillion
SHARED TOKENS (32): "act", "additional", "affordable", "care", "commerce", "coverage", "education", "eligibility", "employer", "federal", "health", "healthcare", "held", "increases", "individuals", "law", "legal", "major", "march", "million".... | EXACT TITLE in insurance_coverage: "Affordable Care Act".
0.500
Social work ↗ EXACT TITLE
academicadministrationagenciescounselingdevelopmentdirectlyeducationfamilygovernmentgrouphealthhumanindividualslaborlawmanagementpolicyprivatepublicresearch
SHARED TOKENS (23): "academic", "administration", "agencies", "counseling", "development", "directly", "education", "family", "government", "group", "health", "human", "individuals", "labor", "law", "management", "policy", "private", "public", "research".... | EXACT TITLE in education: "Social work".
0.500
Title insurance ↗ EXACT TITLE
businesscoverageestatefinancialfiregeneralindependentlandlawlegalpolicypurchasedraterealreceiverequirementsouthsystemtitle
SHARED TOKENS (19): "business", "coverage", "estate", "financial", "fire", "general", "independent", "land", "law", "legal", "policy", "purchased", "rate", "real", "receive", "requirement", "south", "system", "title". | EXACT TITLE in insurance_coverage: "Title insurance".
0.500
broaderbuildingscapitalconstructiondirectlyeconomiceitheremploymentenvironmentalfacilitiesgovernmenthealthinfrastructurephysicalprivatepublicschoolsuseswater
SHARED TOKENS (19): "broader", "buildings", "capital", "construction", "directly", "economic", "either", "employment", "environmental", "facilities", "government", "health", "infrastructure", "physical", "private", "public", "schools", "uses", "water". | EXACT TITLE in insurance_coverage: "Public works".
0.500
Scholarship ↗ Q188823 EXACT TITLE
academicaccessactivityaveragecoveringdevelopmenteconomiceducationeducationalenrollmentexperiencefinancialhousinginternationalminimummodelsnationalneedperiodpolicy
SHARED TOKENS (30): "academic", "access", "activity", "average", "covering", "development", "economic", "education", "educational", "enrollment", "experience", "financial", "housing", "international", "minimum", "models", "national", "need", "period", "policy".... | EXACT TITLE in education: "Scholarship".
0.500
Snake River ↗ Q272074 EXACT TITLE
agenciescanyonconstructionhistoryhostedhumanidahoirrigationlimitedmajornationalnorthnorthwestpolicyprivateprogramsproposedpublicrecentregion
SHARED TOKENS (27): "agencies", "canyon", "construction", "history", "hosted", "human", "idaho", "irrigation", "limited", "major", "national", "north", "northwest", "policy", "private", "programs", "proposed", "public", "recent", "region".... | EXACT TITLE in education: "Snake River".
0.500
Pell Grant ↗ Q2068057 EXACT TITLE
academicactadministeredapplicationcollegedepartmenteducationeducationaleligibilityfamilyfederalfederallyfinancialfoundationfreegovernmenthigherinformationinstitutionslimited
SHARED TOKENS (30): "academic", "act", "administered", "application", "college", "department", "education", "educational", "eligibility", "family", "federal", "federally", "financial", "foundation", "free", "government", "higher", "information", "institutions", "limited".... | EXACT TITLE in education: "Pell Grant".
0.500
applicationcapacitycriticalcurrentdevelopmentfreegroupincreasesphysicalpracticalprocessresponsiblesinglestructurework
SHARED TOKENS (15): "application", "capacity", "critical", "current", "development", "free", "group", "increases", "physical", "practical", "process", "responsible", "single", "structure", "work". | EXACT TITLE in education: "Semiconductor".
0.500
applicationcarecurrentdesigndevelopmentengineeringequipmentgrowthhealthhealthcareindustrymakingmanagementmedicalrelevantresearchrolework
SHARED TOKENS (18): "application", "care", "current", "design", "development", "engineering", "equipment", "growth", "health", "healthcare", "industry", "making", "management", "medical", "relevant", "research", "role", "work". | EXACT TITLE in education: "Biomedical engineering".
0.500
Contract ↗ Q93288 EXACT TITLE
applybusinesscivilcodeeithergeneralgovernedindependentindividualsinternationallawlegalmajornationalpriorprivatespecific
SHARED TOKENS (17): "apply", "business", "civil", "code", "either", "general", "governed", "independent", "individuals", "international", "law", "legal", "major", "national", "prior", "private", "specific". | EXACT TITLE in insurance_coverage: "Contract".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
benefitbuildingbusinessbusinessescapitalcivilcreditdemanddirectlyeitherestatefailsfinancialhomeindividualsinvestmentlawlegalprocessrate
SHARED TOKENS (22): "benefit", "building", "business", "businesses", "capital", "civil", "credit", "demand", "directly", "either", "estate", "fails", "financial", "home", "individuals", "investment", "law", "legal", "process", "rate".... | EXACT TITLE in insurance_coverage: "Mortgage".
0.500
Finance ↗ Q43015 EXACT TITLE
academicaccountingadministrationallowinganalysisbusinessbusinessescorporateengineeringestablishedfinancialfoundationhistoryinvestmentlawmanagementoptionsorganizationpersonalplanning
SHARED TOKENS (25): "academic", "accounting", "administration", "allowing", "analysis", "business", "businesses", "corporate", "engineering", "established", "financial", "foundation", "history", "investment", "law", "management", "options", "organization", "personal", "planning".... | EXACT TITLE in insurance_coverage: "Finance".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesallowingalreadybenefitbestbusinessescollegecurrenteitheremployersemploymentexperiencegovernmentgraduatesindustryinvestmentlimitedmedicalnetworkorganization
SHARED TOKENS (35): "agencies", "allowing", "already", "benefit", "best", "businesses", "college", "current", "either", "employers", "employment", "experience", "government", "graduates", "industry", "investment", "limited", "medical", "network", "organization".... | EXACT TITLE in education: "Internship".
0.500
academiccertificatecollegeeducationeducationalenrollmenthigherinstitutionspolicyprogramsseniorstudentstypeuniversityworkforce
SHARED TOKENS (15): "academic", "certificate", "college", "education", "educational", "enrollment", "higher", "institutions", "policy", "programs", "senior", "students", "type", "university", "workforce". | EXACT TITLE in education: "Community college".
0.500
appliedcomplexconstructiondatadesignengineeringenvironmentalequipmentgeneralhumaninformationlanguagemanagementmodelsoperatingplanningprocesssoftwarethem
SHARED TOKENS (19): "applied", "complex", "construction", "data", "design", "engineering", "environmental", "equipment", "general", "human", "information", "language", "management", "models", "operating", "planning", "process", "software", "them". | EXACT TITLE in education: "Computer science".
0.500
accessaddagentsamericaaveragebestbusinessbusinessescareclientsdirectdirectlyestatefinancialfirehealthindependentindividualslawmajor
SHARED TOKENS (41): "access", "add", "agents", "america", "average", "best", "business", "businesses", "care", "clients", "direct", "directly", "estate", "financial", "fire", "health", "independent", "individuals", "law", "major".... | EXACT TITLE in insurance_coverage: "Independent insurance agent".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agricultureapplicationdirectlyenvironmentalgrowthirrigationlandlandscapelessmanagementnetworkoperationsqualityrequiringresultriverrolesupportsystemuses
SHARED TOKENS (22): "agriculture", "application", "directly", "environmental", "growth", "irrigation", "land", "landscape", "less", "management", "network", "operations", "quality", "requiring", "result", "river", "role", "support", "system", "uses".... | EXACT TITLE in insurance_coverage: "Irrigation". | EXACT TITLE in education: "Irrigation".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcaredemandeducationhealthhealthcarehumanmembersnursingperiodpermittedplanpresenceprofessionalspublicqualitysupportworking
SHARED TOKENS (18): "act", "care", "demand", "education", "health", "healthcare", "human", "members", "nursing", "period", "permitted", "plan", "presence", "professionals", "public", "quality", "support", "working". | EXACT TITLE in insurance_coverage: "Nursing". | EXACT TITLE in education: "Nursing".
0.500
academiccollegecurriculumeducationgeneralhigherindependentknowledgelawleastmajormodelnewsprofessionalprogramsschoolsstudentsthemuniversity
SHARED TOKENS (19): "academic", "college", "curriculum", "education", "general", "higher", "independent", "knowledge", "law", "least", "major", "model", "news", "professional", "programs", "schools", "students", "them", "university". | EXACT TITLE in education: "Liberal arts college".
0.500
appliedapplycarecostcoveragecoveringfiregeneralhealthhigherhomehousinglessmultiplepaidplanpolicyprogramsproviderrequirement
SHARED TOKENS (22): "applied", "apply", "care", "cost", "coverage", "covering", "fire", "general", "health", "higher", "home", "housing", "less", "multiple", "paid", "plan", "policy", "programs", "provider", "requirement".... | EXACT TITLE in insurance_coverage: "Deductible".
0.500
actagenciesagentsallowingappointedbusinessfederalgeneralidahoindependentindustrylimitedplacementpolicyregulatoryresponsiblesystem
SHARED TOKENS (17): "act", "agencies", "agents", "allowing", "appointed", "business", "federal", "general", "idaho", "independent", "industry", "limited", "placement", "policy", "regulatory", "responsible", "system". | EXACT TITLE in insurance_coverage: "Managing general agent".
0.500
Economics ↗ Q8134 EXACT TITLE
agentsanalysisappliedbusinesscapitalcareeconomiceconomyeducationengineeringfamilygovernmentgrowthhealthinstitutionsinvestmentlandlawpublicthem
SHARED TOKENS (21): "agents", "analysis", "applied", "business", "capital", "care", "economic", "economy", "education", "engineering", "family", "government", "growth", "health", "institutions", "investment", "land", "law", "public", "them".... | EXACT TITLE in education: "Economics".
0.500
additionalcollegefacilitiesfinancialinstitutionsmajormembermembersminimummovenationalprogramrankingrequirementsschoolssupportuniversity
SHARED TOKENS (17): "additional", "college", "facilities", "financial", "institutions", "major", "member", "members", "minimum", "move", "national", "program", "ranking", "requirements", "schools", "support", "university". | EXACT TITLE in education: "NCAA Division I".
0.480
caredirecteducationalhealthhealthcareleastmedicalmodelproviderrequiringsupporttrainingtypework
SHARED TOKENS (14): "care", "direct", "educational", "health", "healthcare", "least", "medical", "model", "provider", "requiring", "support", "training", "type", "work". | EXACT TITLE in education: "Physician assistant".
0.480
academiccriticaldesignengineeringhistoryinstitutionsknowledgemajorrelationshipsresearchschoolsspecificstructuretechnical
SHARED TOKENS (14): "academic", "critical", "design", "engineering", "history", "institutions", "knowledge", "major", "relationships", "research", "schools", "specific", "structure", "technical". | EXACT TITLE in education: "Materials science".
0.480
agenciesbuildingscivilconstructiondepartmentsdesignengineeringgovernmentinfrastructurenationalphysicalprivateprofessionalpublic
SHARED TOKENS (14): "agencies", "buildings", "civil", "construction", "departments", "design", "engineering", "government", "infrastructure", "national", "physical", "private", "professional", "public". | EXACT TITLE in education: "Civil engineering".
0.460
annualdesigndevelopmentgrowthindustrylawmakingmultiplereachrecordresearchsingletechnology
SHARED TOKENS (13): "annual", "design", "development", "growth", "industry", "law", "making", "multiple", "reach", "record", "research", "single", "technology". | EXACT TITLE in education: "Semiconductor industry".
0.460
Ericsson ↗ Q52618 EXACT TITLE
developmentequipmentfamilyfoundedheadquarteredindustryinformationinfrastructureinvestmentmajoroperatessoftwaretechnology
SHARED TOKENS (13): "development", "equipment", "family", "founded", "headquartered", "industry", "information", "infrastructure", "investment", "major", "operates", "software", "technology". | EXACT TITLE in education: "Ericsson".
0.460
administeredagricultureassistancecurrentdepartmentdirectlyfederalgovernmentmembernationalprogramprogramsresources
SHARED TOKENS (13): "administered", "agriculture", "assistance", "current", "department", "directly", "federal", "government", "member", "national", "program", "programs", "resources". | EXACT TITLE in insurance_coverage: "United States Department of Agriculture".
0.450
idahonampanorthwestprivateuniversity
SHARED TOKENS (5): "idaho", "nampa", "northwest", "private", "university". | URL->B (1): https://nnu.edu/. | EXACT TITLE in education: "Northwest Nazarene University".
0.440
directeducationexperienceknowledgemedicalpharmacyphysicalreceivedrequirementseniorspecifictraining
SHARED TOKENS (12): "direct", "education", "experience", "knowledge", "medical", "pharmacy", "physical", "received", "requirement", "senior", "specific", "training". | EXACT TITLE in education: "Residency (medicine)".
0.440
boisedataeithergovernmentidaholegislaturemembersnorthpopulationresidentssinglesouth
SHARED TOKENS (12): "boise", "data", "either", "government", "idaho", "legislature", "members", "north", "population", "residents", "single", "south". | EXACT TITLE in education: "Idaho Legislature".
0.440
analysisanalyticsbestbusinessdatadecisionsguidehumanmakingmanagementonlineplanning
SHARED TOKENS (12): "analysis", "analytics", "best", "business", "data", "decisions", "guide", "human", "making", "management", "online", "planning". | EXACT TITLE in insurance_coverage: "Business analytics".
0.440
boisecampuscenterfacilitiesfoundedfundheadquarteredidahomissionofficeorganizationresearch
SHARED TOKENS (12): "boise", "campus", "center", "facilities", "founded", "fund", "headquartered", "idaho", "mission", "office", "organization", "research". | EXACT TITLE in education: "The Peregrine Fund".
0.440
academicapplicationapplyaveragecollegefamilyindividualsinformationprocessscoresspecificuniversity
SHARED TOKENS (12): "academic", "application", "apply", "average", "college", "family", "individuals", "information", "process", "scores", "specific", "university". | EXACT TITLE in education: "College application".
0.440
collegeeducationgovernmentlandscapenationaloperatedownedprivatepublicregionspecificuniversity
SHARED TOKENS (12): "college", "education", "government", "landscape", "national", "operated", "owned", "private", "public", "region", "specific", "university". | EXACT TITLE in education: "Public university".
0.440
FAFSA ↗ Q5424324 EXACT TITLE
applicationboardcollegecurrenteligibilityfederalfinancialfreeorganizationprivateprofilestudents
SHARED TOKENS (12): "application", "board", "college", "current", "eligibility", "federal", "financial", "free", "organization", "private", "profile", "students". | EXACT TITLE in education: "FAFSA".
0.420
completeemployerlaborperiodplacementprofessionalprofessionsreachsystemtrainingworking
SHARED TOKENS (11): "complete", "employer", "labor", "period", "placement", "professional", "professions", "reach", "system", "training", "working". | EXACT TITLE in education: "Apprenticeship".
0.420
boisebranddatademandfoundedidahomajorownedreachsouthtechnology
SHARED TOKENS (11): "boise", "brand", "data", "demand", "founded", "idaho", "major", "owned", "reach", "south", "technology". | EXACT TITLE in education: "Micron Technology".
0.400
costcoveragefundgeneralgrouplegalmemberpolicyspecificsystem
SHARED TOKENS (10): "cost", "coverage", "fund", "general", "group", "legal", "member", "policy", "specific", "system". | EXACT TITLE in insurance_coverage: "Liability insurance".
0.400
academicanalysisgovernancehistoryhumanlawresearchrolestatusuniversity
SHARED TOKENS (10): "academic", "analysis", "governance", "history", "human", "law", "research", "role", "status", "university". | EXACT TITLE in education: "Political science".
0.400
accountingadditionalanalyticsboisefinancialheadquarteredidahoinvestmentofficestechnology
SHARED TOKENS (10): "accounting", "additional", "analytics", "boise", "financial", "headquartered", "idaho", "investment", "offices", "technology". | EXACT TITLE in education: "Clearwater Analytics".
0.400
Law school ↗ Q1321960 EXACT TITLE
centercollegedepartmenteducationlawlegalprocessprofessionalsystemuniversity
SHARED TOKENS (10): "center", "college", "department", "education", "law", "legal", "process", "professional", "system", "university". | EXACT TITLE in education: "Law school".
0.380
Easement ↗ Q448405 EXACT TITLE
accessbestlandlawlimitedownedpublicrealtype
SHARED TOKENS (9): "access", "best", "land", "law", "limited", "owned", "public", "real", "type". | EXACT TITLE in insurance_coverage: "Easement".
0.360
collegeeducationalenrollmentinstitutionslessprogramsstudentsuniversity
SHARED TOKENS (8): "college", "educational", "enrollment", "institutions", "less", "programs", "students", "university". | EXACT TITLE in education: "Dual enrollment".
0.360
Insurance ↗ Q43183 EXACT TITLE
coverageestablishedfinancialhealthmanagementpolicypotentiallyprimary
SHARED TOKENS (8): "coverage", "established", "financial", "health", "management", "policy", "potentially", "primary". | EXACT TITLE in insurance_coverage: "Insurance".
0.360
membermembersnorthoperationsschoolsuniversitywestwestern
SHARED TOKENS (8): "member", "members", "north", "operations", "schools", "university", "west", "western". | EXACT TITLE in education: "Mountain West Conference".
0.360
HP Inc. ↗ Q21404084 EXACT TITLE
businessfoundedinformationlegaloriginalpersonalservingtechnology
SHARED TOKENS (8): "business", "founded", "information", "legal", "original", "personal", "serving", "technology". | EXACT TITLE in education: "HP Inc.".
0.340
agenciescourtsgovernmentinstitutionsprimarysupportsystem
SHARED TOKENS (7): "agencies", "courts", "government", "institutions", "primary", "support", "system". | EXACT TITLE in education: "Criminal justice".
0.340
courtsfinallanguagepolicypriorspecificstandard
SHARED TOKENS (7): "courts", "final", "language", "policy", "prior", "specific", "standard". | EXACT TITLE in insurance_coverage: "Insurance policy".
0.320
Deed ↗ Q705914 EXACT TITLE
lawlegallessperiodtitletype
SHARED TOKENS (6): "law", "legal", "less", "period", "title", "type". | EXACT TITLE in insurance_coverage: "Deed".
0.320
heldlawlimitedpersonalpublicresponsible
SHARED TOKENS (6): "held", "law", "limited", "personal", "public", "responsible". | EXACT TITLE in insurance_coverage: "Product liability".
0.320
actaffordablecarehealthlawrequirement
SHARED TOKENS (6): "act", "affordable", "care", "health", "law", "requirement". | EXACT TITLE in insurance_coverage: "Essential health benefits".
0.300
administrationannualappointedboarddirectoreducationengineeringestablishfederalfederallyfoundationgovernmenthealthindependentmajormedicalmembersnationaloperationsplanning
SHARED TOKENS (25): "administration", "annual", "appointed", "board", "director", "education", "engineering", "establish", "federal", "federally", "foundation", "government", "health", "independent", "major", "medical", "members", "national", "operations", "planning"....
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
benefitcapitalcivildesigneithergrowthindustryinvestmentlegalmainmajormedicalofferingsphysicalpolicysinglespecific
SHARED TOKENS (17): "benefit", "capital", "civil", "design", "either", "growth", "industry", "investment", "legal", "main", "major", "medical", "offerings", "physical", "policy", "single", "specific".
0.300
academicbettercrediteducationemployerexperiencemakingoperatespartnershipperiodpracticalprogramprogramsstudentstypeuniversityworkworkforce
SHARED TOKENS (18): "academic", "better", "credit", "education", "employer", "experience", "making", "operates", "partnership", "period", "practical", "program", "programs", "students", "type", "university", "work", "workforce".
0.300
actaprilbestcodecontinuingcoveragedepartmentemployersemploymentgovernmentgrouphealthlawplanpriceprivateprogrampublicrequirementssupports
SHARED TOKENS (21): "act", "april", "best", "code", "continuing", "coverage", "department", "employers", "employment", "government", "group", "health", "law", "plan", "price", "private", "program", "public", "requirements", "supports"....
0.300
corporateexternalfeesfinancialgovernanceindependentmattersmediamissionmodelmultiplenationallyoperatedoperatingorganizationpolicyprimarypublicreceivesingle
SHARED TOKENS (21): "corporate", "external", "fees", "financial", "governance", "independent", "matters", "media", "mission", "model", "multiple", "nationally", "operated", "operating", "organization", "policy", "primary", "public", "receive", "single"....
0.300
academicdecembereducationeitherestablishedestatefinancialfoundationfundgovernedhigherindependentinstitutionslegalpolicyprivatepublicrealresourcesschools
SHARED TOKENS (24): "academic", "december", "education", "either", "established", "estate", "financial", "foundation", "fund", "governed", "higher", "independent", "institutions", "legal", "policy", "private", "public", "real", "resources", "schools"....
0.300
actagricultureamericacivilcollegecurriculumdepartmenteducationeducationalengineeringestablishedfederalfundhigherhomeinformationinstitutionslandlawmission
SHARED TOKENS (34): "act", "agriculture", "america", "civil", "college", "curriculum", "department", "education", "educational", "engineering", "established", "federal", "fund", "higher", "home", "information", "institutions", "land", "law", "mission"....
0.300
businessescyberinformationinfrastructuretechnology
SHARED TOKENS (5): "businesses", "cyber", "information", "infrastructure", "technology". | EXACT TITLE in insurance_coverage: "Cyber insurance".
0.300
americacarecontinuingeducationeducationalgeneralhealthhighermedicalmultipleoptionspopulationprimaryprivateprocesspublicresearchtrainingworkworking
SHARED TOKENS (20): "america", "care", "continuing", "education", "educational", "general", "health", "higher", "medical", "multiple", "options", "population", "primary", "private", "process", "public", "research", "training", "work", "working".
0.300
actbusinessescarechoosecoverageemployersfamilyfederalgovernsgrouphealthhealthcareindividualsinformationlawlimitedmedicalmembersnationalrequires
SHARED TOKENS (22): "act", "businesses", "care", "choose", "coverage", "employers", "family", "federal", "governs", "group", "health", "healthcare", "individuals", "information", "law", "limited", "medical", "members", "national", "requires"....
0.300
actaffordableassistancecarecoveragecoveringfederalfinancialgovernmenthealthindividualsmajormedicalmillionnursingpaidpopulationprivateprogramprograms
SHARED TOKENS (27): "act", "affordable", "assistance", "care", "coverage", "covering", "federal", "financial", "government", "health", "individuals", "major", "medical", "million", "nursing", "paid", "population", "private", "program", "programs"....
0.300
developmenteconomicestatefinancialgovernmentlanguagelegalmodelsnationalprocessrealrequirementsresearchselectedsystem
SHARED TOKENS (15): "development", "economic", "estate", "financial", "government", "language", "legal", "models", "national", "process", "real", "requirements", "research", "selected", "system".
0.300
Drought ↗ Q43059 KW CROSS HIGH
activityagricultureannualdirectlyeconomiceconomyenvironmentalexperiencehealthhistoryhumanincreasesjulylesslocalmonthsperiodpublicregionresult
SHARED TOKENS (22): "activity", "agriculture", "annual", "directly", "economic", "economy", "environmental", "experience", "health", "history", "human", "increases", "july", "less", "local", "months", "period", "public", "region", "result"....
0.300
actadministrationagenciesbureaubusinesscouncilcreditdataeconomicestablishedfederalfinancialgrowthinstitutionsjulylawmajormakingprimaryregulatory
SHARED TOKENS (22): "act", "administration", "agencies", "bureau", "business", "council", "credit", "data", "economic", "established", "federal", "financial", "growth", "institutions", "july", "law", "major", "making", "primary", "regulatory"....
0.300
accreditationadministrationalreadybusinesscorecorporatecreditcreditseducationgeneralhigherleastmanagementprofessionalprogramprogramsqualityrequiresschoolssenior
SHARED TOKENS (23): "accreditation", "administration", "already", "business", "core", "corporate", "credit", "credits", "education", "general", "higher", "least", "management", "professional", "program", "programs", "quality", "requires", "schools", "senior"....
0.300
actadaanalysisannualcivilemploymentfamilyhourinformationlaborlawmanagementmedicalnationalprofessionalratestitletype
SHARED TOKENS (18): "act", "ada", "analysis", "annual", "civil", "employment", "family", "hour", "information", "labor", "law", "management", "medical", "national", "professional", "rates", "title", "type".
0.300
collegeeconomiceducationeducationalgeneralhigherindividualsknowledgeoccupationsschoolsspecifictechnicaltechnologytrainingtype
SHARED TOKENS (15): "college", "economic", "education", "educational", "general", "higher", "individuals", "knowledge", "occupations", "schools", "specific", "technical", "technology", "training", "type".
0.300
administeredappointeddepartmenteducationfederalgeneralgovernmenthealthhealthcarehumanmattersmedicalmissionprimaryprivatepublicresponsiblesystem
SHARED TOKENS (18): "administered", "appointed", "department", "education", "federal", "general", "government", "health", "healthcare", "human", "matters", "medical", "mission", "primary", "private", "public", "responsible", "system".
0.300
applicationapplyaveragecollegedecemberdepartmentdirectlyeducationenrollmentfilinggraduatesheldhigherinstitutionsmajormediamillionminimummultiplenovember
SHARED TOKENS (32): "application", "apply", "average", "college", "december", "department", "directly", "education", "enrollment", "filing", "graduates", "held", "higher", "institutions", "major", "media", "million", "minimum", "multiple", "november"....
0.300
additionalbuildingcurrentdepartmentdevelopmentdirectlyfederalgovernmenthumanmembernationalofficesphysicalpolicyprogramresearchsystem
SHARED TOKENS (17): "additional", "building", "current", "department", "development", "directly", "federal", "government", "human", "member", "national", "offices", "physical", "policy", "program", "research", "system".
0.300
educationestablishedexperiencespecificwork
SHARED TOKENS (5): "education", "established", "experience", "specific", "work". | EXACT TITLE in education: "Adult learner".
0.300
Student affairs ↗ KW CROSS HIGH
academicdepartmentdepartmentsdevelopmentdirectlyeducationgrowthhigherinstitutionsorganizationprofessionalsschoolsseniorstudentssupporttitletypeuniversitywork
SHARED TOKENS (19): "academic", "department", "departments", "development", "directly", "education", "growth", "higher", "institutions", "organization", "professionals", "schools", "senior", "students", "support", "title", "type", "university", "work".
0.300
accountinganalysisappliedbusinessconstructionemploymentfinancialinvestmentmodelsnewsphysicalprofessionalprofessionalsprofessionsprogramssearchtrained
SHARED TOKENS (17): "accounting", "analysis", "applied", "business", "construction", "employment", "financial", "investment", "models", "news", "physical", "professional", "professionals", "professions", "programs", "search", "trained".
0.300
actadditionalaffordableappointedassistancebureaucarecivilcodedepartmenteitherfederalfundgovernmenthistoryincreaseslawmainmillionoffice
SHARED TOKENS (27): "act", "additional", "affordable", "appointed", "assistance", "bureau", "care", "civil", "code", "department", "either", "federal", "fund", "government", "history", "increases", "law", "main", "million", "office"....
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
acquisitionsadditionalannouncedapplicationassistancebusinessesdatalocalmarchoctoberplanningplatformprogrampublicsearchstreet
SHARED TOKENS (16): "acquisitions", "additional", "announced", "application", "assistance", "businesses", "data", "local", "march", "october", "planning", "platform", "program", "public", "search", "street".
0.300
accessadministrationaprilbuildingbusinessdepartmentdevelopmentfederalgovernmenthousingindividualsinfrastructurelocalmajormanagementplanprimaryrequirementresourcessupport
SHARED TOKENS (21): "access", "administration", "april", "building", "business", "department", "development", "federal", "government", "housing", "individuals", "infrastructure", "local", "major", "management", "plan", "primary", "requirement", "resources", "support"....
0.300
Dentistry ↗ Q12128 KW CROSS HIGH
carecomplexdentaldevelopmenteitherguidehistoryinstitutionsmanagementmedicalprimaryprivaterelevantresearchwaterwork
SHARED TOKENS (16): "care", "complex", "dental", "development", "either", "guide", "history", "institutions", "management", "medical", "primary", "private", "relevant", "research", "water", "work".
0.300
acquisitionsactactivitybusinesscapitalcorporatedepartmentdirectfederalgovernedgovernmentlawlegalmanagementoperatingoperationsorganizationproposedregulatoryrequires
SHARED TOKENS (23): "acquisitions", "act", "activity", "business", "capital", "corporate", "department", "direct", "federal", "governed", "government", "law", "legal", "management", "operating", "operations", "organization", "proposed", "regulatory", "requires"....
0.300
academicanalysiscompleteengineeringfoundedgeneralgrowthhistoryhumanknowledgelanguageleastmediamultipleoperationsplanningreachresearchsearchsoftware
SHARED TOKENS (21): "academic", "analysis", "complete", "engineering", "founded", "general", "growth", "history", "human", "knowledge", "language", "least", "media", "multiple", "operations", "planning", "reach", "research", "search", "software"....
0.300
actadditionaladministeredboardcentercompletecontinuingdepartmenteducationfederalgovernmenthealthlicensuremedicalprogramprogramssupportstrainingtype
SHARED TOKENS (19): "act", "additional", "administered", "board", "center", "complete", "continuing", "department", "education", "federal", "government", "health", "licensure", "medical", "program", "programs", "supports", "training", "type".
0.300
boardcarecollegecriticaldepartmentsequipmenthealthcarehomemanagementmedicalnationalregulatoryresponsiblespecialistsupporttraineduniversityworkworking
SHARED TOKENS (19): "board", "care", "college", "critical", "departments", "equipment", "healthcare", "home", "management", "medical", "national", "regulatory", "responsible", "specialist", "support", "trained", "university", "work", "working".
0.300
broadercounselingdevelopmenteconomiceducationeducationalemploymentgeneralidentityinformationinstitutionsmanagementoccupationsplanningprocessprofessionalrelationshipssupportsupportswork
SHARED TOKENS (21): "broader", "counseling", "development", "economic", "education", "educational", "employment", "general", "identity", "information", "institutions", "management", "occupations", "planning", "process", "professional", "relationships", "support", "supports", "work"....
0.300
administrationcriticalcurriculumdepartmentdevelopmenteconomyeducationengineeringfoundationgrouphealthlabornationalnetonlinepolicyrepresentsschoolsstudentstechnical
SHARED TOKENS (22): "administration", "critical", "curriculum", "department", "development", "economy", "education", "engineering", "foundation", "group", "health", "labor", "national", "net", "online", "policy", "represents", "schools", "students", "technical"....
0.300
Actuary ↗ Q179985 KW CROSS HIGH
academicadditionalanalysisappliedbusinesscompletecostdesigneducationfinancialhumaninformationknowledgemanagementmultipleprofessionalprogramsproposedregionalrequirements
SHARED TOKENS (22): "academic", "additional", "analysis", "applied", "business", "complete", "cost", "design", "education", "financial", "human", "information", "knowledge", "management", "multiple", "professional", "programs", "proposed", "regional", "requirements"....
0.300
benefitcoverageeitherestatefirehomeleastlimitedpaidperiodplanningpolicypotentiallyraterelevantspecific
SHARED TOKENS (16): "benefit", "coverage", "either", "estate", "fire", "home", "least", "limited", "paid", "period", "planning", "policy", "potentially", "rate", "relevant", "specific".
0.300
businesscreateseconomicfreegeneralgovernmentgrowthhealthhigherindividualslawleastlicensuremembersminimumoccupationsprofessionalprofessionspublicquality
SHARED TOKENS (27): "business", "creates", "economic", "free", "general", "government", "growth", "health", "higher", "individuals", "law", "least", "licensure", "members", "minimum", "occupations", "professional", "professions", "public", "quality"....
0.300
actadministrationcaredepartmentfacilitiesfederalgovhealthhealthcarehomehumannursingpartnershipprocessprogramprogramsqualitysystem
SHARED TOKENS (18): "act", "administration", "care", "department", "facilities", "federal", "gov", "health", "healthcare", "home", "human", "nursing", "partnership", "process", "program", "programs", "quality", "system".
0.300
actadditionalaffordableaprilbusinessescarechoosedecemberenrollmentfederalhealthlawmillionmonthsnovemberoctoberprivateresponsibletype
SHARED TOKENS (19): "act", "additional", "affordable", "april", "businesses", "care", "choose", "december", "enrollment", "federal", "health", "law", "million", "months", "november", "october", "private", "responsible", "type".
0.300
Juris Doctor ↗ Q1540185 KW CROSS HIGH
academicadditionalapplycentercivilcompletecorporatecourtscurriculumdepartmenteducationengineeringfederalgraduatesindividualsinternationallawlegallessmatters
SHARED TOKENS (33): "academic", "additional", "apply", "center", "civil", "complete", "corporate", "courts", "curriculum", "department", "education", "engineering", "federal", "graduates", "individuals", "international", "law", "legal", "less", "matters"....
0.300
accreditationactagenciescouncilcreditsdatadepartmenteducationeducationaleligibilityfederalfederallygovernmenthigherinstitutionslawlegislationlimitedmembernationally
SHARED TOKENS (33): "accreditation", "act", "agencies", "council", "credits", "data", "department", "education", "educational", "eligibility", "federal", "federally", "government", "higher", "institutions", "law", "legislation", "limited", "member", "nationally"....
0.300
actadministeredadministrationagenciesappointedbureaucurrentdepartmentdepartmentsestablishedfederalfinancialgovernmentinstitutionslimitedmajormattersmembernationaloffice
SHARED TOKENS (24): "act", "administered", "administration", "agencies", "appointed", "bureau", "current", "department", "departments", "established", "federal", "financial", "government", "institutions", "limited", "major", "matters", "member", "national", "office"....
0.300
benefitbestbusinessesconstructiondirecteconomiceconomygovernmentgroupgrowthinternationallocalorganizationprivateprocesspublicqualityspecificworking
SHARED TOKENS (19): "benefit", "best", "businesses", "construction", "direct", "economic", "economy", "government", "group", "growth", "international", "local", "organization", "private", "process", "public", "quality", "specific", "working".
0.300
applicationdesignengineeringequipmentinternationalmanagementmanufacturingmembersnationalneedorganizationprofessionalsoftwaretechnologywork
SHARED TOKENS (15): "application", "design", "engineering", "equipment", "international", "management", "manufacturing", "members", "national", "need", "organization", "professional", "software", "technology", "work".
0.300
actadministrationassistancecreditdecemberdepartmenteducationemploymentestablishedfederalhealthlaborlawmissionratesregulatorytrainingworking
SHARED TOKENS (18): "act", "administration", "assistance", "credit", "december", "department", "education", "employment", "established", "federal", "health", "labor", "law", "mission", "rates", "regulatory", "training", "working".
0.300
financialinstitutionsinvestmentminimumpublic
SHARED TOKENS (5): "financial", "institutions", "investment", "minimum", "public". | EXACT TITLE in insurance_coverage: "Underwriting".
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitaldevelopmenteitherfinancialfundgeneralinvestmentlimitedmanagementprivatepublicrolespecificworking
SHARED TOKENS (15): "business", "capital", "development", "either", "financial", "fund", "general", "investment", "limited", "management", "private", "public", "role", "specific", "working".
0.300
accessactannouncedannualboarddirectlyeducationalfederalfinancialgovernmentlawmediamissionoperationsownedpublicreceivedsupport
SHARED TOKENS (18): "access", "act", "announced", "annual", "board", "directly", "educational", "federal", "financial", "government", "law", "media", "mission", "operations", "owned", "public", "received", "support".
0.300
academicfoundationfoundedlawlegalmembersmillionmodelnationalofficeorganizationprofessionalresearchschoolssinglespecificstudents
SHARED TOKENS (17): "academic", "foundation", "founded", "law", "legal", "members", "million", "model", "national", "office", "organization", "professional", "research", "schools", "single", "specific", "students".
0.300
academicbroadercorporatecreatesexperiencefreegovernmentidentitymakingoperationspresenceresourcesresultschoolsspecificstatustrainingworkforce
SHARED TOKENS (18): "academic", "broader", "corporate", "creates", "experience", "free", "government", "identity", "making", "operations", "presence", "resources", "result", "schools", "specific", "status", "training", "workforce".
0.300
actadministereddirectestablishedfederalhealthcarelaborlawmajornationalplanprogramprogramssinglesupportsystem
SHARED TOKENS (16): "act", "administered", "direct", "established", "federal", "healthcare", "labor", "law", "major", "national", "plan", "program", "programs", "single", "support", "system".
0.300
administrationbuildingdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgovernmenthealthhistoryhourlabormembermillionmissionresponsiblethemworking
SHARED TOKENS (20): "administration", "building", "department", "departments", "directly", "economic", "employers", "employment", "federal", "government", "health", "history", "hour", "labor", "member", "million", "mission", "responsible", "them", "working".
0.300
accessactbenefitcodecourtsdepartmentdisclosurefederalfinancialindustryinformationlaborlawminimumplanprivaterequiring
SHARED TOKENS (17): "access", "act", "benefit", "code", "courts", "department", "disclosure", "federal", "financial", "industry", "information", "labor", "law", "minimum", "plan", "private", "requiring".
0.300
annualappointedaprilboardbrandcurrentdecemberfirefoundedgeneralgrouplegallocalmultipleoperatespersonal
SHARED TOKENS (16): "annual", "appointed", "april", "board", "brand", "current", "december", "fire", "founded", "general", "group", "legal", "local", "multiple", "operates", "personal".
0.300
Trinity Health ↗ KW CROSS HIGH
carecontinuingfacilitieshealthhealthcarehomeidahonetworknorthoperatesoperatingseniorsouthsupportsystem
SHARED TOKENS (15): "care", "continuing", "facilities", "health", "healthcare", "home", "idaho", "network", "north", "operates", "operating", "senior", "south", "support", "system".
0.300
academicactivityanalysisbenefitcapacityconnectingcoredevelopmentgovernmentinstitutionsknowledgemissionorganizationpartnersprivateprocesspublicresearchrolesharing
SHARED TOKENS (21): "academic", "activity", "analysis", "benefit", "capacity", "connecting", "core", "development", "government", "institutions", "knowledge", "mission", "organization", "partners", "private", "process", "public", "research", "role", "sharing"....
0.300
academicbrandcentercriticaldesignationeducationemployershigherinstitutionsinstructionknowledgemembersmissionprivatepublicresearchsitesstudentsuniversity
SHARED TOKENS (19): "academic", "brand", "center", "critical", "designation", "education", "employers", "higher", "institutions", "instruction", "knowledge", "members", "mission", "private", "public", "research", "sites", "students", "university".
0.300
actannualbenefitcareemployeremployersfederallygrouphealthhealthcareindividualsmedicaloptionsorganizationprofessionalsproviderstatus
SHARED TOKENS (17): "act", "annual", "benefit", "care", "employer", "employers", "federally", "group", "health", "healthcare", "individuals", "medical", "options", "organization", "professionals", "provider", "status".
🫐 BERRY97 edges
0.280
Simplot ↗ Q3484788 EXACT TITLE
agricultureboiseheadquarteredidaho
SHARED TOKENS (4): "agriculture", "boise", "headquartered", "idaho". | EXACT TITLE in education: "Simplot".
0.280
Subrogation ↗ Q322457 EXACT TITLE
benefitcivillawlegal
SHARED TOKENS (4): "benefit", "civil", "law", "legal". | EXACT TITLE in insurance_coverage: "Subrogation".
0.280
healthmanagementpriorprocess
SHARED TOKENS (4): "health", "management", "prior", "process". | EXACT TITLE in insurance_coverage: "Prior authorization".
0.280
averagebenefitbetterdemandhigherinformationlawlessmanagementpricequalityrelevantstandardthem
SHARED TOKENS (14): "average", "benefit", "better", "demand", "higher", "information", "law", "less", "management", "price", "quality", "relevant", "standard", "them".
0.280
benefitbusinesscreatesdirectdirectlyeitherestablishgroupheldmanagementownedpracticalspecificthem
SHARED TOKENS (14): "benefit", "business", "creates", "direct", "directly", "either", "establish", "group", "held", "management", "owned", "practical", "specific", "them".
0.280
alreadyanalysisbusinesscomparisoncurrentdirectlyeconomyindustrymarketingonlinepricesearchsitesvertical
SHARED TOKENS (14): "already", "analysis", "business", "comparison", "current", "directly", "economy", "industry", "marketing", "online", "price", "search", "sites", "vertical".
0.280
Lien ↗ Q4469383 EXACT TITLE
applicationbenefitspecifictype
SHARED TOKENS (4): "application", "benefit", "specific", "type". | EXACT TITLE in insurance_coverage: "Lien". | EXACT TITLE in education: "Lien".
0.280
Tuition ↗ Q129529471 EXACT TITLE
academiceducationfeesprivate
SHARED TOKENS (4): "academic", "education", "fees", "private". | EXACT TITLE in education: "Tuition".
0.280
broadereducationeducationalexperiencegeneralinformationknowledgeprocessrecentrequiresrolestudentsthemwork
SHARED TOKENS (14): "broader", "education", "educational", "experience", "general", "information", "knowledge", "process", "recent", "requires", "role", "students", "them", "work".
0.280
actactivityapplicationbenefitbureaucostcoveragefederalhealthprocessproviderreceivereceivedthem
SHARED TOKENS (14): "act", "activity", "application", "benefit", "bureau", "cost", "coverage", "federal", "health", "process", "provider", "receive", "received", "them".
0.280
Indemnity ↗ Q708399 EXACT TITLE
lawlimitedmedicalrelevant
SHARED TOKENS (4): "law", "limited", "medical", "relevant". | EXACT TITLE in insurance_coverage: "Indemnity".
0.280
firehomemainpolicy
SHARED TOKENS (4): "fire", "home", "main", "policy". | EXACT TITLE in insurance_coverage: "Property insurance".
0.280
State Farm ↗ Q2007336 EXACT TITLE
corporatefoundedgroupprovider
SHARED TOKENS (4): "corporate", "founded", "group", "provider". | EXACT TITLE in insurance_coverage: "State Farm".
0.280
Boise River ↗ Q891080 EXACT TITLE
boiseidahoriverwestern
SHARED TOKENS (4): "boise", "idaho", "river", "western". | EXACT TITLE in insurance_coverage: "Boise River".
0.280
Balance billing ↗ KW CROSS HIGH
carecostcreatesfeeshealthcareincreasesmakingmedicalneednetworkproviderratessystemthem
SHARED TOKENS (14): "care", "cost", "creates", "fees", "healthcare", "increases", "making", "medical", "need", "network", "provider", "rates", "system", "them".
0.260
Escrow ↗ Q338451 EXACT TITLE
establishedheldprimary
SHARED TOKENS (3): "established", "held", "primary". | EXACT TITLE in insurance_coverage: "Escrow".
0.260
activitycentercouncildataeducationeducationalfoundationhigherinstitutionsnationalresearchservessystem
SHARED TOKENS (13): "activity", "center", "council", "data", "education", "educational", "foundation", "higher", "institutions", "national", "research", "serves", "system".
0.260
adaboisecanyonhomeidahomainmeridiannampanorthwestpopulationsectiontreasurevalley
SHARED TOKENS (13): "ada", "boise", "canyon", "home", "idaho", "main", "meridian", "nampa", "northwest", "population", "section", "treasure", "valley".
0.260
additionalcoreeducationgraduateshumanmedicaloperatingprogramprogramsschoolsstudentssystemtraining
SHARED TOKENS (13): "additional", "core", "education", "graduates", "human", "medical", "operating", "program", "programs", "schools", "students", "system", "training".
0.260
complexdirectlyeconomyfinalfreeinternationalmakingmanagementmemberneedownedriververtical
SHARED TOKENS (13): "complex", "directly", "economy", "final", "free", "international", "making", "management", "member", "need", "owned", "river", "vertical".
0.260
eithergovernmentpurchased
SHARED TOKENS (3): "either", "government", "purchased". | EXACT TITLE in insurance_coverage: "Crop insurance".
0.260
averagecaredevelopmenteconomiceducationfamilymembermembersprimaryproviderresponsiblestudentsuniversity
SHARED TOKENS (13): "average", "care", "development", "economic", "education", "family", "member", "members", "primary", "provider", "responsible", "students", "university".
0.260
businessescivilcostcoveragedirectfinancialgeneralindividualslawlegalmedicalpolicyprofessional
SHARED TOKENS (13): "businesses", "civil", "cost", "coverage", "direct", "financial", "general", "individuals", "law", "legal", "medical", "policy", "professional".
0.260
Aon plc ↗ Q739518 KW CROSS HIGH
americacapitalcenterfoundedgroupheadquarteredhealthhumanmanagementnorthoperatesoperationsprofessional
SHARED TOKENS (13): "america", "capital", "center", "founded", "group", "headquartered", "health", "human", "management", "north", "operates", "operations", "professional".
0.260
centercurrentdirecteducationhealthmedicalprofessionalsprogramprogramsschoolsseniortraininguniversity
SHARED TOKENS (13): "center", "current", "direct", "education", "health", "medical", "professionals", "program", "programs", "schools", "senior", "training", "university".
0.260
actdirectorfederalfinancialgroupinvestmentlawlegislationlessmembernovemberpdfregulatory
SHARED TOKENS (13): "act", "director", "federal", "financial", "group", "investment", "law", "legislation", "less", "member", "november", "pdf", "regulatory".
0.260
businessbusinessescoveragegenerallinemedicaloperationspersonalpolicyprofessionalpublicspecifictype
SHARED TOKENS (13): "business", "businesses", "coverage", "general", "line", "medical", "operations", "personal", "policy", "professional", "public", "specific", "type".
0.260
accreditationeducationeithergovernmenthigherinstitutionsnationaloperatedownedprivatepublicreceiveuniversity
SHARED TOKENS (13): "accreditation", "education", "either", "government", "higher", "institutions", "national", "operated", "owned", "private", "public", "receive", "university".
0.260
administrationagricultureappointedcreditdepartmentdirectorhomemarketingnationalnetworkofficespolicyprograms
SHARED TOKENS (13): "administration", "agriculture", "appointed", "credit", "department", "director", "home", "marketing", "national", "network", "offices", "policy", "programs".
0.240
acquirecoreeducationgraduatesmajormedicalmovedprofessionsprogramstrainedtrainingwork
SHARED TOKENS (12): "acquire", "core", "education", "graduates", "major", "medical", "moved", "professions", "programs", "trained", "training", "work".
0.240
appliedcapitalcrediteconomicfinancialinvestmentlinemanagementraterequiresspecificthem
SHARED TOKENS (12): "applied", "capital", "credit", "economic", "financial", "investment", "line", "management", "rate", "requires", "specific", "them".
0.240
Fidelity bond ↗ Q884117 KW CROSS HIGH
additionalbenefitbusinesscoverageeitheremployerfinancialfiregeneralindividualsresultspecific
SHARED TOKENS (12): "additional", "benefit", "business", "coverage", "either", "employer", "financial", "fire", "general", "individuals", "result", "specific".
0.240
accesseducationeducationaleitherinstructionmultiplenetworkonlineprocessprogramrecentstudents
SHARED TOKENS (12): "access", "education", "educational", "either", "instruction", "multiple", "network", "online", "process", "program", "recent", "students".
0.240
coursecoverageeconomicemployeremployersemploymentgeneralhealthlimitedmedicalresultsystem
SHARED TOKENS (12): "course", "coverage", "economic", "employer", "employers", "employment", "general", "health", "limited", "medical", "result", "system".
0.240
broadercapacitycivilcoveragelegalmanagementorganizationpersonalregulatoryresultsimultaneouslytype
SHARED TOKENS (12): "broader", "capacity", "civil", "coverage", "legal", "management", "organization", "personal", "regulatory", "result", "simultaneously", "type".
0.240
businessbusinesseseconomicemployersheadquarteredhealthinvestmentmainmanagementoperatingprofessionalprogram
SHARED TOKENS (12): "business", "businesses", "economic", "employers", "headquartered", "health", "investment", "main", "management", "operating", "professional", "program".
0.240
academicapprovedboardcollegecoursecreditcurriculumdesignationplacementprogramscoresstudents
SHARED TOKENS (12): "academic", "approved", "board", "college", "course", "credit", "curriculum", "designation", "placement", "program", "scores", "students".
0.240
actadministrationdepartmentestablishedgovernmentlabormanagementofficepriorprogramresponsibletitle
SHARED TOKENS (12): "act", "administration", "department", "established", "government", "labor", "management", "office", "prior", "program", "responsible", "title".
0.240
academicboisefoundedhistoryidahoinstitutionsmembersnationaloperatedtemporarilytitlewestern
SHARED TOKENS (12): "academic", "boise", "founded", "history", "idaho", "institutions", "members", "national", "operated", "temporarily", "title", "western".
0.220
actamericacarecorporatedirecteligibilityemployergrouphealthplanpolicy
SHARED TOKENS (11): "act", "america", "care", "corporate", "direct", "eligibility", "employer", "group", "health", "plan", "policy".
0.220
additionalbusinessbusinessescoveragefinancialoperationsphysicalpolicyprimaryprocesstype
SHARED TOKENS (11): "additional", "business", "businesses", "coverage", "financial", "operations", "physical", "policy", "primary", "process", "type".
0.220
generalhigherinformationmultipleonlineprimaryprocesssinglesitespecifictype
SHARED TOKENS (11): "general", "higher", "information", "multiple", "online", "primary", "process", "single", "site", "specific", "type".
0.220
Reinsurance ↗ Q476118 EXACT TITLE
capacitypurchased
SHARED TOKENS (2): "capacity", "purchased". | EXACT TITLE in insurance_coverage: "Reinsurance".
0.220
datadigitalfeesgroupmanagementmarketingonlinereviewsearchsitestemporarily
SHARED TOKENS (11): "data", "digital", "fees", "group", "management", "marketing", "online", "review", "search", "sites", "temporarily".
0.220
coveragespecific
SHARED TOKENS (2): "coverage", "specific". | EXACT TITLE in insurance_coverage: "Flood insurance".
0.220
additionalestatefinancialhomeindustrypersonalpolicyprivaterealstandardtype
SHARED TOKENS (11): "additional", "estate", "financial", "home", "industry", "personal", "policy", "private", "real", "standard", "type".
0.220
americaannualcapacityeconomygroupidaholandmajormanufacturingownedriver
SHARED TOKENS (11): "america", "annual", "capacity", "economy", "group", "idaho", "land", "major", "manufacturing", "owned", "river".
0.210
Surety ↗ Q748845 EXACT TITLE
fails
SHARED TOKENS (1): "fails". | EXACT TITLE in insurance_coverage: "Surety".
0.200
associationassociationseventguarantyinsuranceorganizationspolicies
EXACT TITLE in insurance_coverage: "Guaranty association".
0.200
academiceducationenrollmentfederalfederallyhigherinstitutionslawprivatepublic
SHARED TOKENS (10): "academic", "education", "enrollment", "federal", "federally", "higher", "institutions", "law", "private", "public".
0.200
betterbuildingcoveragedatahomemanagementoriginalratesresourcestype
SHARED TOKENS (10): "better", "building", "coverage", "data", "home", "management", "original", "rates", "resources", "type".
0.200
Raptor ↗ Q137956 EXACT TITLE
topics
EXACT TITLE in education: "Raptor".
0.180
actappliedbusinesscommercefederalgovernmentindustrylawlimited
SHARED TOKENS (9): "act", "applied", "business", "commerce", "federal", "government", "industry", "law", "limited".
0.180
accreditationcampuscollegegovernancemainprimaryregionalresourcesuniversity
SHARED TOKENS (9): "accreditation", "campus", "college", "governance", "main", "primary", "regional", "resources", "university".
0.180
Medigap ↗ Q6806864 KW CROSS HIGH
carecoverageequipmenthealthhomemedicalmillionnursingprivate
SHARED TOKENS (9): "care", "coverage", "equipment", "health", "home", "medical", "million", "nursing", "private".
0.180
Moral hazard ↗ Q44454 KW CROSS HIGH
actcosteconomicfinancialhigherincreasesinformationlesstype
SHARED TOKENS (9): "act", "cost", "economic", "financial", "higher", "increases", "information", "less", "type".
0.180
analysisbroadercostcriticalmanagementplanprocessreviewsystem
SHARED TOKENS (9): "analysis", "broader", "cost", "critical", "management", "plan", "process", "review", "system".
0.180
Student loan ↗ Q462058 KW CROSS HIGH
educationeducationalfeesfinancialmajorratestudentssystemtype
SHARED TOKENS (9): "education", "educational", "fees", "financial", "major", "rate", "students", "system", "type".
0.180
careclientshealthmedicalorganizationplanproviderratestype
SHARED TOKENS (9): "care", "clients", "health", "medical", "organization", "plan", "provider", "rates", "type".
0.180
buildingbuildingsconstructioncoverageequipmentorganizationphysicalstructuretype
SHARED TOKENS (9): "building", "buildings", "construction", "coverage", "equipment", "organization", "physical", "structure", "type".
0.180
Request for proposal ↗ KW CROSS HIGH
bestbusinesscomplexfinalinformationoriginalpriceprocessquality
SHARED TOKENS (9): "best", "business", "complex", "final", "information", "original", "price", "process", "quality".
0.160
carehealthhomeindividualsleastneednursingtype
SHARED TOKENS (8): "care", "health", "home", "individuals", "least", "need", "nursing", "type".
0.160
commercedecisionsexperienceonlineprofessionalpurchasedreviewsites
SHARED TOKENS (8): "commerce", "decisions", "experience", "online", "professional", "purchased", "review", "sites".
0.160
costcurrentfeesfinancialminimumpolicyratetype
SHARED TOKENS (8): "cost", "current", "fees", "financial", "minimum", "policy", "rate", "type".
0.160
Allstate ↗ Q2645636 KW CROSS HIGH
foundedheadquarteredhumanindependentlineoperationsownedpersonal
SHARED TOKENS (8): "founded", "headquartered", "human", "independent", "line", "operations", "owned", "personal".
0.160
actdevelopmentfederalhousinglawnationalprogramtitle
SHARED TOKENS (8): "act", "development", "federal", "housing", "law", "national", "program", "title".
0.140
financialgroupoperatesownedpriorpublicregional
SHARED TOKENS (7): "financial", "group", "operates", "owned", "prior", "public", "regional".
0.140
agentsaverageindependentofficeofficesoperationspersonal
SHARED TOKENS (7): "agents", "average", "independent", "office", "offices", "operations", "personal".
0.140
benefithigherlimitedpaidpolicyremainrepresents
SHARED TOKENS (7): "benefit", "higher", "limited", "paid", "policy", "remain", "represents".
0.140
agentsbusinessesfinancialfiregroupindependentowned
SHARED TOKENS (7): "agents", "businesses", "financial", "fire", "group", "independent", "owned".
0.140
civillawofficeoriginalrecordservestitle
SHARED TOKENS (7): "civil", "law", "office", "original", "record", "serves", "title".
0.140
activityenvironmentalhealthhumanlandpubliczone
SHARED TOKENS (7): "activity", "environmental", "health", "human", "land", "public", "zone".
0.140
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahopopulationschoolswest
SHARED TOKENS (7): "ada", "boise", "canyon", "idaho", "population", "schools", "west".
0.140
benefitdirectestablishedfinanciallegalmajorrequirement
SHARED TOKENS (7): "benefit", "direct", "established", "financial", "legal", "major", "requirement".
0.140
agentsamericaheadquarteredindependentnationalofficesorganization
SHARED TOKENS (7): "agents", "america", "headquartered", "independent", "national", "offices", "organization".
0.140
educationeducationalhigherhomeonlineresourcestechnology
SHARED TOKENS (7): "education", "educational", "higher", "home", "online", "resources", "technology".
0.140
applicationdigitalestablishedfinancialindustryonlinetechnology
SHARED TOKENS (7): "application", "digital", "established", "financial", "industry", "online", "technology".
0.140
codecoveringgovernmenthomeofficesystemtype
SHARED TOKENS (7): "code", "covering", "government", "home", "office", "system", "type".
0.140
coveragedirectlyhealthindividualsmedicalorganizationpolicy
SHARED TOKENS (7): "coverage", "directly", "health", "individuals", "medical", "organization", "policy".
0.140
agriculturedepartmentfederalgovernmentmanagementownedprogram
SHARED TOKENS (7): "agriculture", "department", "federal", "government", "management", "owned", "program".
0.140
accreditationdepartmenteducationindependentnorthwestorganizationuniversity
SHARED TOKENS (7): "accreditation", "department", "education", "independent", "northwest", "organization", "university".
0.120
coveragefamilyheadquarteredhealthinvestmentprivate
SHARED TOKENS (6): "coverage", "family", "headquartered", "health", "investment", "private".
0.120
eitherfinancialmillionownedpolicypurchased
SHARED TOKENS (6): "either", "financial", "million", "owned", "policy", "purchased".
0.120
Kuna, Idaho ↗ KW CROSS HIGH
adaadditionalboiseidahokunapopulation
SHARED TOKENS (6): "ada", "additional", "boise", "idaho", "kuna", "population".
0.120
estategovernmentofficepublicrealrecords
SHARED TOKENS (6): "estate", "government", "office", "public", "real", "records".
0.120
financiallegalphysicalprimaryregionspecific
SHARED TOKENS (6): "financial", "legal", "physical", "primary", "region", "specific".
0.120
headquarteredhomepersonalprivateselectwater
SHARED TOKENS (6): "headquartered", "home", "personal", "private", "select", "water".
0.120
corecreatespaidphysicalworkworking
SHARED TOKENS (6): "core", "creates", "paid", "physical", "work", "working".
0.100
buildinggroupinvestmentofficesoperations
SHARED TOKENS (5): "building", "group", "investment", "offices", "operations".
0.100
averagehistoryindependentlawsingle
SHARED TOKENS (5): "average", "history", "independent", "law", "single".
0.100
actcoveragepolicyprimarytype
SHARED TOKENS (5): "act", "coverage", "policy", "primary", "type".
0.100
constructioncoverageequipmentmedicaltype
SHARED TOKENS (5): "construction", "coverage", "equipment", "medical", "type".
0.100
buildingcourtsdecisionsidahomoved
SHARED TOKENS (5): "building", "courts", "decisions", "idaho", "moved".
0.100
appointeddesignationeducationalprofessionalpublic
SHARED TOKENS (5): "appointed", "designation", "educational", "professional", "public".
0.100
collegeeducationalfinancialprivateuniversity
SHARED TOKENS (5): "college", "educational", "financial", "private", "university".
0.100
academiccampuscurriculumeducationalstudents
SHARED TOKENS (5): "academic", "campus", "curriculum", "educational", "students".
0.100
eitherpolicyprivatepublictype
SHARED TOKENS (5): "either", "policy", "private", "public", "type".
◈ Frequently Asked Questions
Insurance Coverage × Education — Treasure Valley
HAIKU · HIGH GATE
Do students at Boise State University in Ada County have access to health insurance coverage through their enrollment?
Boise State University offers health insurance plans to enrolled students as part of their student services program. Students in Ada County can elect institutional coverage or waive it if they maintain equivalent coverage elsewhere. The university's insurance options cover preventive care, emergency services, and ongoing medical treatment relevant to the student population.
What insurance coverage options are available for continuing education participants in the Nampa and Caldwell area of Canyon County?
Continuing education programs offered in Nampa and Caldwell through providers like College of Western Idaho typically do not include health insurance, as these are non-degree programs for working adults. Participants are responsible for maintaining their own health coverage through employers, the individual market, or public programs. Some workforce development grants in Canyon County do include health coverage components for eligible continuing education students.
How does insurance coverage affect enrollment decisions for students choosing between Boise State University and College of Western Idaho?
Boise State University in Ada County provides comprehensive student health insurance as a standard benefit, while College of Western Idaho in Canyon County requires students to arrange their own coverage. Students transferring between these institutions or attending both may experience gaps in coverage if they do not coordinate their insurance during enrollment transitions. The difference in institutional coverage availability is a practical consideration for Treasure Valley residents selecting between university and community college pathways.
Which Treasure Valley cities require insurance documentation for educational program enrollment?
Boise, Meridian, Eagle, and other Ada County municipalities hosting Boise State University programs typically require proof of health insurance or enrollment in the university plan. Nampa and Caldwell in Canyon County generally do not mandate insurance for continuing education but may require it for degree-seeking students at College of Western Idaho. Each institution's enrollment checklist specifies whether insurance verification is necessary before registration.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Insurance Coverage × Education 11 QID bridges 249 edges 6,601 ext links 2026-07-17 21:28:11 UTC 6611da59afdce5fb
Insurance Coverage corridor ↗ Education corridor ↗ Education × Insurance Coverage ↗ boisestandard.org/standard ↗
Parent Corridors
Insurance Coverage × All Other Verticals