—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Insurance Coverage ↔ relates to ↔ Wedding Events

26 Wikipedia bridge articles confirmed in both vertical ledgers. 319 deterministic cross-vertical edges. 7,994 external source links harvested. Every edge provenance-stamped. Every claim auditable.

26 QID Bridge Articles
319 Cross Edges
7,994 External Sources
380 Wikipedia Articles
28 🌲 Evergreen
209 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Insurance Coverage
× Wedding Events
QID Bridge Articles
26
confirmed Wikipedia overlap
Total Cross Edges
319
External Sources Harvested
7,994
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
College of Western Idaho
score: 1.1500  ·  type: exact_title_cross  ·  27 shared tokens
QID Bridge Titles (20)
College of Western IdahoBoise metropolitan areaTreasure ValleyInsuranceIndemnityBoise, IdahoYelpContinuing educationLiability insuranceBoise State UniversityBoise RiverVertical integrationMergers and acquisitionsNampa, IdahoOnline marketplaceCommercial general liability insurancePrivate equityCustomer reviewAda County, IdahoRecorder of deeds
Shared Semantics (20 tokens)
boiseidahopopulationmetropolitanadapubliccanyoncollegesouthwesternownershipcapitalbusinessgeneralnampatreasurevalleywesternhomeriverdamage
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:32:18 UTC
Content Hash
91200bba55055229
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
26 BRIDGES
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (27): "academic", "ada", "board", "boise", "campus", "canyon", "college", "comprehensive", "cwi", "development", "education", "governed", "idaho", "nampa", "north", "population", "primary", "programs", "public", "reported".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in insurance_coverage: "College of Western Idaho". | EXACT TITLE in wedding_events: "College of Western Idaho".
academicadaboardboisecampuscanyoncollegecomprehensivecwidevelopmenteducationgovernedidahonampanorthpopulationprimaryprogramspublicreportedresidentsservedstudentstreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in insurance_coverage (tier:branch) and wedding_events (tier:evergreen). | SHARED TOKENS (17): "ada", "boise", "canyon", "cities", "commonly", "designated", "home", "idaho", "larger", "meridian", "metropolitan", "nampa", "percent", "population", "southwestern", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise metropolitan area".
adaboisecanyoncitiescommonlydesignatedhomeidaholargermeridianmetropolitannampapercentpopulationsouthwesterntreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "southwestern", "treasure", "valley", "western". | EXACT TITLE in insurance_coverage: "Treasure Valley". | EXACT TITLE in wedding_events: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanregionresourcesriversouthwesterntreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Insurance
Q43183 EXACT TITLE 1.000
QID OVERLAP: Q43183 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (29): "against", "certain", "contract", "damage", "designated", "established", "event", "financial", "form", "health", "insurance", "insurer", "management", "mandatory", "means", "ownership", "party", "policy", "premium", "primary".... | EXACT TITLE in insurance_coverage: "Insurance". | EXACT TITLE in wedding_events: "Insurance".
againstcertaincontractdamagedesignatedestablishedeventfinancialformhealthinsuranceinsurermanagementmandatorymeansownershippartypolicypremiumprimaryprotectionreceivesrelationshiprequiredriskriskssmalltermstransaction
inancial loss in which, in exchange for a fee, a party agrees to compensate another party in the event of a certain loss, damage, or injury. It is a form of risk management, primarily used to protect against the risk of a contingent or uncertain loss. An entity which provides insurance is known as an insurer, insurance company, insurance carrier, or underwriter. A person or entity who buys insurance is known as a policyholder, while a person or entity covered under the policy is called an insured. The insurance transaction involves the policyholder assuming a guaranteed, known, and relatively small loss in the form of a payment to the insurer (a premium) in exchange for the insurer's promise to compensate the insured in the event of a covered loss. The loss may or may not be financial, but it must always be reducible to financial terms. Furthermore, it usually involves something in which the insured has an insurable interest established by ownership, possession, or pre-existing relationship. The insured receives a contract, called the insurance policy, which details the conditions and circumstances under which the insurer will compensate the insured, or their designated beneficiary or assignee. The amount of money charged by the insurer to the policyholder for the coverage set forth in the insurance policy is called the premium. If the insured experiences a loss which is potentially covered by the insurance policy, the insured submits a claim to the insurer for processing by a claims adjuster. A mandatory out-of-pocket expense required by an insurance policy before an insurer will pay a claim is called a deductible or excess (or if required by a health insurance policy, a copayment).
Life insurance policies were taken out in the early 18th century. The first company to offer life insurance was the Amicable Society for a Perpetual Assurance Office, founded in London in 1706 by William Talbot and Sir Thomas Allen. Upon the same principle, Edward Rowe Mores established the Society for Equitable Assurances on Lives and Survivorship in 1762. It was the world's first mutual insurer and it pioneered age-based premiums based on mortality rate laying "the framework for scientific insurance practice and development" and "the basis of modern life assurance upon which all life assurance schemes were subsequently based." In the late 19th century "accident insurance" began to become available. The first company to offer accident insurance was the Railway Passengers Assurance Company, formed in 1848 in England to insure against the rising number of fatalities on the nascent railway system. The first international insurance rule was the York Antwerp Rules (YAR) for the distribution of costs between ship and cargo in the event of general average. In 1873 the "Association for the Reform and Codification of the Law of Nations", the forerunner of the International Law Association (ILA), was founded in Brussels. It published the first YAR in 1890, before switching to the present title of the "International Law Association" in 1895. By the late 19th century governments began to initiate national insurance programs against sickness and old age. Germany built on a tradition of welfare programs in Prussia and Saxony that began as early as in the 1840s. In the 1880s Chancellor Otto von Bismarck introduced old age pensions, accident insurance and medical care that formed the basis for Germany's welfare state. In Britain more extensive legislation was introduced by the Liberal government in the National Insurance Act 1911. This gave the British working classes the first contributory system of insurance against illness and unemployment. This system was greatly expanded after the Second World War under the influence of the Beveridge Report, to form the first modern welfare state. In 2008, the International Network of Insurance Associations (INIA), then an informal network, became active and it has been succeeded by the Global Federation of Insurance Associations (GFIA), which was formally founded in 2012 to increase insurance industry effectiveness in providing input to international regulatory bodies and to contribute more effectively to the international dialogue on issues of common interest.
Principles Insurance involves pooling funds from many insured entities to pay for the losses that some may incur, a process known as risk pool. The insured entities are therefore protected from risk for a fee, with the fee being dependent upon the frequency and severity of the event occurring. In order to be an insurable risk, the risk insured against must meet certain characteristics.
I
Q708399 EXACT TITLE 1.000
QID OVERLAP: Q708399 in insurance_coverage (tier:evergreen) and wedding_events (tier:branch). | SHARED TOKENS (19): "compensation", "contract", "contracts", "contractual", "damage", "events", "expenses", "expressly", "form", "insurance", "law", "limited", "medical", "party", "perform", "principal", "relationship", "relevant", "specified". | EXACT TITLE in insurance_coverage: "Indemnity".
compensationcontractcontractscontractualdamageeventsexpensesexpresslyforminsurancelawlimitedmedicalpartyperformprincipalrelationshiprelevantspecified
the relationship. While the events giving rise to an indemnity may be specified by contract, the actions that must be taken to compensate the injured party are largely unpredictable, and the maximum compensation is often expressly limited. English common law Indemnity clauses Under section 4 of the Statute of Frauds (1677), a "guarantee" (an undertaking of secondary liability; to answer for another's default) must be evidenced in writing. No such formal requirement exists in respect of indemnities (involving the assumption of primary liability; to pay irrespective of another's default) which are enforceable even if made orally. Under current English law, indemnities must be clearly and precisely worded in the contract in order to be enforceable.
Distinction from guarantees An indemnity is distinct from a guarantee, which is the promise of a third party to honor the obligation of a party to a contract should that party be unable or unwilling to do so (usually a guarantee is limited to an obligation to pay a debt). This distinction between indemnity and guarantee was discussed as early as the eighteenth century in Birkmyr v Darnell.
Distinction from warranties An indemnity is distinct from a warranty in that: An indemnity guarantees compensation equal to the amount of loss subject to the indemnity, while a warranty only guarantees compensation for the reduction in value of the acquired asset due to the warranted fact being untrue (and the beneficiary must prove such diminution in value). Warranties require the beneficiary to mitigate their losses, while indemnities do not. Warranties do not cover problems known to the beneficiary at the time the warranty is given, while indemnities do.
Boise, Idaho
Q35775 EXACT TITLE 1.000
QID OVERLAP: Q35775 in insurance_coverage (tier:branch) and wedding_events (tier:evergreen). | SHARED TOKENS (17): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "level", "major", "metropolitan", "north", "population", "river", "southwestern", "technology", "treasure", "valley". | EXACT TITLE in wedding_events: "Boise, Idaho".
adaannualboisecapitalemployershomeidaholevelmajormetropolitannorthpopulationriversouthwesterntechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Yelp
Q2299611 EXACT TITLE 1.000
QID OVERLAP: Q2299611 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (31): "annual", "approximately", "become", "business", "businesses", "com", "competing", "december", "directory", "estimates", "expanded", "information", "later", "million", "online", "operates", "practice", "practices", "public", "published".... | EXACT TITLE in insurance_coverage: "Yelp". | EXACT TITLE in wedding_events: "Yelp".
annualapproximatelybecomebusinessbusinessescomcompetingdecemberdirectoryestimatesexpandedinformationlatermilliononlineoperatespracticepracticespublicpublishedpublishesratingratingsreviewreviewssalessitesometimessubmittedsystem+1
24, approximately 308 million reviews had been contributed to Yelp. In 2024, the company had over 76 million unique visitors on desktop and mobile. Yelp estimates that over 50% of its audience has an annual household income of more than $100,000. The company has been accused of using unfair practices to raise revenue from the businesses that are reviewed on its site – e.g., by presenting more negative review information for companies that do not purchase its advertising services or by prominently featuring advertisements of the competitors of such non-paying companies or conversely by excluding negative reviews from companies' overall rating on the basis that the reviews "are not currently recommended". There have also been complaints of aggressive and misleading tactics by some of its advertising sales representatives.
Having filed for an initial public offering (IPO) with the Securities Exchange Commission in November 2011, Yelp's stock began public trading on the New York Stock Exchange on March 2, 2012. In 2012, Yelp acquired its largest European rival, Qype, for $50 million. The following year, CEO Jeremy Stoppelman reduced his salary to $1. Yelp acquired start-up online reservation company SeatMe for $12.7 million in cash and stock in 2013. Yelp's second quarter 2013 revenue of $55 million "exceeded expectations", but the company was not yet profitable. In 2012/13, Yelp moved into its new corporate headquarters, occupying about 150,000 square feet on 12 floors of 140 New Montgomery (the former PacBell building) in San Francisco. The company was profitable for the first time in the second quarter of 2014, as a result of increasing ad spending by business owners and possibly from changes in Google's local search algorithm. The algorithm dubbed Google Pigeon made authoritative local directory sites like Yelp and TripAdvisor more visible. Over the course of the year, Yelp websites were launched in Mexico, Japan, and Argentina. Also in 2014, Yelp expanded in Europe through the acquisitions of German-based restaurant review site Restaurant-Kritik and French-based CityVox. In early February 2015, Yelp announced it bought Eat24, an online food-ordering service, for $134 million. Then in August 2017, Yelp sold Eat24 to Grubhub for $287.5 million. The acquisition resulted in a partnership to integrate Grubhub delivery into the Yelp profiles of restaurants. In late 2015, a "Public Services & Government" section was introduced to Yelp, and the General Services Administration began encouraging government agencies to create and monitor official government pages. For example, the Transportation Security Administration created official TSA Yelp pages. Later that year Yelp began experimenting in San Francisco with consumer alerts that were added to pages about restaurants with poor hygiene scores in government inspections. Research conducted by the Boston Children's Hospital found that Yelp reviews with keywords associated with food poisoning correlates strongly with poor hygiene at the restaurant. Researchers at Columbia University used data from Yelp to identify three previously unreported restaurant-related food poisoning outbreaks. On November 2, 2016, concurrent with its earnings report for Q3 2016, Yelp announced it would drastically scale back its operations outside North America and halt international expansion. This resulted in the termination of essentially all international employees across Yelp's 30+ international markets from the sales, marketing, public relations, business outreach, and government relations departments. Overseas employees now primarily consist of engineering and product management staff. These layoffs affected only 175 individuals or 4% of its total workforce. In March 2017, Yelp acquired the restaurant reservation app Nowait for $40 million. In April 2017, Yelp acquired Wi-Fi marketing company Turnstyle Analytics for $20 million. In early 2020, Yelp listed space at 55 Hawthorne Street, San Francisco, for 235 employees as available for sublease. Business closures and stay-at-home orders during the COVID-19 pandemic in the United States caused a massive decline in searches on Yelp (down 64-83% from March to April, depending on category) and company revenues. On April 9, the company announced it would lay off 1,000 employees, furlough about 1,100 with benefits, reduce hours for others, cut executive pay by 20–30%, and stop paying the CEO for the rest of 2020. In September 2021, Yelp announced that it was relocating its corporate headquarters to a smaller space at 350 Mission Street to be subleased from Salesforce. On June 1, 2023, Yelp decided to close its offices in Phoenix, Arizona and Hamburg, Germany. According to an announcement made by the company, less than 6 percent of the available workstations in these offices were being utilized. This move comes after Yelp had already shut down its New York, Chicago, and Washington, D.C. offices. As of mid-2023, Yelp maintains a single remaining office in the United States in San Francisco. Additionally, the company will continue its operations in Toronto, Canada, and London, United Kingdom. The closure and downsizing of these offices are expected to result in approximately $27 million in annual cost savings for Yelp during the 2023–24 fiscal year. As of February 2024, its website listed reviews for establishments in 32 countries. In November 2024, Yelp Inc. acquired RepairPal, an auto services platform, for $80 million. In January 2026, Yelp Inc.
ful negotiations to be acquired by Google. Yelp became a public company via an initial public offering in March 2012 and became profitable for the first time two years later. As of December 31, 2024, approximately 308 million reviews had been contributed to Yelp. In 2024, the company had over 76 million unique visitors on desktop and mobile. Yelp estimates that over 50% of its audience has an annual household income of more than $100,000. The company has been accused of using unfair practices to raise revenue from the businesses that are reviewed on its site – e.g., by presenting more negative review information for companies that do not purchase its advertising services or by prominently featuring advertisements of the competitors of such non-paying companies or conversely by excluding negative reviews from companies' overall rating on the basis that the reviews "are not currently recommended". There have also been complaints of aggressive and misleading tactics by some of its advertising sales representatives.
C
Q828748 EXACT TITLE 1.000
QID OVERLAP: Q828748 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (33): "academic", "activities", "agencies", "beyond", "college", "continuing", "curriculum", "development", "economic", "education", "formal", "forms", "frequently", "general", "government", "institutional", "intended", "least", "life", "online".... | EXACT TITLE in insurance_coverage: "Continuing education". | EXACT TITLE in wedding_events: "Continuing education".
academicactivitiesagenciesbeyondcollegecontinuingcurriculumdevelopmenteconomiceducationformalformsfrequentlygeneralgovernmentinstitutionalintendedleastlifeonlinepersonalprofessionalprogramsratherseparatesometimesstaffstudentssupporttraining+3
t programs as it relates to strengthening partnerships with corporations and government agencies, helping to inform and shape the curriculum for degree programs, and generating revenue to support the academic enterprise. Comparable terminology and initiatives Outside the United States and Canada, comparable forms of post-initial education may be described using terms such as adult education, further education, lifelong learning, continuing professional development, upskilling or reskilling. In Ireland, comparable continuing-education and reskilling initiatives include Springboard+, which provides free or subsidised higher-education courses for upskilling and reskilling, and the Human Capital Initiative, a €300 million programme that commenced in 2020 to expand skills-focused higher-education provision in priority areas.
History In the United Kingdom, Oxford University's Department for Continuing Education was founded in 1878, and the Institute of Continuing Education of Cambridge University dates back to 1873. In the United States, the Chautauqua Institution, originally the Chautauqua Lake Sunday School Assembly, was founded in 1874 "as an educational experiment in out-of-school, vacation learning. It was successful and broadened almost immediately beyond courses for Sunday school teachers to include academic subjects, music, art and physical education." Harvard University traces its origins in continuing education to 1835 when John Lowell Jr. established the Lowell Institute with a mission to provide free public lectures in Boston. In 1909, then-Harvard President A. Lawrence Lowell, who was also a trustee of the Lowell Institute, expanded plans to offer Lowell Institute public courses directly with Harvard. In 1910, Lowell formally established the Havard Extension School, then referred to as the Commission on Extension Courses. The Harvard Extension School now operates under the Faculty of Arts and Sciences and is one of the 13 degree-granting schools that make up Harvard University. The School has remained in continuous operation since 1910. Cornell University was among higher education institutions that began offering university-based continuing education, primarily to teachers, through extension courses in the 1870s. As noted in the Cornell Era of February 16, 1877, the university offered a "Tour of the Great Lakes" program for "teachers and others" under the direction of Professor Theodore B. Comstock, head of Cornell's department of geology. The University of Wisconsin–Madison began its continuing education program in 1907. The New School for Social Research, founded in 1919, was initially devoted to adult education. In 1969, Empire State College, a unit of the State University of New York, was the first institution in the US to exclusively focus on providing higher education to adult learners. In 1976 the University of Florida created its own Division of Continuing Education and most courses were offered on evenings or weekends to accommodate the schedules of working students. The method of delivery of continuing education can include traditional types of classroom lectures and laboratories.
n is the education undertaken after initial education for either personal or professional reasons. The term is used mainly in the United States and Canada. Recognized forms of post-secondary learning activities within the domain include: degree credit courses by non-traditional students, non-degree career training, college remediation, workforce training, and formal personal enrichment courses (both on-campus and online). General continuing education is similar to adult education, at least in being intended for adult learners, especially those beyond traditional undergraduate college or university age. Frequently, in the United States and Canada continuing education courses are delivered through a division or school of continuing education of a college or university known sometimes as the university extension or extension school.
L
Q992350 EXACT TITLE 1.000
QID OVERLAP: Q992350 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (33): "affect", "against", "compensation", "contract", "contractual", "cost", "costs", "damage", "dedicated", "even", "expressly", "financing", "fund", "general", "group", "individual", "insurance", "legal", "liability", "limits".... | EXACT TITLE in insurance_coverage: "Liability insurance". | EXACT TITLE in wedding_events: "Liability insurance".
affectagainstcompensationcontractcontractualcostcostsdamagededicatedevenexpresslyfinancingfundgeneralgroupindividualinsurancelegalliabilitylimitsmodernpartypoliciespolicypremiumprotectionratherriskrisksrule+3
liability are not covered under liability insurance policies. When a claim is made, the insurance carrier has the duty (and right) to defend the insured. The legal costs of a defence normally do not affect policy limits unless the policy expressly states otherwise; this default rule is useful because defence costs tend to soar when cases go to trial.
Types In many countries, liability insurance is a compulsory form of insurance for those at risk of being sued by third parties for negligence. The most usual classes of mandatory policy cover the drivers of motor vehicles (vehicle insurance), those who offer professional services to the public, those who manufacture products that may be harmful, constructors and those who offer employment. The reason for such laws is that the classes of insured are deliberately engaging in activities that put others at risk of injury or loss. Public policy therefore requires that such individuals should carry insurance so that, if their activities do cause loss or damage to another, money will be available to pay compensation. In addition, there are a further range of perils that people insure against and, consequently, the number and range of liability policies has increased in line with the rise of contingency fee litigation offered by lawyers (sometimes on a class action basis). Such policies fall into several different classes: Public liability Industry and commerce are based on a range of processes and activities that have the potential to affect third parties (members of the public, visitors, trespassers, sub-contractors, etc. who may be physically injured or whose property may be damaged or both). It varies from state to state as to whether either or both employer's liability insurance and public liability insurance have been made compulsory by law. Regardless of compulsion, however, most organizations include public liability insurance in their insurance portfolio even though the conditions, exclusions, and warranties included within the standard policies can be a burden. A company owning an industrial facility, for instance, may buy pollution insurance to cover lawsuits resulting from environmental accidents. Many small businesses do not secure general or professional liability insurance due to the high cost of premiums. However, in the event of a claim, out-of-pocket costs for a legal defence or settlement can far exceed premium costs. In some cases, the costs of a claim could be enough to shut down a small business. Businesses must consider all potential risk exposures when deciding whether liability insurance is needed, and, if so, how much coverage is appropriate and cost-effective. Those with the greatest public liability risk exposure are occupiers of premises where large numbers of third parties frequent at leisure including shopping centres, pubs, clubs, theatres, cinemas, sporting venues, markets, hotels, and resorts. The risk increases dramatically when consumption of alcohol and sporting events are included. Certain industries such as security and cleaning are considered high risk by underwriters. In some cases underwriters even refuse to insure the liability of these industries or choose to apply a large deductible in order to minimise the potential compensations. Private individuals also occupy land and engage in potentially dangerous activities. For example, a rotten branch may fall from an old tree and injure a pedestrian, and many people ride bicycles and skateboards in public places. The majority of states require motorists to carry insurance and criminalise those who drive without a valid policy.
out of which to pay compensation should any member incur loss (in other words, a mutual insurance arrangement). The modern system relies on dedicated carriers, usually for-profit, to offer protection against specified perils in consideration of a premium. Liability insurance is designed to offer specific protection against third-party insurance claims, i.e., payment is not typically made to the insured, but rather to someone suffering loss who is not a party to the insurance contract. In general, damage caused intentionally as well as contractual liability are not covered under liability insurance policies. When a claim is made, the insurance carrier has the duty (and right) to defend the insured. The legal costs of a defence normally do not affect policy limits unless the policy expressly states otherwise; this default rule is useful because defence costs tend to soar when cases go to trial.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (20): "activity", "among", "boise", "business", "classified", "college", "compete", "education", "engineering", "health", "idaho", "independent", "million", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in insurance_coverage: "Boise State University". | EXACT TITLE in wedding_events: "Boise State University".
activityamongboisebusinessclassifiedcollegecompeteeducationengineeringhealthidahoindependentmillionprogramprogramspublicreportedresearchuniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise River
Q891080 EXACT TITLE 0.840
QID OVERLAP: Q891080 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (7): "agricultural", "approximately", "boise", "idaho", "river", "southwestern", "western". | EXACT TITLE in insurance_coverage: "Boise River". | EXACT TITLE in wedding_events: "Boise River".
agriculturalapproximatelyboiseidahoriversouthwesternwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Vertical integration
Q1571520 QID OVERLAP 0.800
QID OVERLAP: Q1571520 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (22): "become", "complex", "consolidation", "consumers", "directly", "economy", "final", "firm", "management", "market", "marketplace", "need", "owned", "ownership", "position", "produce", "products", "rather", "related", "river"....
becomecomplexconsolidationconsumersdirectlyeconomyfinalfirmmanagementmarketmarketplaceneedownedownershippositionproduceproductsratherrelatedriversuppliesvertical
ather than buying it from suppliers). Vertical integration can be desirable because it secures supplies needed by the firm to produce its product and the market needed to sell the product, but it can become undesirable when a firm's actions become anti-competitive and impede free competition in an open marketplace. Vertical integration is one method of avoiding the hold-up problem.
Vertical expansion Vertical integration is often closely associated with vertical expansion which, in economics, is the growth of a business enterprise through the acquisition of companies that produce the intermediate goods needed by the business or help market and distribute its product. A firm may desire such expansion to secure the supplies needed by the firm to produce its product and the market needed to sell the product. Such expansion can become undesirable from a system-wide perspective when it becomes anti-competitive and impede free competition in an open marketplace. The result is a more efficient business with lower costs and more profits. On the undesirable side, when vertical expansion leads toward monopolistic control of a product or service then regulative action may be required to rectify anti-competitive behavior. Related to vertical expansion is lateral expansion, which is the growth of a business enterprise through the acquisition of similar firms, in the hope of achieving economies of scale. Vertical expansion is also known as a vertical acquisition. Vertical expansion or acquisitions can also be used to increase sales and to gain market power. The acquisition of DirecTV by News Corporation is an example of forwarding vertical expansion or acquisition. DirecTV is a satellite TV company through which News Corporation can distribute more of its media content: news, movies, and television shows. The acquisition of NBC by Comcast is an example of backward vertical integration. For example, in the United States, protecting the public from communications monopolies that can be built in this way is one of the missions of the Federal Communications Commission. Scholars' findings suggest that a reduction in inefficiencies caused by the market vertical value chains, including downstream prices or double mark-up, can be negated with vertical integration. Application in more complex environments can help firms overcome market failures (markets with high transaction costs or assets specificities). Scholars also identified potential risks and boundaries which may occur under vertical integration. This includes the potential competitor, the enhancements to horizontal collusion, and development of barriers to entry. However, it is still debated over if vertical integration expected efficiencies can lead to competitive harm to the market.
There are many problems and benefits that vertical integration brings to an economic system. Problems that can stem from vertical integration can include large capital investments needed to set up and buy factories and maintain efficient profits. Rapid technology development can increase integration difficulties and further increase costs. The requirement of different business skills venturing into new portions of the supply chain can be challenging for the firm. Another problem that may stem from vertical integration is the collapse of goals among the various firms in a supply chain. With each firm operating under different systems, integration may cause initial problems in management and production. Vertical integration also proves to be dangerous when monopolistic problems arise in a capitalistic economy. When this happens, competition is removed and a corporation has the power to control all firms in its supply chain. Large companies are more likely than smaller companies to employ vertical integration, as they have more resources to manage each stage of production (e.g. major expansion and funding). Vertical integration allows control of production from beginning to end. Vertical integration requires a company to focus not only on its core business, but also on several difficult areas such as sourcing materials and manufacturing partners, distribution, and finally selling the product. One benefit is that the implementation of vertical integration can yield increased profit margins or eliminate the leverage that other firms or buyers may have over the firm. It allows improved coordination between production and distribution firms and decreases the cost of exchange of goods between firms within a supply chain. Operational routines also become more consistent and certain as the management of these firms gradually merge. Vertically integrated firms rarely need to worry about the sufficiency in their supply of materials because they generally control the facilities that provide them. A vertically integrated company also creates high barriers of entry into their respective economy, eliminating most potential competition. Implementing vertical integration can be beneficial in that it reduces the distance that separates the suppliers and customers from the resources or information, which can then boost profits and efficiency. There are internal and external society-wide gains and losses stemming from vertical integration, which vary according to the state of technology in the industries involved, roughly corresponding to the stages of the industry lifecycle. Static technology represents the simplest case, where the gains and losses have been studied extensively.
Mergers and acquisitions
QID OVERLAP 0.800
QID OVERLAP: Q731112 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (38): "acquisition", "activity", "assets", "business", "capital", "certain", "commission", "consolidation", "control", "corporate", "create", "department", "direct", "effects", "entities", "federal", "governed", "government", "law", "legal"....
acquisitionactivityassetsbusinesscapitalcertaincommissionconsolidationcontrolcorporatecreatedepartmentdirecteffectsentitiesfederalgovernedgovernmentlawlegalmanagementmarketoccursoperatingoperationsorganizationownershippositionregulatoryrequire+8
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (15): "according", "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "population", "principal", "second", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeridianmetropolitannampapopulationprincipalseconduniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (19): "availability", "consumer", "consumers", "general", "information", "marketplace", "marketplaces", "multiple", "online", "operator", "primary", "process", "products", "providers", "segment", "single", "site", "transactions", "type".
availabilityconsumerconsumersgeneralinformationmarketplacemarketplacesmultipleonlineoperatorprimaryprocessproductsproviderssegmentsinglesitetransactionstype
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
C
Q22907382 QID OVERLAP 0.800
QID OVERLAP: Q22907382 in insurance_coverage (tier:evergreen) and wedding_events (tier:evergreen). | SHARED TOKENS (28): "automobile", "business", "businesses", "commercial", "damage", "directors", "duties", "general", "generally", "insurance", "insurers", "liability", "line", "market", "medical", "operations", "personal", "policies", "policy", "premises"....
automobilebusinessbusinessescommercialdamagedirectorsdutiesgeneralgenerallyinsuranceinsurersliabilitylinemarketmedicaloperationspersonalpoliciespolicypremisesprofessionalpropertypublicrisksseparatetermstypeunless
pe of insurance, under which it provides coverage for risks unless specifically excluded. Specific risks that are normally excluded from CGL coverage include professional services, pollution, liquor, automobile liability, and directors and officers liability, with separate insurance policies being available to cover these situations. A wide variety of other coverage exclusions, extensions, limitations, and other policy terms and conditions may be included by endorsements to a CGL policy.
Commercial general liability insurance is a broad type of insurance policy that provides liability insurance for general business risks. In the United States insurance market, this is known as Commercial General Liability (CGL). It is the first line of coverage that a business typically purchases, and it covers many of the common risks that most types of businesses may incur, such as bodily injury or property damage that occur on the business premises or due to the business operations, personal and advertising injury, and medical payments. As with other types of liability insurance, CGL insurance normally imposes on issuing insurers duties both to defend and to indemnify insureds with respect to covered claims. CGL insurance is generally categorized as an "all-risks" type of insurance, under which it provides coverage for risks unless specifically excluded. Specific risks that are normally excluded from CGL coverage include professional services, pollution, liquor, automobile liability, and directors and officers liability, with separate insurance policies being available to cover these situations. A wide variety of other coverage exclusions, extensions, limitations, and other policy terms and conditions may be included by endorsements to a CGL policy.
first line of coverage that a business typically purchases, and it covers many of the common risks that most types of businesses may incur, such as bodily injury or property damage that occur on the business premises or due to the business operations, personal and advertising injury, and medical payments. As with other types of liability insurance, CGL insurance normally imposes on issuing insurers duties both to defend and to indemnify insureds with respect to covered claims. CGL insurance is generally categorized as an "all-risks" type of insurance, under which it provides coverage for risks unless specifically excluded. Specific risks that are normally excluded from CGL coverage include professional services, pollution, liquor, automobile liability, and directors and officers liability, with separate insurance policies being available to cover these situations. A wide variety of other coverage exclusions, extensions, limitations, and other policy terms and conditions may be included by endorsements to a CGL policy.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (26): "business", "capital", "category", "changes", "control", "development", "finance", "financial", "financing", "firm", "firms", "fund", "general", "investment", "limited", "management", "operational", "ownership", "private", "products"....
businesscapitalcategorychangescontroldevelopmentfinancefinancialfinancingfirmfirmsfundgeneralinvestmentlimitedmanagementoperationalownershipprivateproductspublicratherrolespecializedstrategiesworking
l restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
Strategies The strategies private-equity firms may use are as follows, leveraged buyout being the most common. Leveraged buyout Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
C
Q5196473 QID OVERLAP 0.760
QID OVERLAP: Q5196473 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (13): "consumers", "customer", "dedicated", "evaluation", "experience", "form", "online", "products", "professional", "purchasing", "review", "reviews", "sites".
consumerscustomerdedicatedevaluationexperienceformonlineproductsprofessionalpurchasingreviewreviewssites
, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines.
A customer review is an evaluation of a product or service made by someone who has purchased and used, or had experience with, a product or service. Customer reviews are a form of customer feedback on electronic commerce and online shopping sites. There are also dedicated review sites, some of which use customer reviews as well as or instead of professional reviews. The reviews may themselves be graded for usefulness or accuracy by other users.
or accuracy by other users. Customer reviews are widely used by consumers to make informed purchasing decisions and compare products and services online. History Before the arrival of the internet, customers could review products and services through customer comment boxes and customer service helplines. These methods still exist today although internet review sites are used more in recent years. Reliability The reliability of customer reviews has been questioned. Abuses akin to ballot stuffing of favourable reviews by the seller (known as incentivized reviews), or negative reviews by competitors, need to be policed by the review host site. Indeed, gathering fake reviews has become big business. In 2012, for example, fake book reviews have been revealed as significantly affecting ratings on Amazon. In 2016 Amazon banned the practice of reviewing complimentary products, researchers have shown that the process still continued as of 2021, but without any disclosures. Since few sites restrict users to reviewing only items they have actually purchased, it is difficult to know if a customer is real, has actually used the product they are reviewing, and is giving honest, unbiased feedback about the product or services being reviewed. Tools like Fakespot and ReviewMeta can help spot fake reviews on shopping sites like Amazon. Unfortunately, the tools do not work on most other websites that show customer reviews. Public calls have been growing stronger, demanding that review sites be held accountable for publishing fake reviews. Most recently (June 2021), the Competition and Markets Authority (CMA) in the United Kingdom has launched an investigation into whether Amazon and Google are doing enough to prevent fake reviews from being published on their sites. Both businesses claim to have sufficient resources and policies in place to prevent fake reviews from being published. Legal steps could be taken against the giants if CMA determines those claims to be false.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (13): "ada", "boise", "capital", "home", "idaho", "local", "metropolitan", "population", "private", "roads", "second", "southwestern", "streets".
adaboisecapitalhomeidaholocalmetropolitanpopulationprivateroadssecondsouthwesternstreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Recorder of deeds
Q2630069 QID OVERLAP 0.720
QID OVERLAP: Q2630069 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (11): "documents", "estate", "government", "maintains", "office", "ownership", "position", "property", "public", "real", "records".
documentsestategovernmentmaintainsofficeownershippositionpropertypublicrealrecords
Recorder of deeds or deeds registry is a government office tasked with maintaining public records and documents, especially records relating to real estate ownership that provide persons other than the owner of a property with real rights over that property. Background The offices with similar duties (varying by jurisdiction) include registrar general, register of deeds, registrar of deeds, registrar of titles. The office of such an official may be referred to as the deeds registry or deeds office. In the United States, the recorder of deeds is often an elected county office and is called the county recorder. In some U.S. states, the functions of a recorder of deeds are a responsibility of the county clerk (or the county's clerk of court), and the official may be called a clerk-recorder or recorder-clerk. The recorder of deeds provides a single location in which records of real property rights are recorded and may be researched by interested parties. The record of deeds often maintains documents regularly recorded by the recorder of deeds, including deeds, mortgages, mechanic's liens, releases and plats, among others. To allow full access to deeds recorded throughout the office history, several indexes may be maintained, which include grantor–grantee indexes, tract indexes, and plat maps. Storage methods to record registry entries include paper, microform, and computer. The principles of statutory, case, and common law are given effect by the recorder of deeds, insofar as it relates to vested ownership in land and other real rights. Because estate in land can be held in so many complex ways, a single deeds registry provides some clarity, even though it cannot "guarantee" those real property rights. The legal certainty provided by a title deed issued under the registration of the recorder of deeds is of great significance to all parties who hold, or wish to acquire rights in real property. Certainty of title is the basis for the investment of massive amounts of money in real estate development for residential, commercial, industrial and agricultural use each year. This is why the meticulous recording of registration information by the recorder of deeds is so important. Each document recorded against title to real estate can be examined and the portion of the bundle of rights that it includes can be determined.
The offices with similar duties (varying by jurisdiction) include registrar general, register of deeds, registrar of deeds, registrar of titles. The office of such an official may be referred to as the deeds registry or deeds office. In the United States, the recorder of deeds is often an elected county office and is called the county recorder. In some U.S. states, the functions of a recorder of deeds are a responsibility of the county clerk (or the county's clerk of court), and the official may be called a clerk-recorder or recorder-clerk. The recorder of deeds provides a single location in which records of real property rights are recorded and may be researched by interested parties. The record of deeds often maintains documents regularly recorded by the recorder of deeds, including deeds, mortgages, mechanic's liens, releases and plats, among others. To allow full access to deeds recorded throughout the office history, several indexes may be maintained, which include grantor–grantee indexes, tract indexes, and plat maps. Storage methods to record registry entries include paper, microform, and computer. The principles of statutory, case, and common law are given effect by the recorder of deeds, insofar as it relates to vested ownership in land and other real rights. Because estate in land can be held in so many complex ways, a single deeds registry provides some clarity, even though it cannot "guarantee" those real property rights. The legal certainty provided by a title deed issued under the registration of the recorder of deeds is of great significance to all parties who hold, or wish to acquire rights in real property. Certainty of title is the basis for the investment of massive amounts of money in real estate development for residential, commercial, industrial and agricultural use each year. This is why the meticulous recording of registration information by the recorder of deeds is so important. Each document recorded against title to real estate can be examined and the portion of the bundle of rights that it includes can be determined.
United States: Recorders of Deeds In the U.S., most recorders of deeds are elected officials who serve the area of a county or equivalent jurisdiction. In some states, the recorder of deeds may also act as a public posting place for documents that are not directly related to estates in land, such as corporate charters, military discharges, Uniform Commercial Code records, applications for marriage licenses, and judgments. Deeds in a few states of the U.S. are maintained under the Torrens title system or some limited implementation of it. (For example: Minnesota, some property in Massachusetts, Colorado, Hawaii, New York, North Carolina, Ohio, and Washington.) Other U.S. states maintain their deeds under the common law system of record title.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "meridian", "population", "second".
adaamongboisecapitalcitiesidahomeridianpopulationsecond
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidahometropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
QID OVERLAP 0.660
QID OVERLAP: Q1515177 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.640
QID OVERLAP: Q486078 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (7): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahometropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
P
Q16023913 QID OVERLAP 0.600
QID OVERLAP: Q16023913 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (5): "educational", "perform", "professional", "public", "trade".
educationalperformprofessionalpublictrade
ly certification or qualification, is a designation earned by a person to assure qualification to perform a job or task. Not all certifications that use post-nominal letters are an acknowledgement of educational achievement, or an agency appointed to safeguard the public interest. Overview A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
A certification is a third-party attestation of an individual's level of knowledge or proficiency in a certain industry or profession. They are granted by authorities in the field, such as professional societies and colleges, or by private certificate-granting agencies. Most certifications are time-limited; some expire after a period of time (e.g., the lifetime of a product that requires certification for use), while others can be renewed indefinitely as long as certain requirements are met. Renewal usually requires ongoing education to remain up-to-date on advancements in the field, evidenced by earning the specified number of continuing education credits (CECs), or continuing education units (CEUs), from approved professional development courses. Certification is different from occupational licensing. In the United States, licenses are typically issued by state agencies, whereas certifications are usually awarded by professional societies or educational institutes. Obtaining a certificate is voluntary in some fields, but in others, certification from a government-accredited agency may be legally required to perform certain jobs or tasks. In other countries, licenses are typically granted by professional societies or universities and require a certificate after about three to five years and so on thereafter. The assessment process for certification may be more comprehensive than that of licensure, though sometimes the assessment process is very similar or even the same, despite differing in terms of legal status. According to The Guide to National Professional Certification Programs (1997) by Phillip Barnhart, "certifications are portable, since they do not depend on one company's definition of a certain job" and they provide potential employers with "an impartial, third-party endorsement of an individual's professional knowledge and experience". Many certification programs are affiliated with professional associations, trade organizations, or private vendors interested in raising industry standards. Certification programs are often created or endorsed by professional associations, but are typically completely independent from membership organizations.
Delivering an assessment based on industry knowledge that is independent from training courses or course providers Granting a time-limited credential to anyone who meets the assessment standards The Institute for Credentialing Excellence (ICE) is a U.S.-based organization that sets standards for the accreditation of personnel certification and certificate programs based on the Standards for Educational and Psychological Testing, a joint publication of the American Educational Research Association (AERA), the American Psychological Association (APA), and the National Council on Measurement in Education (NCME).
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in insurance_coverage (tier:branch) and wedding_events (tier:branch). | SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
adaboiseeagleidahopopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
293 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP293 edges
🌲 EVERGREEN2 edges
0.650
administrationagainstavailabilitybuildingscommunitiesconsumerscontrolcostcostsdamagedecemberdevelopmentemergencyenforcementexistingfederalfloodgenerallygovernmentinsurance
SHARED TOKENS (38): "administration", "against", "availability", "buildings", "communities", "consumers", "control", "cost", "costs", "damage", "december", "development", "emergency", "enforcement", "existing", "federal", "flood", "generally", "government", "insurance".... | URL->A (1): http://www.floodsmart.gov/. | EXACT TITLE in insurance_coverage: "National Flood Insurance Program".
0.610
administrativecommissioncompensationdepartmentestablishedidahoinsuranceissuedlaborlegislaturesystemunemploymentworkers
SHARED TOKENS (13): "administrative", "commission", "compensation", "department", "established", "idaho", "insurance", "issued", "labor", "legislature", "system", "unemployment", "workers". | URL->A (1): https://iic.idaho.gov/. | EXACT TITLE in insurance_coverage: "Idaho Industrial Commission".
🌿 BRANCH209 edges
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedboisecapitalcontainseconomygeographicidahoisolatedlandmillionnationalnorthofficialpartypopulationpriorproducts
SHARED TOKENS (28): "agricultural", "agriculture", "approximately", "associated", "boise", "capital", "contains", "economy", "geographic", "idaho", "isolated", "land", "million", "national", "north", "official", "party", "population", "prior", "products".... | EXACT TITLE in insurance_coverage: "Idaho". | EXACT TITLE in wedding_events: "Idaho".
0.500
agenciesappropriateassetsauthoritiesauthoritybusinessescommonlydamagedepartmentsdirectlyeligibilityemergencyequipmentexperiencegenerallygovernedgovernmenthazardshousingindividual
SHARED TOKENS (40): "agencies", "appropriate", "assets", "authorities", "authority", "businesses", "commonly", "damage", "departments", "directly", "eligibility", "emergency", "equipment", "experience", "generally", "governed", "government", "hazards", "housing", "individual".... | EXACT TITLE in wedding_events: "Security guard".
0.500
Kitchen ↗ Q43164 EXACT TITLE
accordingcommercialcompletedesigneducationalequipmentfacilitiesfoundfunctionsgenerallyhealthlargerlawmarketmodernpublicrelatedrequirementssmallspace
SHARED TOKENS (22): "according", "commercial", "complete", "design", "educational", "equipment", "facilities", "found", "functions", "generally", "health", "larger", "law", "market", "modern", "public", "related", "requirements", "small", "space".... | EXACT TITLE in wedding_events: "Kitchen".
0.500
accordingassociationbecomebureaubusinessbusinessescodeconsumerscustomerevenindustrylocalmarketingmarketplacemissionnorthoperatingorganizationpolicypractices
SHARED TOKENS (27): "according", "association", "become", "bureau", "business", "businesses", "code", "consumers", "customer", "even", "industry", "local", "marketing", "marketplace", "mission", "north", "operating", "organization", "policy", "practices".... | EXACT TITLE in insurance_coverage: "Better Business Bureau".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addchangeclassifiedcreatecreatesdependdirecteconomiceffectsequipmenteventfiregrowthhealthhumanlandland-uselevelmanagementmaterial
SHARED TOKENS (28): "add", "change", "classified", "create", "creates", "depend", "direct", "economic", "effects", "equipment", "event", "fire", "growth", "health", "human", "land", "land-use", "level", "management", "material".... | EXACT TITLE in insurance_coverage: "Wildfire". | EXACT TITLE in wedding_events: "Wildfire".
0.500
applicationbrandbuildingbusinessclientcorporatedesigndevelopmentemergencyeventeventsformalfrequentlyidentifyingindustryknowledgemanagementmarketmarketingnegotiation
SHARED TOKENS (34): "application", "brand", "building", "business", "client", "corporate", "design", "development", "emergency", "event", "events", "formal", "frequently", "identifying", "industry", "knowledge", "management", "market", "marketing", "negotiation".... | EXACT TITLE in wedding_events: "Event management".
0.500
Food safety ↗ Q909821 EXACT TITLE
cannotconsumerconsumerscreatesdeliverydescribingdisciplineenforcementgrowthhazardshealthindustrylinemanagementmarketmillionorganizationphysicalpoliciespractices
SHARED TOKENS (24): "cannot", "consumer", "consumers", "creates", "delivery", "describing", "discipline", "enforcement", "growth", "hazards", "health", "industry", "line", "management", "market", "million", "organization", "physical", "policies", "practices".... | EXACT TITLE in wedding_events: "Food safety".
0.500
addedadditionalapplybeyondbusinesscapacitycategoriesconductdescriptiondirectorsextendgeneralgenerallyidentifiesinsuranceliabilitymeansoperationsorganizationoriginal
SHARED TOKENS (33): "added", "additional", "apply", "beyond", "business", "capacity", "categories", "conduct", "description", "directors", "extend", "general", "generally", "identifies", "insurance", "liability", "means", "operations", "organization", "original".... | EXACT TITLE in insurance_coverage: "Additional insured".
0.500
Commissary ↗ Q5152616 EXACT TITLE
administrativeassociatedbuildingdeliveryequivalentfinancialgovernmentnationalofficeofficialorganizationstandardsuppliestermstitleuses
SHARED TOKENS (16): "administrative", "associated", "building", "delivery", "equivalent", "financial", "government", "national", "office", "official", "organization", "standard", "supplies", "terms", "title", "uses". | EXACT TITLE in wedding_events: "Commissary".
0.500
Ballroom ↗ Q805353 EXACT TITLE
annualbuildingbuildingsbusinessescourtseventeventsformalgenerallyhelphistoryholdinglaterlevelmodernpartyprimaryprivatepublicsometimes
SHARED TOKENS (23): "annual", "building", "buildings", "businesses", "courts", "event", "events", "formal", "generally", "help", "history", "holding", "later", "level", "modern", "party", "primary", "private", "public", "sometimes".... | EXACT TITLE in wedding_events: "Ballroom".
0.500
applicableappliedassociationauthoritychangechangescitiescommunitiescomprehensivecostsdependdependsdesigndevelopmenteconomicexposurefacilitieshealthhumanjurisdictions
SHARED TOKENS (38): "applicable", "applied", "association", "authority", "change", "changes", "cities", "communities", "comprehensive", "costs", "depend", "depends", "design", "development", "economic", "exposure", "facilities", "health", "human", "jurisdictions".... | EXACT TITLE in insurance_coverage: "Land-use planning".
0.500
businessescategorycertaincreateeconomichumanindividualinformationlandlawlegallimitedmodernoriginalownershipperiodplacepriceprimaryproperty
SHARED TOKENS (24): "businesses", "category", "certain", "create", "economic", "human", "individual", "information", "land", "law", "legal", "limited", "modern", "original", "ownership", "period", "place", "price", "primary", "property".... | EXACT TITLE in wedding_events: "Intellectual property".
0.500
appropriatebeyondcomplianceevidenceformformsgroupidentifiedinfluenceinformationmarketingneedoutsideprivateproofpublicpubliclysalestermsthem
SHARED TOKENS (21): "appropriate", "beyond", "compliance", "evidence", "form", "forms", "group", "identified", "influence", "information", "marketing", "need", "outside", "private", "proof", "public", "publicly", "sales", "terms", "them".... | EXACT TITLE in wedding_events: "Social influence".
0.500
agreementsassociatedcontractcontractscontractualcourtsdeliverydeterminesevidencefinalformformsfoundgenerallyinsuranceinsurerlegallypoliciespolicypremium
SHARED TOKENS (25): "agreements", "associated", "contract", "contracts", "contractual", "courts", "delivery", "determines", "evidence", "final", "form", "forms", "found", "generally", "insurance", "insurer", "legally", "policies", "policy", "premium".... | EXACT TITLE in insurance_coverage: "Insurance policy".
0.500
Deed ↗ Q705914 EXACT TITLE
associatedcommonlyconcerningcontractdeliverydocumentjurisdictionslawlegalliabilitylicensesmodernownershippartyperiodpracticepropertyspecialtytitletype
SHARED TOKENS (20): "associated", "commonly", "concerning", "contract", "delivery", "document", "jurisdictions", "law", "legal", "liability", "licenses", "modern", "ownership", "party", "period", "practice", "property", "specialty", "title", "type". | EXACT TITLE in insurance_coverage: "Deed".
0.500
additionaladvantagecannotchangescostsdeliveryeducationeligibilityestimatesexistingexpandedfederalfoundhealthincreasesindividualinsuranceinsurersintendedlaw
SHARED TOKENS (43): "additional", "advantage", "cannot", "changes", "costs", "delivery", "education", "eligibility", "estimates", "existing", "expanded", "federal", "found", "health", "increases", "individual", "insurance", "insurers", "intended", "law".... | EXACT TITLE in insurance_coverage: "Affordable Care Act".
0.500
assetsbroaderbuildingscapitalcategorydirectlyeconomicemploymentfacilitiesgovernmenthealthinfrastructuremunicipaloperatorphysicalprivateprotectionpublicroadsschools
SHARED TOKENS (23): "assets", "broader", "buildings", "capital", "category", "directly", "economic", "employment", "facilities", "government", "health", "infrastructure", "municipal", "operator", "physical", "private", "protection", "public", "roads", "schools".... | EXACT TITLE in insurance_coverage: "Public works".
0.500
Marketing ↗ Q39809 EXACT TITLE
agriculturalassociationbusinessbusinessesconcerningconsumerscontracteddedicateddirectlyfirmsgovernmentindustrymanagementmarketmarketingmediaplanningpriceprimaryprocess
SHARED TOKENS (29): "agricultural", "association", "business", "businesses", "concerning", "consumers", "contracted", "dedicated", "directly", "firms", "government", "industry", "management", "market", "marketing", "media", "planning", "price", "primary", "process".... | EXACT TITLE in insurance_coverage: "Marketing". | EXACT TITLE in wedding_events: "Marketing".
0.500
Rodeo ↗ Q207703 EXACT TITLE
associationcategoriescertaindecemberequipmenteventeventsfederalgenerallygovernedindustrylaterlivestocklocalmodernnationalnorthofficialorganizationpractices
SHARED TOKENS (30): "association", "categories", "certain", "december", "equipment", "event", "events", "federal", "generally", "governed", "industry", "later", "livestock", "local", "modern", "national", "north", "official", "organization", "practices".... | EXACT TITLE in wedding_events: "Rodeo".
0.500
Internship ↗ Q6500754 EXACT TITLE
agenciesallowingalreadybusinessescollegecurrentdetermineemployersemploymenteventexperiencegovernmentindustryinvestmentlimitedmedicalnetworkorganizationpaidperiod
SHARED TOKENS (37): "agencies", "allowing", "already", "businesses", "college", "current", "determine", "employers", "employment", "event", "experience", "government", "industry", "investment", "limited", "medical", "network", "organization", "paid", "period".... | EXACT TITLE in wedding_events: "Internship".
0.500
boardsbusinesscompensationconsumerconsumerscreatescustomereconomicevidenceformfrequentlygeneralgovernmentgrowthhealthindividualinspectionslawleastlicense
SHARED TOKENS (45): "boards", "business", "compensation", "consumer", "consumers", "creates", "customer", "economic", "evidence", "form", "frequently", "general", "government", "growth", "health", "individual", "inspections", "law", "least", "license".... | EXACT TITLE in wedding_events: "Occupational licensing".
0.500
Convention ↗ Q225862 EXACT TITLE
boardcertainconductformalgrouphumanindustrylawlegallinemediaofficepractitionerspropertystandardtrade
SHARED TOKENS (16): "board", "certain", "conduct", "formal", "group", "human", "industry", "law", "legal", "line", "media", "office", "practitioners", "property", "standard", "trade". | EXACT TITLE in insurance_coverage: "Convention". | EXACT TITLE in wedding_events: "Convention".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationchangesconsolidationcontroldirectlydistributioneffectsformgrowthhelpirrigationlandlandscapelivestockmaintainmanagementnetworkoccurs
SHARED TOKENS (35): "agricultural", "agriculture", "application", "changes", "consolidation", "control", "directly", "distribution", "effects", "form", "growth", "help", "irrigation", "land", "landscape", "livestock", "maintain", "management", "network", "occurs".... | EXACT TITLE in insurance_coverage: "Irrigation". | EXACT TITLE in wedding_events: "Irrigation".
0.500
Outsourcing ↗ Q61515 EXACT TITLE
assetsbusinesscentercontractingcontroleconomicevenfirmfunctionslaterlegallimitedmanagementoperationalorganizationoutsidepracticepresenceprivateprocess
SHARED TOKENS (29): "assets", "business", "center", "contracting", "control", "economic", "even", "firm", "functions", "later", "legal", "limited", "management", "operational", "organization", "outside", "practice", "presence", "private", "process".... | EXACT TITLE in wedding_events: "Outsourcing".
0.500
Weather ↗ Q11663 EXACT TITLE
activitiesaffectagricultureapplicationchangechangescontroldistributioneffectsevidencegenerallyhistoryhumanindustrylayerleastlimitedmeanplacereceived
SHARED TOKENS (27): "activities", "affect", "agriculture", "application", "change", "changes", "control", "distribution", "effects", "evidence", "generally", "history", "human", "industry", "layer", "least", "limited", "mean", "place", "received".... | EXACT TITLE in insurance_coverage: "Weather". | EXACT TITLE in wedding_events: "Weather".
0.500
amongapproximatelyboisecampusclassifiedcompeteestablishedidaholaterofficesoperatesprofessionalpublicrepresentedresearchschoolsstatewidestudentsuniversity
SHARED TOKENS (19): "among", "approximately", "boise", "campus", "classified", "compete", "established", "idaho", "later", "offices", "operates", "professional", "public", "represented", "research", "schools", "statewide", "students", "university". | EXACT TITLE in wedding_events: "University of Idaho".
0.500
Photography ↗ Q11633 EXACT TITLE
applicationbasebusinesscreatedigitaldirectexposureformlatermaterialmeansoperatespracticeproducerealrecordingreflectedstudentsusesvisible
SHARED TOKENS (20): "application", "base", "business", "create", "digital", "direct", "exposure", "form", "later", "material", "means", "operates", "practice", "produce", "real", "recording", "reflected", "students", "uses", "visible". | EXACT TITLE in wedding_events: "Photography".
0.500
alreadybuildingbuildingscodescommonlyconductdepartmenteventfirehazardsincreasesinspectionsintendedoccurspracticesschoolsstructures
SHARED TOKENS (17): "already", "building", "buildings", "codes", "commonly", "conduct", "department", "event", "fire", "hazards", "increases", "inspections", "intended", "occurs", "practices", "schools", "structures". | EXACT TITLE in wedding_events: "Fire safety".
0.500
Catering ↗ Q777754 EXACT TITLE
businesscommercialeventfull-servicegenerallygroupindividualmanagementmodelpracticesprivateriskservedservesservingstaff
SHARED TOKENS (16): "business", "commercial", "event", "full-service", "generally", "group", "individual", "management", "model", "practices", "private", "risk", "served", "serves", "serving", "staff". | EXACT TITLE in wedding_events: "Catering".
0.500
administrationboardcompensationcouncildatadepartmentdeterminedirectorsexperiencehelpinformationinsuranceinsurerslabornationaloperatesorganizationratingreportedsupports
SHARED TOKENS (22): "administration", "board", "compensation", "council", "data", "department", "determine", "directors", "experience", "help", "information", "insurance", "insurers", "labor", "national", "operates", "organization", "rating", "reported", "supports".... | EXACT TITLE in insurance_coverage: "National Council on Compensation Insurance".
0.500
Waste management ↗ EXACT TITLE
accordingactivitiesactivityadditionalapproximatelychangecitiescommercialeconomiceffectsexistingfinalhealthhumaninvolvingleastmanagementmaterialmunicipalpolicies
SHARED TOKENS (34): "according", "activities", "activity", "additional", "approximately", "change", "cities", "commercial", "economic", "effects", "existing", "final", "health", "human", "involving", "least", "management", "material", "municipal", "policies".... | EXACT TITLE in wedding_events: "Waste management".
0.500
accordingamongapplyauditcertainclassifiedcomprehensivecontrolcorporatedatadefinitionsdesigndevelopmentengineeringestimatesevaluationeveneventsfinancefinancial
SHARED TOKENS (44): "according", "among", "apply", "audit", "certain", "classified", "comprehensive", "control", "corporate", "data", "definitions", "design", "development", "engineering", "estimates", "evaluation", "even", "events", "finance", "financial".... | EXACT TITLE in insurance_coverage: "Risk management".
0.500
Park ↗ Q22698 EXACT TITLE
activitiesagainstagenciesbuildingscitiesgovernmenthumanhundredslandlawnationalpermitprotectionrulesshowsskillspacestructureswater
SHARED TOKENS (19): "activities", "against", "agencies", "buildings", "cities", "government", "human", "hundreds", "land", "law", "national", "permit", "protection", "rules", "shows", "skill", "space", "structures", "water". | EXACT TITLE in insurance_coverage: "Park". | EXACT TITLE in wedding_events: "Park".
0.500
accordingamongassociationbusinesscontractcostscoveringevidenceexpensesfinancegovernmenthealthindividualinsuranceinsurermandatorymedicalnationalorganizationplans
SHARED TOKENS (31): "according", "among", "association", "business", "contract", "costs", "covering", "evidence", "expenses", "finance", "government", "health", "individual", "insurance", "insurer", "mandatory", "medical", "national", "organization", "plans".... | EXACT TITLE in insurance_coverage: "Health insurance".
0.500
Zoning ↗ Q702232 EXACT TITLE
activitiesallowingbuildingbuildingscertaindeterminedevelopmentformgovernmentgrowthguidelandland-uselocalmunicipalityplanningpolicypropertyregulationsregulatory
SHARED TOKENS (26): "activities", "allowing", "building", "buildings", "certain", "determine", "development", "form", "government", "growth", "guide", "land", "land-use", "local", "municipality", "planning", "policy", "property", "regulations", "regulatory".... | EXACT TITLE in insurance_coverage: "Zoning". | EXACT TITLE in wedding_events: "Zoning".
0.500
Floristry ↗ Q637125 EXACT TITLE
arrangementsbusinessconsumerscorporatecreatedeliverydesigndistributioneventeventsgenerallygeographicindustryknowledgelevelmarketmaterialonlineproductsprofessionals
SHARED TOKENS (30): "arrangements", "business", "consumers", "corporate", "create", "delivery", "design", "distribution", "event", "events", "generally", "geographic", "industry", "knowledge", "level", "market", "material", "online", "products", "professionals".... | EXACT TITLE in wedding_events: "Floristry".
0.500
applicationarisebecomeclientcompletecourseequipmentfilingidentifyingleastlicensedlistoccupationperformplaceproductsprofessionaltrainingtreatmentwhose
SHARED TOKENS (21): "application", "arise", "become", "client", "complete", "course", "equipment", "filing", "identifying", "least", "licensed", "list", "occupation", "perform", "place", "products", "professional", "training", "treatment", "whose".... | EXACT TITLE in wedding_events: "Nail technician".
0.500
Tourism ↗ Q49389 EXACT TITLE
activitybeyondbusinesscommercialcommunitiesdefinesdevelopmenteconomiceffectsgenerallygrowthlimitedlocalmarketsorganizationoutsidepracticesprogramsrealsecond
SHARED TOKENS (23): "activity", "beyond", "business", "commercial", "communities", "defines", "development", "economic", "effects", "generally", "growth", "limited", "local", "markets", "organization", "outside", "practices", "programs", "real", "second".... | EXACT TITLE in wedding_events: "Tourism".
0.500
activitiesaddedapplybusinesschangeclientcompletecontractorsdevelopmentdocumentationestablishedinfluenceinformationmanagementoperationspracticeprimaryprocessproduceproducts
SHARED TOKENS (26): "activities", "added", "apply", "business", "change", "client", "complete", "contractors", "development", "documentation", "established", "influence", "information", "management", "operations", "practice", "primary", "process", "produce", "products".... | EXACT TITLE in wedding_events: "Project management".
0.500
Accounting ↗ Q4116214 EXACT TITLE
accountingactivitiesanalysisboardbusinessbusinessescostcouncileconomicentitiesfinancialfirmsformsfunctionsgenerallyhistoryhumaninformationmajormanagement
SHARED TOKENS (38): "accounting", "activities", "analysis", "board", "business", "businesses", "cost", "council", "economic", "entities", "financial", "firms", "forms", "functions", "generally", "history", "human", "information", "major", "management".... | EXACT TITLE in insurance_coverage: "Accounting". | EXACT TITLE in wedding_events: "Accounting".
0.500
Trade show ↗ Q57305 EXACT TITLE
activitiesappropriateclassifiedconsumercontinuingestablishedeventeventsfinalgeneralhelpindustrymarketmarketsonlineorganizersproductsprofessionalspublicshows
SHARED TOKENS (23): "activities", "appropriate", "classified", "consumer", "continuing", "established", "event", "events", "final", "general", "help", "industry", "market", "markets", "online", "organizers", "products", "professionals", "public", "shows".... | EXACT TITLE in wedding_events: "Trade show".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessannualassetsaveragebecomecertaincostcostseconomiceligibilityestablishedexpandedfamiliesfederalfinancialgeneralgovernmenthealthhomeinsurance
SHARED TOKENS (46): "access", "annual", "assets", "average", "become", "certain", "cost", "costs", "economic", "eligibility", "established", "expanded", "families", "federal", "financial", "general", "government", "health", "home", "insurance".... | EXACT TITLE in insurance_coverage: "Medicaid".
0.500
advantagedeliverydirectlyexpenseshealthinsurancelabormedicaloperatororiginalplanplanspriorprivateproviderssecuritysystemstype
SHARED TOKENS (18): "advantage", "delivery", "directly", "expenses", "health", "insurance", "labor", "medical", "operator", "original", "plan", "plans", "prior", "private", "providers", "security", "systems", "type". | EXACT TITLE in insurance_coverage: "Medicare Advantage".
0.500
accountbeyondbusinesscertainchangesdatademandeconomiceconomyemploymentextendsgenerallyhelpincreasesinventoryleastmarketneedperformanceperiod
SHARED TOKENS (33): "account", "beyond", "business", "certain", "changes", "data", "demand", "economic", "economy", "employment", "extends", "generally", "help", "increases", "inventory", "least", "market", "need", "performance", "period".... | EXACT TITLE in wedding_events: "Seasonality".
0.500
Title insurance ↗ EXACT TITLE
againstbusinesscommercialcommonlycostsestateevidencefinancialfireformfoundgeneralgenerallyindependentinstitutionalinsuranceinsurerinsurerslandlaw
SHARED TOKENS (39): "against", "business", "commercial", "commonly", "costs", "estate", "evidence", "financial", "fire", "form", "found", "general", "generally", "independent", "institutional", "insurance", "insurer", "insurers", "land", "law".... | EXACT TITLE in insurance_coverage: "Title insurance".
0.500
Logistics ↗ Q177777 EXACT TITLE
accordingcostsdedicatedequipmentinformationmanagementmaterialmodeloperationalphysicalplanningproductsprofessionalpublicrelatedresourcessoftwaretransportationworking
SHARED TOKENS (19): "according", "costs", "dedicated", "equipment", "information", "management", "material", "model", "operational", "physical", "planning", "products", "professional", "public", "related", "resources", "software", "transportation", "working". | EXACT TITLE in wedding_events: "Logistics".
0.500
Hotel ↗ Q27686 EXACT TITLE
accessadditionaladministrativeboardbusinesscentercostcourtsdepartmentdepartmentsdirecteconomyequipmenteventfacilitiesformfull-servicegeneralhospitalityindependent
SHARED TOKENS (47): "access", "additional", "administrative", "board", "business", "center", "cost", "courts", "department", "departments", "direct", "economy", "equipment", "event", "facilities", "form", "full-service", "general", "hospitality", "independent".... | EXACT TITLE in wedding_events: "Hotel".
0.500
againstdirectlyencounterevengenerallyguideindividualinfluenceinformationlimitednetworkoutsidepositionprocessproofsecondspacesupporttechnology
SHARED TOKENS (19): "against", "directly", "encounter", "even", "generally", "guide", "individual", "influence", "information", "limited", "network", "outside", "position", "process", "proof", "second", "space", "support", "technology". | EXACT TITLE in wedding_events: "Information cascade".
0.500
Snake River ↗ Q272074 EXACT TITLE
activitiesagenciescanyonchannelcommercialcontrolfloodhistoryhostedhumanidahoirrigationlimitedmajornationalnorthpolicyprivateprogramspublic
SHARED TOKENS (27): "activities", "agencies", "canyon", "channel", "commercial", "control", "flood", "history", "hosted", "human", "idaho", "irrigation", "limited", "major", "national", "north", "policy", "private", "programs", "public".... | EXACT TITLE in wedding_events: "Snake River".
0.500
Contract ↗ Q93288 EXACT TITLE
activitiesagreementsapplybusinesscategorycertaincodecommercialcontractcontractingcontractscontractualdatedocumentdutiesenforcementestablishingeventgeneralgenerally
SHARED TOKENS (41): "activities", "agreements", "apply", "business", "category", "certain", "code", "commercial", "contract", "contracting", "contracts", "contractual", "date", "document", "duties", "enforcement", "establishing", "event", "general", "generally".... | EXACT TITLE in insurance_coverage: "Contract". | EXACT TITLE in wedding_events: "Contract".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
arrangementsbuildingbusinessbusinessescapitalcommercialconvertsdemanddirectlyestateeventexistingfinancialformhomeinvestmentjurisdictionslawlegalmarkets
SHARED TOKENS (32): "arrangements", "building", "business", "businesses", "capital", "commercial", "converts", "demand", "directly", "estate", "event", "existing", "financial", "form", "home", "investment", "jurisdictions", "law", "legal", "markets".... | EXACT TITLE in insurance_coverage: "Mortgage".
0.500
Festival ↗ Q132241 EXACT TITLE
agricultureamongassociatedcommunitiesconnectioneventexperiencefamilieslocalmeansnationalplacepracticesharingsource
SHARED TOKENS (15): "agriculture", "among", "associated", "communities", "connection", "event", "experience", "families", "local", "means", "national", "place", "practice", "sharing", "source". | EXACT TITLE in wedding_events: "Festival".
0.500
againstdamageeventsfirefloodformshomeinsurancepoliciespolicypropertyprotectionrequirerisksspecialized
SHARED TOKENS (15): "against", "damage", "events", "fire", "flood", "forms", "home", "insurance", "policies", "policy", "property", "protection", "require", "risks", "specialized". | EXACT TITLE in insurance_coverage: "Property insurance".
0.500
administersagriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyfederalgovernmentlivestocknationalprogramprogramsreportsresourcesservedtrade
SHARED TOKENS (19): "administers", "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "federal", "government", "livestock", "national", "program", "programs", "reports", "resources", "served", "trade". | EXACT TITLE in insurance_coverage: "United States Department of Agriculture".
0.500
accessaddadvantageappropriateapproximatelyassociationautomobileaveragebusinessbusinesseschangechannelcommercialcommissioncompensationcontractcontractorscontroldamagedirect
SHARED TOKENS (68): "access", "add", "advantage", "appropriate", "approximately", "association", "automobile", "average", "business", "businesses", "change", "channel", "commercial", "commission", "compensation", "contract", "contractors", "control", "damage", "direct".... | EXACT TITLE in insurance_coverage: "Independent insurance agent".
0.500
accordingadvicealreadyassetschangeconsumerscreatecustomerexperiencefirmguideidentifiedindustryorganizationpersonnelpoliciesproductsqualitystandardsstrategies
SHARED TOKENS (21): "according", "advice", "already", "assets", "change", "consumers", "create", "customer", "experience", "firm", "guide", "identified", "industry", "organization", "personnel", "policies", "products", "quality", "standards", "strategies".... | EXACT TITLE in wedding_events: "Customer service".
0.500
approximatelyauthoritybusinessescertainclausescontractsdirecteconomiceconomygovernmentgroupgrowthlocalorganizationpracticesprivateprocessprocurementproducepublic
SHARED TOKENS (28): "approximately", "authority", "businesses", "certain", "clauses", "contracts", "direct", "economic", "economy", "government", "group", "growth", "local", "organization", "practices", "private", "process", "procurement", "produce", "public".... | EXACT TITLE in wedding_events: "Government procurement".
0.500
appliedapplyautomobileclausesconsumercontractcostcostscoveringdamageeventeventsexpensesfirefirmfrequentlygeneralhealthhomehousing
SHARED TOKENS (34): "applied", "apply", "automobile", "clauses", "consumer", "contract", "cost", "costs", "covering", "damage", "event", "events", "expenses", "fire", "firm", "frequently", "general", "health", "home", "housing".... | EXACT TITLE in insurance_coverage: "Deductible".
0.500
agenciesallowingauthorizedbusinesscontractsfederalfoundgeneralidahoindependentindividualindustryinsuranceinsurerinsurersjurisdictionslegallylimitedperformperformed
SHARED TOKENS (26): "agencies", "allowing", "authorized", "business", "contracts", "federal", "found", "general", "idaho", "independent", "individual", "industry", "insurance", "insurer", "insurers", "jurisdictions", "legally", "limited", "perform", "performed".... | EXACT TITLE in insurance_coverage: "Managing general agent".
0.500
activityagenciesauthorizationbusinessconductdepartmentsdeterminesgovernmentissuedlicenselicenseslocalmultipleoperateoperatingphysicalrequiredrequiressingle
SHARED TOKENS (19): "activity", "agencies", "authorization", "business", "conduct", "departments", "determines", "government", "issued", "license", "licenses", "local", "multiple", "operate", "operating", "physical", "required", "requires", "single". | EXACT TITLE in wedding_events: "Business license".
0.490
approximatelyboisecentercomplexidahonampawest
SHARED TOKENS (7): "approximately", "boise", "center", "complex", "idaho", "nampa", "west". | URL->B (1): http://www.fordidahocenter.com/. | EXACT TITLE in wedding_events: "Ford Idaho Center".
0.480
amongcommissioncontractdamagefinancialinsuranceinvestmentliabilitypracticepublicrisksecuritysupportingvalue
SHARED TOKENS (14): "among", "commission", "contract", "damage", "financial", "insurance", "investment", "liability", "practice", "public", "risk", "security", "supporting", "value". | EXACT TITLE in insurance_coverage: "Underwriting".
0.480
analysisbusinessdatadescriptionguidehumanmanagementonlineperformanceplanningpracticesrelatedreportingtherefore
SHARED TOKENS (14): "analysis", "business", "data", "description", "guide", "human", "management", "online", "performance", "planning", "practices", "related", "reporting", "therefore". | EXACT TITLE in insurance_coverage: "Business analytics".
0.480
authoritydocumentissuedjurisdictionslegallicenselicensesorganizationperiodpermitplacerecordrequirerequired
SHARED TOKENS (14): "authority", "document", "issued", "jurisdictions", "legal", "license", "licenses", "organization", "period", "permit", "place", "record", "require", "required". | EXACT TITLE in wedding_events: "Marriage license".
0.480
Tent ↗ Q170544 EXACT TITLE
categoriescitiesexperienceincreasinglyintendedlargermaterialmultiplesecondsmallsmallerstructuressupportingtype
SHARED TOKENS (14): "categories", "cities", "experience", "increasingly", "intended", "larger", "material", "multiple", "second", "small", "smaller", "structures", "supporting", "type". | EXACT TITLE in insurance_coverage: "Tent". | EXACT TITLE in wedding_events: "Tent".
0.470
boisecentereventidahooperatingspace
SHARED TOKENS (6): "boise", "center", "event", "idaho", "operating", "space". | URL->B (1): https://www.boisecentre.com/. | EXACT TITLE in wedding_events: "Boise Centre".
0.460
Signage ↗ Q1211272 EXACT TITLE
boardsbuildingsdesigndigitaldocumentedformgroupinformationmeansoutsidesmallerstreetstreets
SHARED TOKENS (13): "boards", "buildings", "design", "digital", "documented", "form", "group", "information", "means", "outside", "smaller", "street", "streets". | EXACT TITLE in wedding_events: "Signage".
0.460
activitiesemergencyeventsfederalgenerallyhazardslocalmanagementprofessionalrequiresrisksearchterms
SHARED TOKENS (13): "activities", "emergency", "events", "federal", "generally", "hazards", "local", "management", "professional", "requires", "risk", "search", "terms". | EXACT TITLE in insurance_coverage: "Emergency management".
0.460
clientdesigndocumentationeventindustrymanagementnamesplanningproceduresprofessionalrequireswesternwork
SHARED TOKENS (13): "client", "design", "documentation", "event", "industry", "management", "names", "planning", "procedures", "professional", "requires", "western", "work". | EXACT TITLE in wedding_events: "Wedding planner".
0.440
Escrow ↗ Q338451 EXACT TITLE
accountcontractualestablishedholdinginsuranceobligationspartyprimaryprincipalpropertyreceivestransaction
SHARED TOKENS (12): "account", "contractual", "established", "holding", "insurance", "obligations", "party", "primary", "principal", "property", "receives", "transaction". | EXACT TITLE in insurance_coverage: "Escrow".
0.440
Resort ↗ Q875157 EXACT TITLE
activitiescommercialcontainingfrequentlymeansnorthoperatedownedownershippremisessingletype
SHARED TOKENS (12): "activities", "commercial", "containing", "frequently", "means", "north", "operated", "owned", "ownership", "premises", "single", "type". | EXACT TITLE in wedding_events: "Resort".
0.440
Downtown ↗ Q1050303 EXACT TITLE
businesscentercommercialemploymentgeographicnorthofficepopulationpublicsmallsmallersometimes
SHARED TOKENS (12): "business", "center", "commercial", "employment", "geographic", "north", "office", "population", "public", "small", "smaller", "sometimes". | EXACT TITLE in wedding_events: "Downtown".
0.440
activityamongcampusclassifiedidahomeridianpercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (12): "activity", "among", "campus", "classified", "idaho", "meridian", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in wedding_events: "Idaho State University".
0.440
Concert ↗ Q182832 EXACT TITLE
designatedequipmenteventperformperformanceprivateprofessionalrequiresinglesmallsometimessupport
SHARED TOKENS (12): "designated", "equipment", "event", "perform", "performance", "private", "professional", "require", "single", "small", "sometimes", "support". | EXACT TITLE in wedding_events: "Concert".
0.440
Parking ↗ Q267917 EXACT TITLE
availabilitybuildingsdesignfacilitieslandlocalnorthpercentpricerulessometimessupport
SHARED TOKENS (12): "availability", "buildings", "design", "facilities", "land", "local", "north", "percent", "price", "rules", "sometimes", "support". | EXACT TITLE in wedding_events: "Parking".
0.440
Easement ↗ Q448405 EXACT TITLE
accessamongenterjurisdictionslandlawlimitedownedpropertypublicrealtype
SHARED TOKENS (12): "access", "among", "enter", "jurisdictions", "land", "law", "limited", "owned", "property", "public", "real", "type". | EXACT TITLE in insurance_coverage: "Easement".
0.420
Cosmetology ↗ EXACT TITLE
applicationaveragecostlicensemedianoccupationalrequiredspecialtystudytreatmentwage
SHARED TOKENS (11): "application", "average", "cost", "license", "median", "occupational", "required", "specialty", "study", "treatment", "wage". | EXACT TITLE in wedding_events: "Cosmetology".
0.420
appropriatebureaudepartmentenforcementidaholawlegislaturemunicipalorganizationpublicstatewide
SHARED TOKENS (11): "appropriate", "bureau", "department", "enforcement", "idaho", "law", "legislature", "municipal", "organization", "public", "statewide". | EXACT TITLE in wedding_events: "Idaho State Police".
0.420
Orchard ↗ Q236371 EXACT TITLE
basecommercialgenerallymaintainedmodernorchardsscalesinglesmallersometimeswater
SHARED TOKENS (11): "base", "commercial", "generally", "maintained", "modern", "orchards", "scale", "single", "smaller", "sometimes", "water". | EXACT TITLE in insurance_coverage: "Orchard". | EXACT TITLE in wedding_events: "Orchard".
0.420
Banquet ↗ Q626066 EXACT TITLE
additionalamongbuildingcourseeveneventsformformalmodernpartythem
SHARED TOKENS (11): "additional", "among", "building", "course", "even", "events", "form", "formal", "modern", "party", "them". | EXACT TITLE in wedding_events: "Banquet".
0.400
Rose garden ↗ Q291177 EXACT TITLE
alreadydisplayedexistingindividualleastpublicsometimesspecializedtreatedtype
SHARED TOKENS (10): "already", "displayed", "existing", "individual", "least", "public", "sometimes", "specialized", "treated", "type". | EXACT TITLE in wedding_events: "Rose garden".
0.400
consumerscontractorsequipmentfinalgeneralindividualindustrylimitedperiodrental
SHARED TOKENS (10): "consumers", "contractors", "equipment", "final", "general", "individual", "industry", "limited", "period", "rental". | EXACT TITLE in wedding_events: "Equipment rental".
0.400
Barn ↗ Q1303167 EXACT TITLE
activitiesagriculturalappliedbuildingbuildingsequipmentlivestocknorthstructuresterms
SHARED TOKENS (10): "activities", "agricultural", "applied", "building", "buildings", "equipment", "livestock", "north", "structures", "terms". | EXACT TITLE in wedding_events: "Barn".
0.400
Public records ↗ EXACT TITLE
agenciesconductdocumenteddocumentsgenerallygovernmentinformationpublicrecordstransactions
SHARED TOKENS (10): "agencies", "conduct", "documented", "documents", "generally", "government", "information", "public", "records", "transactions". | EXACT TITLE in wedding_events: "Public records".
0.400
Lien ↗ Q4469383 EXACT TITLE
applicationcertainformformsgenerallyperformancepropertyretainsecuritytype
SHARED TOKENS (10): "application", "certain", "form", "forms", "generally", "performance", "property", "retain", "security", "type". | EXACT TITLE in insurance_coverage: "Lien". | EXACT TITLE in wedding_events: "Lien".
0.400
arrangementshealthinsurancelawmarketplacesmarketsoutsideplanssubjectwelfare
SHARED TOKENS (10): "arrangements", "health", "insurance", "law", "marketplaces", "markets", "outside", "plans", "subject", "welfare". | EXACT TITLE in insurance_coverage: "Essential health benefits".
0.400
Warehouse ↗ Q181623 EXACT TITLE
agricultureassociatedbuildingbuildingsbusinessescitiesdirectlysometimesstandardwarehouses
SHARED TOKENS (10): "agriculture", "associated", "building", "buildings", "businesses", "cities", "directly", "sometimes", "standard", "warehouses". | EXACT TITLE in insurance_coverage: "Warehouse". | EXACT TITLE in wedding_events: "Warehouse".
0.400
Use tax ↗ Q17155766 EXACT TITLE
appliedconvertedequivalentpaidpersonalpropertysalessubjecttaxtype
SHARED TOKENS (10): "applied", "converted", "equivalent", "paid", "personal", "property", "sales", "subject", "tax", "type". | EXACT TITLE in wedding_events: "Use tax".
0.400
Officiant ↗ Q2015874 EXACT TITLE
commonlyconducthealthhumanlawlegallifeperformspecifiedwork
SHARED TOKENS (10): "commonly", "conduct", "health", "human", "law", "legal", "life", "perform", "specified", "work". | EXACT TITLE in wedding_events: "Officiant".
0.400
departmentdevelopmenteconomicidahoinsurancelaborselectedtechnologyunemploymentworkforce
SHARED TOKENS (10): "department", "development", "economic", "idaho", "insurance", "labor", "selected", "technology", "unemployment", "workforce". | EXACT TITLE in insurance_coverage: "Idaho Department of Labor". | EXACT TITLE in wedding_events: "Idaho Department of Labor".
0.400
becomecommercialdigitaldirecthistoricallylocalmedianewsrecordingwork
SHARED TOKENS (10): "become", "commercial", "digital", "direct", "historically", "local", "media", "news", "recording", "work". | EXACT TITLE in wedding_events: "Videography".
0.400
Restaurant ↗ Q11707 EXACT TITLE
businessdeliveryfamilygenerallymodelsofferingspremisesservedservessingle
SHARED TOKENS (10): "business", "delivery", "family", "generally", "models", "offerings", "premises", "served", "serves", "single". | EXACT TITLE in wedding_events: "Restaurant".
0.380
businesscommercialestategrouphospitalitymanagementprofessionalrealview
SHARED TOKENS (9): "business", "commercial", "estate", "group", "hospitality", "management", "professional", "real", "view". | EXACT TITLE in wedding_events: "Oak View Group".
0.380
activitiesbusinessesinformationinfrastructureinsuranceriskrisksspecialtytechnology
SHARED TOKENS (9): "activities", "businesses", "information", "infrastructure", "insurance", "risk", "risks", "specialty", "technology". | EXACT TITLE in insurance_coverage: "Cyber insurance".
0.380
Reinsurance ↗ Q476118 EXACT TITLE
againstcapacitycontractcostscountinsuranceissuedliabilitypolicies
SHARED TOKENS (9): "against", "capacity", "contract", "costs", "count", "insurance", "issued", "liability", "policies". | EXACT TITLE in insurance_coverage: "Reinsurance".
0.380
Subrogation ↗ Q322457 EXACT TITLE
ariseinsurancejurisdictionslawlegalpartysecondsubjectsystems
SHARED TOKENS (9): "arise", "insurance", "jurisdictions", "law", "legal", "party", "second", "subject", "systems". | EXACT TITLE in insurance_coverage: "Subrogation".
0.380
amongcannotdeterminefamilylawlegallegallyrequirementsterms
SHARED TOKENS (9): "among", "cannot", "determine", "family", "law", "legal", "legally", "requirements", "terms". | EXACT TITLE in wedding_events: "Marriage law".
0.380
agenciesbusinessescapitalfinancialformsonlineprocesssolicitationsometimes
SHARED TOKENS (9): "agencies", "businesses", "capital", "financial", "forms", "online", "process", "solicitation", "sometimes". | EXACT TITLE in wedding_events: "Fundraising".
0.360
arrangementscommonlydesignatedhomeinfluencepracticalremainsterms
SHARED TOKENS (8): "arrangements", "commonly", "designated", "home", "influence", "practical", "remains", "terms". | EXACT TITLE in wedding_events: "Designated driver".
0.360
againstdeterminefloodinsuranceinsurersissuedpropertyrisk
SHARED TOKENS (8): "against", "determine", "flood", "insurance", "insurers", "issued", "property", "risk". | EXACT TITLE in insurance_coverage: "Flood insurance".
0.360
arrangementscreatedeliverydesignevidencefoundmarketingmaterial
SHARED TOKENS (8): "arrangements", "create", "delivery", "design", "evidence", "found", "marketing", "material". | EXACT TITLE in wedding_events: "Floral design".
0.360
Surety ↗ Q748845 EXACT TITLE
againstcertaincontractfinancepartyprincipalsecondterms
SHARED TOKENS (8): "against", "certain", "contract", "finance", "party", "principal", "second", "terms". | EXACT TITLE in insurance_coverage: "Surety".
0.360
formlawliabilitylimitedpersonalproductspropertypublic
SHARED TOKENS (8): "form", "law", "liability", "limited", "personal", "products", "property", "public". | EXACT TITLE in insurance_coverage: "Product liability".
0.340
functionsgovernmenthealthprofessionalsrecordingrecordsstatistics
SHARED TOKENS (7): "functions", "government", "health", "professionals", "recording", "records", "statistics". | EXACT TITLE in wedding_events: "Vital statistics".
0.340
associationeventshelpidahonampaprofessionalriver
SHARED TOKENS (7): "association", "events", "help", "idaho", "nampa", "professional", "river". | EXACT TITLE in wedding_events: "Snake River Stampede".
0.340
buildingcenterleastmajorshowssometimestrade
SHARED TOKENS (7): "building", "center", "least", "major", "shows", "sometimes", "trade". | EXACT TITLE in wedding_events: "Convention center".
0.340
authorizationdeterminehealthinsurancemanagementpriorprocess
SHARED TOKENS (7): "authorization", "determine", "health", "insurance", "management", "prior", "process". | EXACT TITLE in insurance_coverage: "Prior authorization".
0.340
State Farm ↗ Q2007336 EXACT TITLE
corporatefarmgroupinsurancepropertyprovidersecond
SHARED TOKENS (7): "corporate", "farm", "group", "insurance", "property", "provider", "second". | EXACT TITLE in insurance_coverage: "State Farm".
0.320
businessesformsissuedlicenseofficialpermit
SHARED TOKENS (6): "businesses", "forms", "issued", "license", "official", "permit". | EXACT TITLE in wedding_events: "Liquor license".
0.320
amongbuildingbuildingscostsexistingterms
SHARED TOKENS (6): "among", "building", "buildings", "costs", "existing", "terms". | EXACT TITLE in wedding_events: "Adaptive reuse".
0.300
activitiesassociatedbecomechangecostsgenerallyhealthhelphomeinsuranceleastneedoccurspercentperformreceivingrequiretype
SHARED TOKENS (18): "activities", "associated", "become", "change", "costs", "generally", "health", "help", "home", "insurance", "least", "need", "occurs", "percent", "perform", "receiving", "require", "type".
0.300
againstappliedappropriatecapitaldisciplineeconomicevenexposurefinancefinancialfirmgenerallyidentifyingindividualinsurersinvestmentlifelinemanagementmarket
SHARED TOKENS (31): "against", "applied", "appropriate", "capital", "discipline", "economic", "even", "exposure", "finance", "financial", "firm", "generally", "identifying", "individual", "insurers", "investment", "life", "line", "management", "market"....
0.300
Force majeure ↗ Q161398 KW CROSS HIGH
beyondcancellationchangeclausescontractcontractscontractualcontrolemergencyeventeventsfloodgeneralgenerallygoverninggovernsintendedlawlegallegally
SHARED TOKENS (33): "beyond", "cancellation", "change", "clauses", "contract", "contracts", "contractual", "control", "emergency", "event", "events", "flood", "general", "generally", "governing", "governs", "intended", "law", "legal", "legally"....
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
arisecapitalcategoriescontractcontractsdesigndesignatedeventeventsexpensesformformsgrowthindustryinsuranceinsurerinsurersinvestmentlegalliability
SHARED TOKENS (37): "arise", "capital", "categories", "contract", "contracts", "design", "designated", "event", "events", "expenses", "form", "forms", "growth", "industry", "insurance", "insurer", "insurers", "investment", "legal", "liability"....
0.300
administrativecontractscorporatecreatedirectdocumenteligibilityemployeefoundgrouphealthinsuranceobligationsplanplanspolicyprovisionsretirementrisksecurity
SHARED TOKENS (22): "administrative", "contracts", "corporate", "create", "direct", "document", "eligibility", "employee", "found", "group", "health", "insurance", "obligations", "plan", "plans", "policy", "provisions", "retirement", "risk", "security"....
0.300
agriculturalagricultureassociateddisplayedequipmenteventeventsfarmlivestocknorthpracticespublicsharingshowstermstradework
SHARED TOKENS (17): "agricultural", "agriculture", "associated", "displayed", "equipment", "event", "events", "farm", "livestock", "north", "practices", "public", "sharing", "shows", "terms", "trade", "work".
0.300
amongcurrentdatadigitalfirmfirmsgeneralgovernancelevelmanagementmarketingmediaonlineplatformspractitionersproductspublicratherreviewsterms
SHARED TOKENS (20): "among", "current", "data", "digital", "firm", "firms", "general", "governance", "level", "management", "marketing", "media", "online", "platforms", "practitioners", "products", "public", "rather", "reviews", "terms".
0.300
amongcertaincodecontinuingdepartmentemergencyemployeeemployersemploymentequivalentgenerallygovernmentgrouphealthinsurancelawofficialplanplansprice
SHARED TOKENS (31): "among", "certain", "code", "continuing", "department", "emergency", "employee", "employers", "employment", "equivalent", "generally", "government", "group", "health", "insurance", "law", "official", "plan", "plans", "price"....
0.300
Copyright ↗ Q1297822 KW CROSS HIGH
agreementsamongapplicablebeyondcertaincommonlycontroldistributioneducationalestablishingextendformformalgroupintendedjurisdictionslawlegallicenselimited
SHARED TOKENS (35): "agreements", "among", "applicable", "beyond", "certain", "commonly", "control", "distribution", "educational", "establishing", "extend", "form", "formal", "group", "intended", "jurisdictions", "law", "legal", "license", "limited"....
0.300
academicadministrationbusinesscollegecoursededicateddepartmenthospitalityindustrymanagementmarketingrelevantstudysubjectuniversity
SHARED TOKENS (15): "academic", "administration", "business", "college", "course", "dedicated", "department", "hospitality", "industry", "management", "marketing", "relevant", "study", "subject", "university".
0.300
activitiesactivityadministrationadministrativeagencieschangescontrolcourtseconomiceducationenforcementexpandedgenerallygoverninggovernmenthumaninfluencelawlegalmodel
SHARED TOKENS (28): "activities", "activity", "administration", "administrative", "agencies", "changes", "control", "courts", "economic", "education", "enforcement", "expanded", "generally", "governing", "government", "human", "influence", "law", "legal", "model"....
0.300
againstapproximatelyassociatedcannotcommercialcostscoveringexpensesfederalfinancialformgovernmenthealthinsurancemajormedicalmillionpaidpartyplans
SHARED TOKENS (36): "against", "approximately", "associated", "cannot", "commercial", "costs", "covering", "expenses", "federal", "financial", "form", "government", "health", "insurance", "major", "medical", "million", "paid", "party", "plans"....
0.300
amongcommissioncostsdesignateddevelopmenteconomicentitiesestatefinancialgovernmentjurisdictionslegalmodelsnationalpartyperformedprocesspropertyrealregulations
SHARED TOKENS (29): "among", "commission", "costs", "designated", "development", "economic", "entities", "estate", "financial", "government", "jurisdictions", "legal", "models", "national", "party", "performed", "process", "property", "real", "regulations"....
0.300
allowingapplyauthorizedbasecertainchangeclausescompliancedistributionfederalfilingfinalgovernmenthomeimposeindividuallandlawleastlegal
SHARED TOKENS (46): "allowing", "apply", "authorized", "base", "certain", "change", "clauses", "compliance", "distribution", "federal", "filing", "final", "government", "home", "impose", "individual", "land", "law", "least", "legal"....
0.300
againstarisedamageeventsfinancialinsurancelegalliabilityphysicalprimaryprotectionregionregulationstermstrafficvehicles
SHARED TOKENS (16): "against", "arise", "damage", "events", "financial", "insurance", "legal", "liability", "physical", "primary", "protection", "region", "regulations", "terms", "traffic", "vehicles".
0.300
administrationagainstagenciesassetsauthoritybureaubusinesscertainchangescommonlycomplianceconsumerconsumerscostscouncildataeconomicestablishedfederalfinancial
SHARED TOKENS (39): "administration", "against", "agencies", "assets", "authority", "bureau", "business", "certain", "changes", "commonly", "compliance", "consumer", "consumers", "costs", "council", "data", "economic", "established", "federal", "financial"....
0.300
departmenthealthidahopublicwelfare
SHARED TOKENS (5): "department", "health", "idaho", "public", "welfare". | EXACT TITLE in insurance_coverage: "Idaho Department of Health and Welfare". | EXACT TITLE in wedding_events: "Idaho Department of Health and Welfare".
0.300
buildingdamagedatadependeventfloodformhomeinsuranceinventorylargermanagementmerelyordinaryoriginalpoliciespropertyresourcesrisksmaller
SHARED TOKENS (24): "building", "damage", "data", "depend", "event", "flood", "form", "home", "insurance", "inventory", "larger", "management", "merely", "ordinary", "original", "policies", "property", "resources", "risk", "smaller"....
0.300
Aon plc ↗ Q739518 KW CROSS HIGH
brokeragecapitalcenterfirmgrouphealthholdinghumaninsurancemanagementnorthoperatesoperationsplansprofessionalrelatedretirementrisk
SHARED TOKENS (18): "brokerage", "capital", "center", "firm", "group", "health", "holding", "human", "insurance", "management", "north", "operates", "operations", "plans", "professional", "related", "retirement", "risk".
0.300
Moral hazard ↗ Q44454 KW CROSS HIGH
associatedchangecostcostseconomicexposurefinancialincreasesinformationinsurancepartyplaceprincipalrisktransactiontype
SHARED TOKENS (16): "associated", "change", "cost", "costs", "economic", "exposure", "financial", "increases", "information", "insurance", "party", "place", "principal", "risk", "transaction", "type".
0.300
businesscomconnectconnectsconsumerscreatesdemanddevelopmentdigitaldirecteconomicexplainingfoundgovernancegrouphealthmarketmarketplacemarketplacesmarkets
SHARED TOKENS (43): "business", "com", "connect", "connects", "consumers", "creates", "demand", "development", "digital", "direct", "economic", "explaining", "found", "governance", "group", "health", "market", "marketplace", "marketplaces", "markets"....
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingadditionalannouncedapplicationbusinessescitiesconsumerconverteddatadedicatedfoundlocalmapownersplanningplatformprogrampublicreportreported
SHARED TOKENS (27): "according", "additional", "announced", "application", "businesses", "cities", "consumer", "converted", "data", "dedicated", "found", "local", "map", "owners", "planning", "platform", "program", "public", "report", "reported"....
0.300
associationbusinesscategoriescategorycontrolcreatesdirectdirectlyestablishfinancefirmformgroupinsuranceinsurerslicensedmaintainmanagementmeansowned
SHARED TOKENS (30): "association", "business", "categories", "category", "control", "creates", "direct", "directly", "establish", "finance", "firm", "form", "group", "insurance", "insurers", "licensed", "maintain", "management", "means", "owned"....
0.300
accessadministrationassetauthoritiesbuildingbusinessdepartmentdevelopmentemergencyentitiesfederalgovernmenthousinginfrastructurelocalmajormanagementoccurspersonnelplace
SHARED TOKENS (30): "access", "administration", "asset", "authorities", "building", "business", "department", "development", "emergency", "entities", "federal", "government", "housing", "infrastructure", "local", "major", "management", "occurs", "personnel", "place"....
0.300
againstamongauthoritycommercialemployeefederalfinancialfirmfirmsformgroupholdinginsuranceinvestmentlaterlawmarketnovemberpdfregulatory
SHARED TOKENS (21): "against", "among", "authority", "commercial", "employee", "federal", "financial", "firm", "firms", "form", "group", "holding", "insurance", "investment", "later", "law", "market", "november", "pdf", "regulatory"....
0.300
communitiescontrolcustomerdatadigitalgroupimposeindividualinfluencemanagementmarketingmarketsnetworksonlineproductsrelatedreputationreviewsearchsites
SHARED TOKENS (22): "communities", "control", "customer", "data", "digital", "group", "impose", "individual", "influence", "management", "marketing", "markets", "networks", "online", "products", "related", "reputation", "review", "search", "sites"....
0.300
accountagreementsalreadyanalysisbusinesscurrentdirectlyeconomyindustrylistingsmarketingonlinepercentpriceproductsreviewssalessearchsitessometimes
SHARED TOKENS (21): "account", "agreements", "already", "analysis", "business", "current", "directly", "economy", "industry", "listings", "marketing", "online", "percent", "price", "products", "reviews", "sales", "search", "sites", "sometimes"....
0.300
Food storage ↗ Q11702361 KW CROSS HIGH
activitycommercialconsumersdeliverydistributionemergencyfaceformhumanlaterlifeproduceproductsprotectionrathersecurityskillsolelytype
SHARED TOKENS (19): "activity", "commercial", "consumers", "delivery", "distribution", "emergency", "face", "form", "human", "later", "life", "produce", "products", "protection", "rather", "security", "skill", "solely", "type".
0.300
accountcontractcontractualcostcurrentevenfinancialindexedinsuranceinsurerlifepolicypremiumtermstypevalue
SHARED TOKENS (16): "account", "contract", "contractual", "cost", "current", "even", "financial", "indexed", "insurance", "insurer", "life", "policy", "premium", "terms", "type", "value".
0.300
affectagriculturalagriculturechangecommunitiesconnectcontroldamageecosystemengineeringevenfloodhealthhumaninfluencelandland-uselandscapelimitslocal
SHARED TOKENS (36): "affect", "agricultural", "agriculture", "change", "communities", "connect", "control", "damage", "ecosystem", "engineering", "even", "flood", "health", "human", "influence", "land", "land-use", "landscape", "limits", "local"....
0.300
Distillation ↗ Q101017 KW CROSS HIGH
approximatelychangesidentifieslivestockoperateoperatesoperationsphysicalprocessproduceproductsrequiresselectedseparatesmallervolumewater
SHARED TOKENS (17): "approximately", "changes", "identifies", "livestock", "operate", "operates", "operations", "physical", "process", "produce", "products", "requires", "selected", "separate", "smaller", "volume", "water".
0.300
containscouncildisplayedfrequentlyhistoryhomeorganizationoriginalperiodphysicalplacementrolesitesometimesstandardssupportvalue
SHARED TOKENS (17): "contains", "council", "displayed", "frequently", "history", "home", "organization", "original", "period", "physical", "placement", "role", "site", "sometimes", "standards", "support", "value".
0.300
Actuary ↗ Q179985 KW CROSS HIGH
academicadditionaladministrativeaffectanalysisappliedassetbecomebusinesscompletecostdesigndisciplineeducationexaminationfinancialhumaninformationinsuranceinvolving
SHARED TOKENS (37): "academic", "additional", "administrative", "affect", "analysis", "applied", "asset", "become", "business", "complete", "cost", "design", "discipline", "education", "examination", "financial", "human", "information", "insurance", "involving"....
0.300
brokeragebusinessbusinesseseconomicemployersfinancingfirmhealthinsuranceinvestmentmanagementoperatingplansprofessionalprogramretirementrisk
SHARED TOKENS (17): "brokerage", "business", "businesses", "economic", "employers", "financing", "firm", "health", "insurance", "investment", "management", "operating", "plans", "professional", "program", "retirement", "risk".
0.300
administersadministrationagriculturalagriculturedepartmentfarmhomemarketingnationalnetworkofficespolicyprogramsreportsstaff
SHARED TOKENS (15): "administers", "administration", "agricultural", "agriculture", "department", "farm", "home", "marketing", "national", "network", "offices", "policy", "programs", "reports", "staff".
0.300
againstclientcontractdateestateeventeventsfirefunctionsgenerallyhomeindividualinsuranceleastlifelimitedpaidperiodplanningpolicy
SHARED TOKENS (24): "against", "client", "contract", "date", "estate", "event", "events", "fire", "functions", "generally", "home", "individual", "insurance", "least", "life", "limited", "paid", "period", "planning", "policy"....
0.300
administersadministrationadministrativecommonlydepartmentfacilitiesfederalfinancinggovhealthhomehumaninsuranceprocessprogramprogramsqualityratingreportsstandards
SHARED TOKENS (21): "administers", "administration", "administrative", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "home", "human", "insurance", "process", "program", "programs", "quality", "rating", "reports", "standards"....
0.300
additionalbusinessescertifieddecemberfederalhealthinsuranceinsurerslawmarketplacemarketplacesmillionnovemberoperationalplansprivateprotectionsmalltype
SHARED TOKENS (19): "additional", "businesses", "certified", "december", "federal", "health", "insurance", "insurers", "law", "marketplace", "marketplaces", "million", "november", "operational", "plans", "private", "protection", "small", "type".
0.300
Parking lot ↗ Q6501349 KW CROSS HIGH
buildingscitiescontroldedicateddepartmentfacilitieshelpholdingintendedjurisdictionslimitedmajormodernnorthpermitrequirerequiresthemtransportationvehicles
SHARED TOKENS (21): "buildings", "cities", "control", "dedicated", "department", "facilities", "help", "holding", "intended", "jurisdictions", "limited", "major", "modern", "north", "permit", "require", "requires", "them", "transportation", "vehicles"....
0.300
accessactivitiesarisebusinessescommonlyconsumerscurrentdatadocumentedevenformgenerallygeographicgovernmenthealthinformationlifelocalnetworknetworking
SHARED TOKENS (36): "access", "activities", "arise", "businesses", "commonly", "consumers", "current", "data", "documented", "even", "form", "generally", "geographic", "government", "health", "information", "life", "local", "network", "networking"....
0.300
administrationcostsdecemberdepartmenteducationeffectsemploymentestablishedfederalfirmhealthinspectionslaborlawmissionoccupationalratingsregulationsregulatorysales
SHARED TOKENS (23): "administration", "costs", "december", "department", "education", "effects", "employment", "established", "federal", "firm", "health", "inspections", "labor", "law", "mission", "occupational", "ratings", "regulations", "regulatory", "sales"....
0.300
affectallowingbrandbusinessesconnectconsumerscostcreatecustomereventinfluenceinformationmedianewsonlineplatformplatformsproduceproductsquality
SHARED TOKENS (28): "affect", "allowing", "brand", "businesses", "connect", "consumers", "cost", "create", "customer", "event", "influence", "information", "media", "news", "online", "platform", "platforms", "produce", "products", "quality"....
0.300
academicbecomecommonlycompetecostsdatededicateddevelopmentdiscoveryfinancialformshomeinformationmajormediamultiplenewsonlineoperateoperators
SHARED TOKENS (34): "academic", "become", "commonly", "compete", "costs", "date", "dedicated", "development", "discovery", "financial", "forms", "home", "information", "major", "media", "multiple", "news", "online", "operate", "operators"....
0.300
administrationbusinesscapitalcompensationconsolidationdepartmentsdesigndevelopmentdocumentingemployeehumaninvolvinglabormanagementorganizationperformanceplanningpoliciesprofessionalsprograms
SHARED TOKENS (28): "administration", "business", "capital", "compensation", "consolidation", "departments", "design", "development", "documenting", "employee", "human", "involving", "labor", "management", "organization", "performance", "planning", "policies", "professionals", "programs"....
0.300
Disc jockey ↗ Q130857 KW CROSS HIGH
commonlycreatedigitaleffectsequipmenteveneventsfunctionslaterleastmedianamesprivateprogramspublicrealrecordrecordingrecordssimultaneously
SHARED TOKENS (27): "commonly", "create", "digital", "effects", "equipment", "even", "events", "functions", "later", "least", "media", "names", "private", "programs", "public", "real", "record", "recording", "records", "simultaneously"....
0.300
administrationchangedepartmentemployeeestablishedgovernmentlabormanagementofficepriorprogramprovisionsreportingretirementsecuritytitlewelfare
SHARED TOKENS (17): "administration", "change", "department", "employee", "established", "government", "labor", "management", "office", "prior", "program", "provisions", "reporting", "retirement", "security", "title", "welfare".
0.300
activitiesadministersadministrationbuildingdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgoverninggovernmenthealthhistorylabormillionmissionoccupationalregulations
SHARED TOKENS (28): "activities", "administers", "administration", "building", "department", "departments", "directly", "economic", "employers", "employment", "federal", "governing", "government", "health", "history", "labor", "million", "mission", "occupational", "regulations"....
0.300
Balance billing ↗ KW CROSS HIGH
administrativecostcostscreatesincreasesinsurancemarketmedicalneednetworkpracticepricingproviderprovidersrathersometimesspecialtysubjectsystemterms
SHARED TOKENS (23): "administrative", "cost", "costs", "creates", "increases", "insurance", "market", "medical", "need", "network", "practice", "pricing", "provider", "providers", "rather", "sometimes", "specialty", "subject", "system", "terms"....
0.300
accountingadvantagearrangementsbrandbusinesscontractcontractscontroldesigndirectfunctionsgovernmentindustryinvestmentlicensinglocalmanagementoperatingoperationalpersonnel
SHARED TOKENS (28): "accounting", "advantage", "arrangements", "brand", "business", "contract", "contracts", "control", "design", "direct", "functions", "government", "industry", "investment", "licensing", "local", "management", "operating", "operational", "personnel"....
0.300
accessamongappropriateassociatedcodeconcerningconductcontainscourtsdepartmentdisclosureeffectsemployeeenforcementestablishesestablishingfederalfinancialindustryinformation
SHARED TOKENS (33): "access", "among", "appropriate", "associated", "code", "concerning", "conduct", "contains", "courts", "department", "disclosure", "effects", "employee", "enforcement", "establishes", "establishing", "federal", "financial", "industry", "information"....
0.300
annualassetsautomobileboardbrandcannotcommercialcompensationcontractscurrentdecemberdirectorsfiregeneralgroupholdinginsuranceinsurerlegallegally
SHARED TOKENS (33): "annual", "assets", "automobile", "board", "brand", "cannot", "commercial", "compensation", "contracts", "current", "december", "directors", "fire", "general", "group", "holding", "insurance", "insurer", "legal", "legally"....
0.300
accordingaccountinganalysisappliedbusinesschangesdisciplineemploymentfinancefinancialhistoricallyinsuranceinvestmentmodelsmodernnewsphysicalproductsprofessionalprofessionals
SHARED TOKENS (27): "according", "accounting", "analysis", "applied", "business", "changes", "discipline", "employment", "finance", "financial", "historically", "insurance", "investment", "models", "modern", "news", "physical", "products", "professional", "professionals"....
0.300
agreementsbecomebuildingscommunitiesconnectiondocumentseconomicgroupindustryknowledgelegallocalmajornationalphysicalpropertyprotectionratherrelatedterms
SHARED TOKENS (21): "agreements", "become", "buildings", "communities", "connection", "documents", "economic", "group", "industry", "knowledge", "legal", "local", "major", "national", "physical", "property", "protection", "rather", "related", "terms"....
0.300
addedadviceamongbrokeragebuildingcommercialemployeegroupinstitutionalinsuranceinvestmentlegallyofficesoperationsprincipalreportedretirementrisk
SHARED TOKENS (18): "added", "advice", "among", "brokerage", "building", "commercial", "employee", "group", "institutional", "insurance", "investment", "legally", "offices", "operations", "principal", "reported", "retirement", "risk".
0.300
addedadditionalapplicablebusinessbusinessescomprehensivedamageeventfinancialinsurancejurisdictionsoperationsphysicalpolicypositionprimaryprocesspropertytype
SHARED TOKENS (19): "added", "additional", "applicable", "business", "businesses", "comprehensive", "damage", "event", "financial", "insurance", "jurisdictions", "operations", "physical", "policy", "position", "primary", "process", "property", "type".
0.300
agenciesassociatedbusinessescapacitydeterminedistributioneconomicemploymentexistingfirmfirmsindustrylandlawmarketorganizationpracticeregulationregulatoryrelated
SHARED TOKENS (27): "agencies", "associated", "businesses", "capacity", "determine", "distribution", "economic", "employment", "existing", "firm", "firms", "industry", "land", "law", "market", "organization", "practice", "regulation", "regulatory", "related"....
0.300
buildingscitiesdevelopmentmaintainsproducts
SHARED TOKENS (5): "buildings", "cities", "development", "maintains", "products". | EXACT TITLE in wedding_events: "Historic preservation".
0.300
categorycontractdateinsuranceinsurerlifelimitedordinarypaidpartypoliciespolicypremiumremainrepresentsrequiredsometimestermsvalue
SHARED TOKENS (19): "category", "contract", "date", "insurance", "insurer", "life", "limited", "ordinary", "paid", "party", "policies", "policy", "premium", "remain", "represents", "required", "sometimes", "terms", "value".
0.300
accountactivitiesbrandbroaderbusinessbusinessesclientcorecreatedirectequivalentestablisheventeventsexposurefirmfirmsformgovernmentindividual
SHARED TOKENS (51): "account", "activities", "brand", "broader", "business", "businesses", "client", "core", "create", "direct", "equivalent", "establish", "event", "events", "exposure", "firm", "firms", "form", "government", "individual"....
0.300
administrativeauthorizedbusinesseschangeconcerningemployersentitiesfamiliesfamilyfederalgenerallygovernsgrouphealthinformationinsurancelawlifelimitedmaintained
SHARED TOKENS (33): "administrative", "authorized", "businesses", "change", "concerning", "employers", "entities", "families", "family", "federal", "generally", "governs", "group", "health", "information", "insurance", "law", "life", "limited", "maintained"....
0.300
againstagriculturalgovernmentinsurancerelated
SHARED TOKENS (5): "against", "agricultural", "government", "insurance", "related". | EXACT TITLE in insurance_coverage: "Crop insurance".
0.300
categoryconsumercontainingcontrolsconventionaldigitalexposurefinalformfunctionshistoryindustrylaterlevelmarketsmediamodernperformproduceprofessional
SHARED TOKENS (35): "category", "consumer", "containing", "controls", "conventional", "digital", "exposure", "final", "form", "functions", "history", "industry", "later", "level", "markets", "media", "modern", "perform", "produce", "professional"....
0.300
Drought ↗ Q43059 KW CROSS HIGH
activityagricultureannualavailabilitybecomechangecostsdatedirectlyeconomiceconomyeffectsexperiencehealthhistoryhumanincreaseslargerlivestocklocal
SHARED TOKENS (30): "activity", "agriculture", "annual", "availability", "become", "change", "costs", "date", "directly", "economic", "economy", "effects", "experience", "health", "history", "human", "increases", "larger", "livestock", "local"....
0.300
agenciesbecomecreatedigitaldisplayedestimatesformfrequentlyhelpincreasinglyindependentmarketingmediamultipleonlineoperatingplaceplatformspracticesproducts
SHARED TOKENS (29): "agencies", "become", "create", "digital", "displayed", "estimates", "form", "frequently", "help", "increasingly", "independent", "marketing", "media", "multiple", "online", "operating", "place", "platforms", "practices", "products"....
0.300
agenciescontroldesignengineeringestateexistinggeneralhumaninfrastructurejurisdictionslandscapelicenselicensedlicensesmanagementplanningpossessprivateproduceprofessional
SHARED TOKENS (25): "agencies", "control", "design", "engineering", "estate", "existing", "general", "human", "infrastructure", "jurisdictions", "landscape", "license", "licensed", "licenses", "management", "planning", "possess", "private", "produce", "professional"....
0.300
adaanalysisannualcommissioncommonlycompensationcontractemploymentfamilyforminformationinsurancelaborlawliabilitymanagementmedicalnationalpracticesprivacy
SHARED TOKENS (26): "ada", "analysis", "annual", "commission", "commonly", "compensation", "contract", "employment", "family", "form", "information", "insurance", "labor", "law", "liability", "management", "medical", "national", "practices", "privacy"....
0.300
Fidelity bond ↗ Q884117 KW CROSS HIGH
additionalagainstagreementsassetsbusinessfinancialfireformgeneralinsuranceobligationspartypoliciespropertyprotectionspecified
SHARED TOKENS (16): "additional", "against", "agreements", "assets", "business", "financial", "fire", "form", "general", "insurance", "obligations", "party", "policies", "property", "protection", "specified".
0.300
Vocational education ↗ KW CROSS HIGH
collegeeconomiceducationeducationalformalformsgeneralindividualknowledgelevellifenamesoccupationplacerelatedschoolsspecializedtechnologytradetraining
SHARED TOKENS (22): "college", "economic", "education", "educational", "formal", "forms", "general", "individual", "knowledge", "level", "life", "names", "occupation", "place", "related", "schools", "specialized", "technology", "trade", "training"....
0.300
Right of way ↗ KW CROSS HIGH
authoritycertainestategovernmentlandlegallocalmeanoperateoriginalownershipphysicalprivaterealretainright-of-wayroadsstatusthemtraffic
SHARED TOKENS (22): "authority", "certain", "estate", "government", "land", "legal", "local", "mean", "operate", "original", "ownership", "physical", "private", "real", "retain", "right-of-way", "roads", "status", "them", "traffic"....
0.300
addressingadviceauthorizedconcerningdepartmenteducationfederalgeneralgovernmenthealthhumanmattersmedicalmissionprimaryprivatepublicseparatesystemwelfare
SHARED TOKENS (20): "addressing", "advice", "authorized", "concerning", "department", "education", "federal", "general", "government", "health", "human", "matters", "medical", "mission", "primary", "private", "public", "separate", "system", "welfare".
0.300
boundariescompleteextendformalfoundlaborlevellicensemeasurableoccupationoutsideperiodplacementpracticepractitionersprofessionalreachregulatedstudysystem
SHARED TOKENS (23): "boundaries", "complete", "extend", "formal", "found", "labor", "level", "license", "measurable", "occupation", "outside", "period", "placement", "practice", "practitioners", "professional", "reach", "regulated", "study", "system"....
0.300
adviceagainstbusinessescertainclientcommonlycontractcostcostsdirectfinancialformformsgeneralinsurancelawlegalliabilitymedicalnames
SHARED TOKENS (27): "advice", "against", "businesses", "certain", "client", "commonly", "contract", "cost", "costs", "direct", "financial", "form", "forms", "general", "insurance", "law", "legal", "liability", "medical", "names"....
0.300
accordingadditionalagainstapproximatelyauditbureaucodedepartmentdutiesenforcementexpensesfederalfundgenerallygovernmenthistoryimposeincreasesindividuallater
SHARED TOKENS (36): "according", "additional", "against", "approximately", "audit", "bureau", "code", "department", "duties", "enforcement", "expenses", "federal", "fund", "generally", "government", "history", "impose", "increases", "individual", "later"....
0.300
accountanalysisassetassociatedbecomebroaderchangecostcostsdocumentationeffectsevaluationeventsexposureformshazardshelpidentifiesidentifyingincreasingly
SHARED TOKENS (32): "account", "analysis", "asset", "associated", "become", "broader", "change", "cost", "costs", "documentation", "effects", "evaluation", "events", "exposure", "forms", "hazards", "help", "identifies", "identifying", "increasingly"....
0.300
Graphic design ↗ Q185925 KW CROSS HIGH
academicapplicationappliedassociatedbeyondconsolidationconsumercustomerdemanddesigndevelopmentdigitaldisciplineestablishedgrowthhumaninformationintendedknowledgeneed
SHARED TOKENS (34): "academic", "application", "applied", "associated", "beyond", "consolidation", "consumer", "customer", "demand", "design", "development", "digital", "discipline", "established", "growth", "human", "information", "intended", "knowledge", "need"....
0.300
advantageaverageconsumerscontractcontractsdamagedemandeffectseveninformationinsurancelargerlawlifemanagementmarketmarketspartypriceprovisions
SHARED TOKENS (30): "advantage", "average", "consumers", "contract", "contracts", "damage", "demand", "effects", "even", "information", "insurance", "larger", "law", "life", "management", "market", "markets", "party", "price", "provisions"....
0.300
accountadditionalaveragecertaincomprehensivecontrolestablishedgenerallygovernmentjurisdictionslegallevellimitslocalmunicipalnationalplaceprivatepublicregulation
SHARED TOKENS (28): "account", "additional", "average", "certain", "comprehensive", "control", "established", "generally", "government", "jurisdictions", "legal", "level", "limits", "local", "municipal", "national", "place", "private", "public", "regulation"....
0.300
buildingscomplexeffectseventeventshundredsindustryintendedlargermarketsmultipleprofessionalpublicsinglesmallsoundsupportsystemsystemstechnology
SHARED TOKENS (21): "buildings", "complex", "effects", "event", "events", "hundreds", "industry", "intended", "larger", "markets", "multiple", "professional", "public", "single", "small", "sound", "support", "system", "systems", "technology"....
0.300
amongcompensationcoursedamageeconomicemployeeemployersemploymentexpensesformgeneralgenerallyhealthinsurancejurisdictionsliabilitylimitedmandatorymedicaloutside
SHARED TOKENS (26): "among", "compensation", "course", "damage", "economic", "employee", "employers", "employment", "expenses", "form", "general", "generally", "health", "insurance", "jurisdictions", "liability", "limited", "mandatory", "medical", "outside"....
0.300
againstassociatedbecomebroadercapacitycostsdirectorseventextendinsurancelegalliabilitymanagementorganizationpersonalpoliciesregulatorysimultaneouslytype
SHARED TOKENS (19): "against", "associated", "become", "broader", "capacity", "costs", "directors", "event", "extend", "insurance", "legal", "liability", "management", "organization", "personal", "policies", "regulatory", "simultaneously", "type".
0.300
accordingaccountactivityadvantageapplicationassetbureaucompensationcostfederalhealthinsuranceinsurerinsurersoccurspremiumprocessproviderreceivereceived
SHARED TOKENS (23): "according", "account", "activity", "advantage", "application", "asset", "bureau", "compensation", "cost", "federal", "health", "insurance", "insurer", "insurers", "occurs", "premium", "process", "provider", "receive", "received"....
0.300
addedadditionalapplicableapplyauthoritydemandfacegeneralgenerallygovernedidahoimposelevellocalnationalpaidpriceproductsrequireresidents
SHARED TOKENS (29): "added", "additional", "applicable", "apply", "authority", "demand", "face", "general", "generally", "governed", "idaho", "impose", "level", "local", "national", "paid", "price", "products", "require", "residents"....
0.300
acquireannouncedapprovedcentercreatelaternetworknorthoperatesoperatingoriginalplansprincipalreachregulatorsreportingsystemtransportationwestwestern
SHARED TOKENS (20): "acquire", "announced", "approved", "center", "create", "later", "network", "north", "operates", "operating", "original", "plans", "principal", "reach", "regulators", "reporting", "system", "transportation", "west", "western".
0.300
Boise Airport ↗ Q1430971 KW CROSS HIGH
adabaseboisecentercommercialcommissiondepartmentfirefunctionsgeneralidahomillionnationaloperatedoperatesprotectionreceiverequiringsupportuses
SHARED TOKENS (22): "ada", "base", "boise", "center", "commercial", "commission", "department", "fire", "functions", "general", "idaho", "million", "national", "operated", "operates", "protection", "receive", "requiring", "support", "uses"....
0.300
Commercial law ↗ Q219186 KW CROSS HIGH
activitiesassetsbusinesscategoriescodecommercialconductconsumercreateemploymententitiesestablishingfinancefinancialfinancingformationgeneralgoverninginsuranceinvolving
SHARED TOKENS (40): "activities", "assets", "business", "categories", "code", "commercial", "conduct", "consumer", "create", "employment", "entities", "establishing", "finance", "financial", "financing", "formation", "general", "governing", "insurance", "involving"....
0.300
E-commerce ↗ Q484847 KW CROSS HIGH
activitiesbusinesscommercialdataindustryinventorymanagementmarketingonlineplatformsproductssegmentsystemstransactiontype
SHARED TOKENS (15): "activities", "business", "commercial", "data", "industry", "inventory", "management", "marketing", "online", "platforms", "products", "segment", "systems", "transaction", "type".
0.300
Building code ↗ Q2333573 KW CROSS HIGH
appliedapplyappropriateapprovedauthoritybuildingbuildingscodecodescompliancecontrolcouncildepartmentsdesigneffectsestategeneralgenerallyhealthinsurance
SHARED TOKENS (42): "applied", "apply", "appropriate", "approved", "authority", "building", "buildings", "code", "codes", "compliance", "control", "council", "departments", "design", "effects", "estate", "general", "generally", "health", "insurance"....
0.300
additionalagainstcombinescommonlyestateexpensesfinancialhomeindustryinsuranceliabilitypersonalpolicyprivatepropertyprotectionrealstandardtype
SHARED TOKENS (19): "additional", "against", "combines", "commonly", "estate", "expenses", "financial", "home", "industry", "insurance", "liability", "personal", "policy", "private", "property", "protection", "real", "standard", "type".
0.300
administrationagenciesbureaucurrentdepartmentdepartmentsdutiesestablishedfederalfinancefinancialgovernmentlicenseslimitedmajormattersnationalofficepolicypresence
SHARED TOKENS (23): "administration", "agencies", "bureau", "current", "department", "departments", "duties", "established", "federal", "finance", "financial", "government", "licenses", "limited", "major", "matters", "national", "office", "policy", "presence"....
0.300
activitiesassociatedbroaderbusinesscategoriescertaindevelopmentfrequentlygenerallyincreasesinvolvinglinkslocalmobilitypropertyratherrulessinglestreetsurrounding
SHARED TOKENS (23): "activities", "associated", "broader", "business", "categories", "certain", "development", "frequently", "generally", "increases", "involving", "links", "local", "mobility", "property", "rather", "rules", "single", "street", "surrounding"....
0.300
Franchising ↗ Q171947 KW CROSS HIGH
brandbusinesscapitalcertaincompetecorporatedirecteconomicfinancialgrowthindividualinvestmentlegalliabilitylicenseslicensingmarketmeansmodelobligations
SHARED TOKENS (30): "brand", "business", "capital", "certain", "compete", "corporate", "direct", "economic", "financial", "growth", "individual", "investment", "legal", "liability", "licenses", "licensing", "market", "means", "model", "obligations"....
0.300
Ridesharing company ↗ KW CROSS HIGH
cannotcommissioncontractorscustomerdemandindependentinsuranceissuedlegallylicensinglocalmodelonlineoperateoperationspricingreceivesregulationsrequiredrequirements
SHARED TOKENS (25): "cannot", "commission", "contractors", "customer", "demand", "independent", "insurance", "issued", "legally", "licensing", "local", "model", "online", "operate", "operations", "pricing", "receives", "regulations", "required", "requirements"....
0.300
buildingbuildingscommercialcommonlydistributionemergencyequipmenteventsfacilitiesgenerallyhumanincreasesinstitutionalmeansmultiplepublicrelatedrequiresschoolssmall
SHARED TOKENS (26): "building", "buildings", "commercial", "commonly", "distribution", "emergency", "equipment", "events", "facilities", "generally", "human", "increases", "institutional", "means", "multiple", "public", "related", "requires", "schools", "small"....
0.300
businessentitiesexpensesfinancegeneratelocalmissionoperatedoperatesoperationsorganizationownersprivateprogrampublicratherreceiveschoolsstatussubject
SHARED TOKENS (21): "business", "entities", "expenses", "finance", "generate", "local", "mission", "operated", "operates", "operations", "organization", "owners", "private", "program", "public", "rather", "receive", "schools", "status", "subject"....
0.300
againstautomobiledamagedirectlyeventexpensesformfoundhealthindividualinsuranceliabilitylifemedicalorganizationpolicypropertyrisksometimes
SHARED TOKENS (19): "against", "automobile", "damage", "directly", "event", "expenses", "form", "found", "health", "individual", "insurance", "liability", "life", "medical", "organization", "policy", "property", "risk", "sometimes".
0.300
againstamongdirectestablishedfamiliesfederalinsurancelaborlaterlawmajornationalplanprogramprogramssecuritysinglesupportsystemunemployment
SHARED TOKENS (21): "against", "among", "direct", "established", "families", "federal", "insurance", "labor", "later", "law", "major", "national", "plan", "program", "programs", "security", "single", "support", "system", "unemployment"....
0.300
Request for proposal ↗ KW CROSS HIGH
biddingbusinesscomplexcontractorscontractscustomerdocumentfinalforminformationoriginalpriceprocessprocurementqualitysalessubmittedvendors
SHARED TOKENS (18): "bidding", "business", "complex", "contractors", "contracts", "customer", "document", "final", "form", "information", "original", "price", "process", "procurement", "quality", "sales", "submitted", "vendors".
0.300
accordingamongappliedauthorizationbecomebureaucertaineconomicemployersformalfoundfunctionsgeneralindividualjurisdictionslawlegalmeansmedianobligations
SHARED TOKENS (31): "according", "among", "applied", "authorization", "become", "bureau", "certain", "economic", "employers", "formal", "found", "functions", "general", "individual", "jurisdictions", "law", "legal", "means", "median", "obligations"....
0.300
annualcertifiedcontractcontractedemergencyemployersentitiesgrouphealthinsurancemedicalorganizationplansprofessionalsproviderprovidersrequiredstatustreat
SHARED TOKENS (19): "annual", "certified", "contract", "contracted", "emergency", "employers", "entities", "group", "health", "insurance", "medical", "organization", "plans", "professionals", "provider", "providers", "required", "status", "treat".
🫐 BERRY82 edges
0.280
associationeventinsurancepolicies
SHARED TOKENS (4): "association", "event", "insurance", "policies". | EXACT TITLE in insurance_coverage: "Guaranty association".
0.280
equipmentfacilitieshumaninfrastructuremunicipalprivacyrequiresinglesitessmallsystemtermstreatmenttype
SHARED TOKENS (14): "equipment", "facilities", "human", "infrastructure", "municipal", "privacy", "require", "single", "sites", "small", "system", "terms", "treatment", "type".
0.280
Baker ↗ Q160131 EXACT TITLE
placeproductssometimessource
SHARED TOKENS (4): "place", "products", "sometimes", "source". | EXACT TITLE in wedding_events: "Baker".
0.280
Medigap ↗ Q6806864 KW CROSS HIGH
accordingassociationequipmentexpenseshealthhomeinsurancemedicalmillionplansprivateprovidersrelatedreport
SHARED TOKENS (14): "according", "association", "equipment", "expenses", "health", "home", "insurance", "medical", "million", "plans", "private", "providers", "related", "report".
0.280
accordingcodecoveringgovernmenthomeinsurancejurisdictionsofficeperformedseparatesometimesstandardssystemtype
SHARED TOKENS (14): "according", "code", "covering", "government", "home", "insurance", "jurisdictions", "office", "performed", "separate", "sometimes", "standards", "system", "type".
0.280
amongcompensationconsumersfinancialforminsurancemarketmillionoperationalownedpolicypremiumratherrisk
SHARED TOKENS (14): "among", "compensation", "consumers", "financial", "form", "insurance", "market", "million", "operational", "owned", "policy", "premium", "rather", "risk".
0.280
Wedding ↗ Q49836 EXACT TITLE
authoritycommonlypublicsometimes
SHARED TOKENS (4): "authority", "commonly", "public", "sometimes". | EXACT TITLE in wedding_events: "Wedding".
0.280
appliedeveneventfamiliesfamilyformhospitalitylinepartyratherreceivereceivingseparatewhose
SHARED TOKENS (14): "applied", "even", "event", "families", "family", "form", "hospitality", "line", "party", "rather", "receive", "receiving", "separate", "whose".
0.280
inquirylawprivatework
SHARED TOKENS (4): "inquiry", "law", "private", "work". | EXACT TITLE in wedding_events: "Private investigator".
0.280
Beer garden ↗ Q857909 EXACT TITLE
capitallocalremainserved
SHARED TOKENS (4): "capital", "local", "remain", "served". | EXACT TITLE in wedding_events: "Beer garden".
0.280
Brewery ↗ Q131734 KW CROSS HIGH
businesscommercialdedicatedequipmenthomeindustrylargerleastplaceprocessproduceprotectionscaleworkers
SHARED TOKENS (14): "business", "commercial", "dedicated", "equipment", "home", "industry", "larger", "least", "place", "process", "produce", "protection", "scale", "workers".
0.280
commonlycontrolcorporatedisciplineeffectsequipmenteventsmodernoperateperformancepersonnelshowstradework
SHARED TOKENS (14): "commonly", "control", "corporate", "discipline", "effects", "equipment", "events", "modern", "operate", "performance", "personnel", "shows", "trade", "work".
0.280
accountallowingapproximatelyauthorizationbeyondcertaincommonlygeneralincreaseslawleastlegalmedicalrequire
SHARED TOKENS (14): "account", "allowing", "approximately", "authorization", "beyond", "certain", "commonly", "general", "increases", "law", "least", "legal", "medical", "require".
0.260
approximatelyboisedataevenfoundgovernmentidaholegislaturelimitsnorthpopulationresidentssingle
SHARED TOKENS (13): "approximately", "boise", "data", "even", "found", "government", "idaho", "legislature", "limits", "north", "population", "residents", "single".
0.260
documentdocumentationdocumentslawmaintainedofficeoriginalownersownershippropertyrecordservestitle
SHARED TOKENS (13): "document", "documentation", "documents", "law", "maintained", "office", "original", "owners", "ownership", "property", "record", "serves", "title".
0.260
Food truck ↗ KW CROSS HIGH
amongbecomecommercialeconomicincreasinglyindustrymajorregionalspecialtystreetsurroundingwaterworkers
SHARED TOKENS (13): "among", "become", "commercial", "economic", "increasingly", "industry", "major", "regional", "specialty", "street", "surrounding", "water", "workers".
0.260
Vineyard ↗ Q22715 EXACT TITLE
placepracticestudy
SHARED TOKENS (3): "place", "practice", "study". | EXACT TITLE in wedding_events: "Vineyard".
0.260
approximatelybusinessesfinancialfiregroupindependentinsuranceinsurerownedproductssmalltradevehicles
SHARED TOKENS (13): "approximately", "businesses", "financial", "fire", "group", "independent", "insurance", "insurer", "owned", "products", "small", "trade", "vehicles".
0.260
Urban renewal ↗ Q920600 KW CROSS HIGH
addressingbusinessescitiescommunitieseconomicgovernmentgrowthhousinginfrastructurelandprivateprocesspublic
SHARED TOKENS (13): "addressing", "businesses", "cities", "communities", "economic", "government", "growth", "housing", "infrastructure", "land", "private", "process", "public".
0.260
Make-up artist ↗ Q935666 KW CROSS HIGH
accessagenciesfoundgenerallyhumanindustrylicensesprofessionalremainrequiredthemwhosework
SHARED TOKENS (13): "access", "agencies", "found", "generally", "human", "industry", "licenses", "professional", "remain", "required", "them", "whose", "work".
0.260
applicableapproximatelydirectlyeconomiceffectsevenexposureleastmillionperiodpriorrepeatedrequiring
SHARED TOKENS (13): "applicable", "approximately", "directly", "economic", "effects", "even", "exposure", "least", "million", "period", "prior", "repeated", "requiring".
0.260
Photo booth ↗ Q494312 EXACT TITLE
containsdigitalmodern
SHARED TOKENS (3): "contains", "digital", "modern". | EXACT TITLE in wedding_events: "Photo booth".
0.260
Marquee ↗ Q1621931 KW CROSS HIGH
buildingchannelcommonlycoveringgenerallynetworkpageregionalsinglesmallstructuretexttype
SHARED TOKENS (13): "building", "channel", "commonly", "covering", "generally", "network", "page", "regional", "single", "small", "structure", "text", "type".
0.260
Cold chain ↗ Q592197 KW CROSS HIGH
activitiesagriculturalassociateddistributionequipmentmaintainmanagementproduceproductsqualityrequiressometimesuses
SHARED TOKENS (13): "activities", "agricultural", "associated", "distribution", "equipment", "maintain", "management", "produce", "products", "quality", "requires", "sometimes", "uses".
0.260
againstcorecreatesformfunctionsinsurancemaintainpaidphysicalprotectionriskworkworking
SHARED TOKENS (13): "against", "core", "creates", "form", "functions", "insurance", "maintain", "paid", "physical", "protection", "risk", "work", "working".
0.260
againstbuildingbuildingscontractordamageequipmentinsuranceorganizationphysicalpropertyriskstructuretype
SHARED TOKENS (13): "against", "building", "buildings", "contractor", "damage", "equipment", "insurance", "organization", "physical", "property", "risk", "structure", "type".
0.260
Quinceañera ↗ EXACT TITLE
eventnamespractices
SHARED TOKENS (3): "event", "names", "practices". | EXACT TITLE in wedding_events: "Quinceañera".
0.250
currentgovernmentidahoofficeposition
SHARED TOKENS (5): "current", "government", "idaho", "office", "position". | URL->B (1): https://sos.idaho.gov/.
0.240
existingextendsformindividualinsuranceliabilitylimitspoliciespolicyprimarytypeunderlying
SHARED TOKENS (12): "existing", "extends", "form", "individual", "insurance", "liability", "limits", "policies", "policy", "primary", "type", "underlying".
0.240
damagedirectestablishedeventfinancialinsurancelegalmajorownershippracticerelationshipvehicles
SHARED TOKENS (12): "damage", "direct", "established", "event", "financial", "insurance", "legal", "major", "ownership", "practice", "relationship", "vehicles".
0.240
Calligraphy ↗ Q12681 KW CROSS HIGH
certificatesdesigndocumentsformindividuallevelmodernpracticerelatedtexttypewestern
SHARED TOKENS (12): "certificates", "design", "documents", "form", "individual", "level", "modern", "practice", "related", "text", "type", "western".
0.240
applicationdigitalestablishedfinancefinancialfirmsindustryonlineplatformsproductssystemstechnology
SHARED TOKENS (12): "application", "digital", "established", "finance", "financial", "firms", "industry", "online", "platforms", "products", "systems", "technology".
0.240
concerningconsolidationcontroldocumentationinsurancemanagementmoveplanningpurchasingtrafficvehiclesworking
SHARED TOKENS (12): "concerning", "consolidation", "control", "documentation", "insurance", "management", "move", "planning", "purchasing", "traffic", "vehicles", "working".
0.240
Trinity Health ↗ KW CROSS HIGH
comprehensivecontinuingfacilitieshealthhomeidahonetworknorthoperatesoperatingsupportsystem
SHARED TOKENS (12): "comprehensive", "continuing", "facilities", "health", "home", "idaho", "network", "north", "operates", "operating", "support", "system".
0.240
averageeventshistoryindependentinsurancelawmeanrepeatedsinglesmallstatisticsvalue
SHARED TOKENS (12): "average", "events", "history", "independent", "insurance", "law", "mean", "repeated", "single", "small", "statistics", "value".
0.240
activitiesbusinessdefinesdefinitionsgovernmenthomelimitedorganizationoutsidepaidprimaryworking
SHARED TOKENS (12): "activities", "business", "defines", "definitions", "government", "home", "limited", "organization", "outside", "paid", "primary", "working".
0.240
agriculturalagriculturedepartmententitiesfederalgovernmentinsurancemanagementownedprogramprotectionrisk
SHARED TOKENS (12): "agricultural", "agriculture", "department", "entities", "federal", "government", "insurance", "management", "owned", "program", "protection", "risk".
0.220
Interior design ↗ KW CROSS HIGH
buildingdesigndevelopmenthelpinspectionsmanagementplanningplansresearchsitespace
SHARED TOKENS (11): "building", "design", "development", "help", "inspections", "management", "planning", "plans", "research", "site", "space".
0.220
appliedassociationauthoritybusinessfederalgovernmentindustryinsurancelawlimitedregulation
SHARED TOKENS (11): "applied", "association", "authority", "business", "federal", "government", "industry", "insurance", "law", "limited", "regulation".
0.220
averagecommercialcommonlyindependentinsurancelistofficeofficesoperationspersonalproperty
SHARED TOKENS (11): "average", "commercial", "commonly", "independent", "insurance", "list", "office", "offices", "operations", "personal", "property".
0.220
approximatelycommonlyfinancialgroupinsurancelistoperatesownedpriorpublicregional
SHARED TOKENS (11): "approximately", "commonly", "financial", "group", "insurance", "list", "operates", "owned", "prior", "public", "regional".
0.220
Payment bond ↗ Q7156776 KW CROSS HIGH
contractcontractorcontractorscontractsfederalgovernmentmaterialpaidperformancerequiredvalue
SHARED TOKENS (11): "contract", "contractor", "contractors", "contracts", "federal", "government", "material", "paid", "performance", "required", "value".
0.220
categorycontractorsequipmenthistoricallyinsurancemedicalpropertyrelatedspecializedtransportationtype
SHARED TOKENS (11): "category", "contractors", "equipment", "historically", "insurance", "medical", "property", "related", "specialized", "transportation", "type".
0.220
Train station ↗ Q55488 KW CROSS HIGH
boardbuildinggenerallyleastlevellineplatformrapidsalessometimessystems
SHARED TOKENS (11): "board", "building", "generally", "least", "level", "line", "platform", "rapid", "sales", "sometimes", "systems".
0.210
performance
SHARED TOKENS (1): "performance". | EXACT TITLE in wedding_events: "Dance floor".
0.210
Decoration ↗ Q1232942 EXACT TITLE
intended
SHARED TOKENS (1): "intended". | EXACT TITLE in wedding_events: "Decoration".
0.210
Fairground ↗ Q5430425 EXACT TITLE
space
SHARED TOKENS (1): "space". | EXACT TITLE in wedding_events: "Fairground".
0.200
analysisconductdetermineestablishexaminationfireknowledgerequiresecondsometimes
SHARED TOKENS (10): "analysis", "conduct", "determine", "establish", "examination", "fire", "knowledge", "require", "second", "sometimes".
0.200
healthinsuranceinsurermedicalorganizationplanproviderproviderssometimestype
SHARED TOKENS (10): "health", "insurance", "insurer", "medical", "organization", "plan", "provider", "providers", "sometimes", "type".
0.200
commercialhomeinsuranceinsurerlifelistpersonalprivatevehicleswater
SHARED TOKENS (10): "commercial", "home", "insurance", "insurer", "life", "list", "personal", "private", "vehicles", "water".
0.200
Insurance law ↗ Q1037642 KW CROSS HIGH
businesscategoriesconsumerinsurancelawpoliciespracticeregulationregulationssurrounding
SHARED TOKENS (10): "business", "categories", "consumer", "insurance", "law", "policies", "practice", "regulation", "regulations", "surrounding".
0.200
damageeducationemergencyenforcementengineeringfireknowledgepracticessurroundingthem
SHARED TOKENS (10): "damage", "education", "emergency", "enforcement", "engineering", "fire", "knowledge", "practices", "surrounding", "them".
0.200
commercialfamilyhealthinsuranceinvestmentlifeprivateproductspropertyreported
SHARED TOKENS (10): "commercial", "family", "health", "insurance", "investment", "life", "private", "products", "property", "reported".
0.200
familygenerallylaworganizationoutsideperformperformanceplacepublicpublicly
SHARED TOKENS (10): "family", "generally", "law", "organization", "outside", "perform", "performance", "place", "public", "publicly".
0.200
Review site ↗ Q1340449 KW CROSS HIGH
businesseschannelcomlaterproductsprofessionalreviewreviewssitesites
SHARED TOKENS (10): "businesses", "channel", "com", "later", "products", "professional", "review", "reviews", "site", "sites".
0.200
contractcontractsfactsformgovernsinsurancelegalmaterialmeanssometimes
SHARED TOKENS (10): "contract", "contracts", "facts", "form", "governs", "insurance", "legal", "material", "means", "sometimes".
0.200
boisecitiesdesignatedhomeidaholinemajormetropolitanriverserves
SHARED TOKENS (10): "boise", "cities", "designated", "home", "idaho", "line", "major", "metropolitan", "river", "serves".
0.180
certainintendedlicensedlicensinglimitedownersseparateuseswork
SHARED TOKENS (9): "certain", "intended", "licensed", "licensing", "limited", "owners", "separate", "uses", "work".
0.180
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitanpopulationrapidlyschoolswest
SHARED TOKENS (9): "ada", "boise", "canyon", "idaho", "metropolitan", "population", "rapidly", "schools", "west".
0.180
Hairstyle ↗ Q327496 KW CROSS HIGH
facefrequentlyhomehumaninfluenceoutsidepersonalpracticalsometimes
SHARED TOKENS (9): "face", "frequently", "home", "human", "influence", "outside", "personal", "practical", "sometimes".
0.180
developmentfederalfloodhousinginsurancelawnationalprogramtitle
SHARED TOKENS (9): "development", "federal", "flood", "housing", "insurance", "law", "national", "program", "title".
0.180
Crowd control ↗ Q1872073 KW CROSS HIGH
controleventshundredsinvolvingmanagementpracticepublicsecuritystreet
SHARED TOKENS (9): "control", "events", "hundreds", "involving", "management", "practice", "public", "security", "street".
0.180
appliedbuildingsfoundoriginalperiodratherrelationshipsecondsometimes
SHARED TOKENS (9): "applied", "buildings", "found", "original", "period", "rather", "relationship", "second", "sometimes".
0.160
advicearrangementsbusinesscompensationdamagemanagementpublicregulation
SHARED TOKENS (8): "advice", "arrangements", "business", "compensation", "damage", "management", "public", "regulation".
0.160
Wedding cake ↗ Q558133 KW CROSS HIGH
costevenmeanmodernrealservedsinglewestern
SHARED TOKENS (8): "cost", "even", "mean", "modern", "real", "served", "single", "western".
0.160
amongautomobilebrokeragecompensationinsurancemanagementriskworkers
SHARED TOKENS (8): "among", "automobile", "brokerage", "compensation", "insurance", "management", "risk", "workers".
0.160
Equestrianism ↗ KW CROSS HIGH
activitiescommonlydescriptionpracticaltransportationwelfareworkworking
SHARED TOKENS (8): "activities", "commonly", "description", "practical", "transportation", "welfare", "work", "working".
0.160
Allstate ↗ Q2645636 KW CROSS HIGH
humanindependentinsurancelinelistoperationsownedpersonal
SHARED TOKENS (8): "human", "independent", "insurance", "line", "list", "operations", "owned", "personal".
0.140
Mobile catering ↗ KW CROSS HIGH
businesscommonlycorporateemergencyeventsmodernperformed
SHARED TOKENS (7): "business", "commonly", "corporate", "emergency", "events", "modern", "performed".
0.140
Winery ↗ Q156362 KW CROSS HIGH
buildingbusinessequipmentlargerplacepropertywarehouses
SHARED TOKENS (7): "building", "business", "equipment", "larger", "place", "property", "warehouses".
0.140
activityhealthhumanlandpublicriskwildfire
SHARED TOKENS (7): "activity", "health", "human", "land", "public", "risk", "wildfire".
0.140
categoryestateeventhospitalityindustryplanningreal
SHARED TOKENS (7): "category", "estate", "event", "hospitality", "industry", "planning", "real".
0.140
lifemarketplacesoperatesplanningplatformsresourcestechnology
SHARED TOKENS (7): "life", "marketplaces", "operates", "planning", "platforms", "resources", "technology".
0.140
clientcompensationcontractinsuranceinsurersmultiplerepresents
SHARED TOKENS (7): "client", "compensation", "contract", "insurance", "insurers", "multiple", "represents".
0.120
associationindependentinsurancenationalofficesorganization
SHARED TOKENS (6): "association", "independent", "insurance", "national", "offices", "organization".
0.120
applicableauthorizeslandpermituseszoning
SHARED TOKENS (6): "applicable", "authorizes", "land", "permit", "uses", "zoning".
0.120
insuranceinsurerpolicyprivatepublictype
SHARED TOKENS (6): "insurance", "insurer", "policy", "private", "public", "type".
0.120
agriculturalcitiesidaholandmajorriver
SHARED TOKENS (6): "agricultural", "cities", "idaho", "land", "major", "river".
0.120
activitiesdocumenteventslaterofficialspecialty
SHARED TOKENS (6): "activities", "document", "events", "later", "official", "specialty".
0.100
boisebuildingidaholevelnational
SHARED TOKENS (5): "boise", "building", "idaho", "level", "national".
0.100
governmentissuedlawlocalmunicipality
SHARED TOKENS (5): "government", "issued", "law", "local", "municipality".
0.100
associatedcostsformhealthinsurance
SHARED TOKENS (5): "associated", "costs", "form", "health", "insurance".
◈ Frequently Asked Questions
Insurance Coverage × Wedding Events — Treasure Valley
HAIKU · HIGH GATE
What liability insurance coverage do wedding venues in Boise, Idaho typically require from event planners?
Most Boise-area wedding venues require general liability insurance with minimum coverage of $1 million to protect against bodily injury and property damage claims. This requirement protects both the venue operator and the event organizer during ceremonies and receptions held in Ada County establishments.
How does Nampa, Idaho's business licensing relate to wedding event insurance requirements?
Wedding service providers operating in Nampa must maintain liability insurance as part of their general business registration with Ada County authorities. Indemnity clauses in Nampa venue contracts typically require vendors to carry coverage that names the venue as an additional insured.
Are there specific insurance considerations for outdoor wedding events along the Boise River in the Treasure Valley?
Outdoor venues near the Boise River require liability coverage that extends to water-related incidents and public property damage in the metropolitan area. Boise Parks and Recreation typically mandates minimum coverage limits and proof of insurance before issuing event permits for riverfront locations.
What indemnity obligations apply to wedding planners working with multiple vendors in the Boise metropolitan area?
Wedding planners in the Boise area must carry liability insurance and contractually indemnify venues, caterers, and rental companies against third-party claims arising from the event. Mergers and acquisitions in the Treasure Valley's wedding services industry have standardized these indemnity requirements across Boise and Nampa locations.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Insurance Coverage × Wedding Events 26 QID bridges 319 edges 7,994 ext links 2026-07-17 21:32:18 UTC ca83197f7b383ccf
Insurance Coverage corridor ↗ Wedding Events corridor ↗ Wedding Events × Insurance Coverage ↗ boisestandard.org/standard ↗
Parent Corridors
Insurance Coverage × All Other Verticals