—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Insurance Coverage ↔ relates to ↔ Water Rights

18 Wikipedia bridge articles confirmed in both vertical ledgers. 273 deterministic cross-vertical edges. 6,911 external source links harvested. Every edge provenance-stamped. Every claim auditable.

18 QID Bridge Articles
273 Cross Edges
6,911 External Sources
322 Wikipedia Articles
20 🌲 Evergreen
179 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Insurance Coverage
× Water Rights
QID Bridge Articles
18
confirmed Wikipedia overlap
Total Cross Edges
273
External Sources Harvested
6,911
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Drought
score: 1.0000  ·  type: exact_title_cross  ·  31 shared tokens
QID Bridge Titles (18)
DroughtEasementSnake RiverBoise State UniversityIrrigationTreasure ValleyIdaho LegislatureBoise RiverNampa, IdahoBoise, IdahoAda County, IdahoStar, IdahoCaldwell, IdahoKuna, IdahoCanyon County, IdahoMeridian, IdahoEagle, IdahoIdaho Supreme Court
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanriveradacanyonwestpublicnorthwestwesternlocalregionamonglandvalleycollegeagriculturalapproximatelyhome
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:32:05 UTC
Content Hash
8f4d56cc4ba2f263
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
18 BRIDGES
Drought
Q43059 EXACT TITLE 1.000
QID OVERLAP: Q43059 in insurance_coverage (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (31): "agriculture", "annual", "availability", "become", "change", "costs", "date", "directly", "economic", "economy", "effects", "environmental", "experience", "health", "history", "increases", "july", "larger", "local", "loss".... | EXACT TITLE in water_rights: "Drought".
agricultureannualavailabilitybecomechangecostsdatedirectlyeconomiceconomyeffectsenvironmentalexperiencehealthhistoryincreasesjulylargerlocallossmonthsperiodpublicregionreportresultriversuppliessystemswater+1
A drought is a period of drier-than-normal conditions. A drought can last for days, months or years. Drought often has large impacts on the ecosystems and agriculture of affected regions, and causes harm to the local economy. Annual dry seasons in the tropics significantly increase the chances of a drought developing, with subsequent increased wildfire risks. Heat waves can significantly worsen drought conditions by increasing evapotranspiration. This dries out forests and other vegetation, and increases the amount of fuel for wildfires. Drought is a recurring feature of the climate in most parts of the world, becoming more extreme and less predictable due to climate change, which dendrochronological studies date back to 1900. There are three kinds of drought effects, environmental, economic and social. Environmental effects include the drying of wetlands, more and larger wildfires, loss of biodiversity. Economic impacts of drought result due to negative disruptions to agriculture and livestock farming (causing food insecurity), forestry, public water supplies, river navigation (due to e.g.: lower water levels), electric power supply (by affecting hydropower systems) and impacts on human health. Social and health costs include the negative effects on the health of people directly exposed to this phenomenon (excessive heat waves), high food costs, stress caused by failed harvests, water scarcity, etc. Drought can also lead to increased air pollution due to increased dust concentrations and wildfires. Prolonged droughts have caused mass migrations and humanitarian crisis. Examples for regions with increased drought risks are the Amazon basin, Australia, the Sahel region and India. For example, in 2005, parts of the Amazon basin experienced the worst drought in 100 years. Australia could experience more severe droughts and they could become more frequent in the future, a government-commissioned report said on July 6, 2008. The long Australian Millennial drought broke in 2010. The 2020–2022 Horn of Africa drought surpassed the severe drought in 2010–2011 in both duration and severity. Throughout history, humans have usually viewed droughts as disasters due to the impact on food availability and the rest of society.
onmental, economic and social. Environmental effects include the drying of wetlands, more and larger wildfires, loss of biodiversity. Economic impacts of drought result due to negative disruptions to agriculture and livestock farming (causing food insecurity), forestry, public water supplies, river navigation (due to e.g.: lower water levels), electric power supply (by affecting hydropower systems) and impacts on human health. Social and health costs include the negative effects on the health of people directly exposed to this phenomenon (excessive heat waves), high food costs, stress caused by failed harvests, water scarcity, etc. Drought can also lead to increased air pollution due to increased dust concentrations and wildfires. Prolonged droughts have caused mass migrations and humanitarian crisis. Examples for regions with increased drought risks are the Amazon basin, Australia, the Sahel region and India. For example, in 2005, parts of the Amazon basin experienced the worst drought in 100 years. Australia could experience more severe droughts and they could become more frequent in the future, a government-commissioned report said on July 6, 2008. The long Australian Millennial drought broke in 2010. The 2020–2022 Horn of Africa drought surpassed the severe drought in 2010–2011 in both duration and severity. Throughout history, humans have usually viewed droughts as disasters due to the impact on food availability and the rest of society.
Human activity can directly trigger exacerbating factors such as over-farming, excessive irrigation, deforestation, and erosion adversely impact the ability of the land to capture and hold water. In arid climates, the main source of erosion is wind. Erosion can be the result of material movement by the wind. The wind can cause small particles to be lifted and therefore moved to another region (deflation). Suspended particles within the wind may impact on solid objects causing erosion by abrasion (ecological succession). Wind erosion generally occurs in areas with little or no vegetation, often in areas where there is insufficient rainfall to support vegetation. Woody plant encroachment can increase soil porosity and therewith the chances of soil drought. Impacts Drought is one of the most complex and major natural hazards, and it has devastating impacts on the environment, economy, water resources, agriculture, and society worldwide. One can divide the impacts of droughts and water shortages into three groups: environmental, economic and social (including health). Environmental and economic impacts Environmental effects of droughts include: lower surface and subterranean water-levels, lower flow-levels (with a decrease below the minimum leading to direct danger for amphibian life), increased pollution of surface water, the drying out of wetlands, more and larger wildfires, higher deflation intensity, loss of biodiversity, worse health of trees and the appearance of pests and dendroid diseases. Drought-induced mortality of trees lacks in most climate models in their representation of forests as land carbon sink. Economic losses as a result of droughts include lower agricultural, forests, game and fishing output, higher food-production costs, lower energy-production levels in hydro plants, losses caused by depleted water tourism and transport revenue, problems with water supply for the energy sector and for technological processes in metallurgy, mining, the chemical, paper, wood, foodstuff industries etc., disruption of water supplies for municipal economies.
Easement
Q448405 EXACT TITLE 1.000
QID OVERLAP: Q448405 in insurance_coverage (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (16): "access", "among", "another", "best", "easements", "enter", "holder", "land", "law", "limited", "owned", "property", "providing", "public", "purpose", "real". | EXACT TITLE in insurance_coverage: "Easement". | EXACT TITLE in water_rights: "Easement".
accessamonganotherbesteasementsenterholderlandlawlimitedownedpropertyprovidingpublicpurposereal
ated purpose. For example, an easement may allow someone to use a road on their neighbor's land to get to their own.' Another example is someone's right to fish in a privately owned pond, or to have access to a public beach. The rights of an easement holder vary substantially among jurisdictions. Types Historically, common law courts would enforce only four types of easements: Easements of way (also known as Right-of-way) Easements of support (pertaining to excavations) Easements of "light and air" Rights pertaining to artificial waterways Courts now recognize more varieties of easements, but these original four categories still form the foundation of easement law.
As defined by Evershed MR in Re Ellenborough Park [1956] Ch 131, an easement requires the existence of at least two pieces of land. The land with the benefit of the easement is the dominant estate or dominant tenement, while the land burdened by the easement is the servient estate or servient tenement. For example, the owner of parcel A holds an easement to use a driveway on parcel B to gain access to A's house. Here, parcel A is the dominant estate, receiving the benefit, and parcel B is the servient estate, granting the benefit or suffering the burden. Public or private A private easement is held by private individuals or entities.
Appurtenant or in gross In the US, an easement appurtenant is one that benefits the dominant estate and "runs with the land" and so generally transfers automatically when the dominant estate is transferred. An appurtenant easement allows property owners to access land that is only accessible through a neighbor's land. Conversely, an easement in gross benefits an individual or a legal entity, rather than a dominant estate. The easement can be for a personal use (for example, an easement to use a boat ramp) or a commercial use (for example, an easement to a railroad company to cross property to build and maintain a rail line). Historically, an easement in gross was neither assignable nor inheritable, but commercial easements are now freely transferable to a third party. They are divisible but must be exclusive (the original owner no longer uses it and exclusive to easement holder) and all holders of the easement must agree to divide.
Snake River
Q272074 EXACT TITLE 1.000
QID OVERLAP: Q272074 in insurance_coverage (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (32): "agencies", "canyon", "century", "channel", "commercial", "construction", "control", "dams", "flood", "flooding", "history", "idaho", "irrigation", "limited", "major", "national", "northwest", "policy", "private", "programs".... | EXACT TITLE in water_rights: "Snake River".
agenciescanyoncenturychannelcommercialconstructioncontroldamsfloodfloodinghistoryidahoirrigationlimitedmajornationalnorthwestpolicyprivateprogramsproposedpublicrapidregionriverrolesectionsouthutilitiesvalley+2
sh. The Snake and its tributary, the Salmon River, host the longest sockeye salmon run in the world, stretching 900 miles (1,400 km) from the Pacific to Redfish Lake in Idaho. Since the 1950s, public agencies, tribal governments and private utilities have invested heavily in fishery restoration and hatchery programs, with limited success.
As gold mining declined in the late 19th century, the wheat industry boomed in the Palouse of southeast Washington. By the 1870s, the Oregon Steam Navigation Company was operating seven steamboats transporting grain from the Snake River to lower Columbia River ports. These were the Harvest Queen, John Gates, Spokane, Annie Faxon, Mountain Queen, R.R. Thompson, and Wide West. In the 1890s, a huge copper deposit was discovered at Eureka Bar in Hells Canyon. Several ships transported ore from there to Lewiston, including Imnaha, Mountain Gem, and Norma. In 1893 the Annie Faxon suffered a boiler explosion and sank on the Snake below Lewiston, killing five people. Starting in the 1880s, the Army Corps began dredging the Snake River below Lewiston to maintain a 5-foot (1.5 m) deep navigation channel. River traffic declined rapidly once railroads arrived. By 1899, the Union Pacific line along the south bank of the Snake River had reached Riparia, Washington. It then joined forces with the Northern Pacific Railroad, which was building a line along the north bank, to build the shared Camas Prairie Railroad the rest of the way to Lewiston, which it reached in 1908. The Open River Transportation Company, which operated steamboats between Lewiston and Celilo Falls on the Columbia, went bankrupt in 1912. The 1915 completion of the Celilo Canal made it much easier for boats from the upper Columbia and Snake to reach Portland, and the Columbia River Transportation Company began operating a water route between Lewiston and Portland. Still, steamboats were unable to compete with railroads on speed and efficiency. The last steamboat on the lower Snake ran in 1920. Once the railroads monopolized grain shipments, they raised shipping rates, to farmers' consternation. In 1934, political activist Herbert G. West organized the Inland Empire Waterways Association (IEWA), to promote an "open river" – a deep-water shipping channel on the Snake and Columbia Rivers that could compete with rail. The IEWA initially pushed for improvements such as bigger locks at Bonneville Dam in 1938 and the construction of McNary Dam on the Columbia, which would improve navigation to the mouth of the Snake. In 1941 a bill was first introduced in Congress authorizing the Army Corps to develop the lower Snake River. The 1941 bill failed, but after several years of debate, Congress finally authorized the Snake River development in 1945. Early plans included anywhere from six to ten low dams for the lower Snake. Eventually this was reduced to four bigger dams, which would lower costs, but would require what at the time were the tallest navigation locks in the world, at over 100 feet (30 m). Tribes, state wildlife agencies and the fishing industry opposed the dams, arguing that they would kill too many salmon. In 1947, the U.S. Department of the Interior proposed a ten-year moratorium on dam construction while the fishery problem was studied. With the onset of the Cold War, rising electricity demand in the Pacific Northwest – particularly at the nearby Hanford nuclear site – turned the project's focus towards hydropower. By 1948, the Army Corps estimated that over 80 percent of the economic benefits would come from power, and only 15 percent from navigation. Dam opponents countered that if the primary objective was now power, other dam sites existed in the Northwest that would have less impact on fish. These objections proved futile, as the lower Snake River dams were already authorized, and the federal government had little interest in studying alternatives. While opponents continued to stall the project for a few more years, Washington Senator Warren G.
Populations of anadromous fish began to decline in the late 1800s due to the impact of commercial fishing, logging, mining and agriculture, but even in the 1930s, returning fall chinook alone numbered 500,000. Populations further collapsed once dams were built on the lower Snake and Columbia Rivers, and Hells Canyon Dam blocked access to the upper Snake. Wild Snake River spring and summer chinook returns declined from 130,000 in the 1950s to less than 5,000 in the 1990s. Wild steelhead returns followed a similar pattern, falling from 110,000 in the 1960s to less than 10,000 in the 1990s. Spring, summer and fall-run chinook were all listed as threatened in 1992. Snake River steelhead were also listed as threatened in 1997. Wild chinook salmon and steelhead continued to decline into the 1990s, but have begun an unsteady recovery since 2000, with both chinook and steelhead returns up to 20,000–30,000 in some years. Coho salmon had disappeared from the Snake River by the 1980s, they were reintroduced to the watershed in 1995. Snake River sockeye once numbered to up 150,000 adults. Between 24,000 and 30,000 sockeye returned to Wallowa Lake in the Grande Ronde River watershed, but the run was eliminated by 1905 due to overharvest and unscreened irrigation diversions. The Payette Lake population once numbering up to 100,000 was blocked by the Black Canyon Dam in 1924. Sockeye in the Yellowbelly, Stanley, and Pettit Lakes of the Sawtooth basin were eradicated by management actions of the Idaho Department of Fish and Game in the 1950s, and irrigation diversions lead to the extirpation of the Pettit Lake population. Snake River sockeye returns declined to 4,500 in the 1950s and only a few dozen by the late 1960s. Snake River sockeye were listed as endangered in 1991. Numerous hatcheries are operated by agencies such as the Army Corps, Idaho Power, the Bonneville Power Administration, the U.S. Bureau of Indian Affairs and the U.S. Fish and Wildlife Service, to supplement wild fish populations. Hatcheries release about 33 million salmon and steelhead smolt into the Snake River watershed each year. However, the survival rate for hatchery fish is poor. Just 0.4 percent of hatchery chinook and 1.5 percent of hatchery steelhead returned as adults, as measured at Lower Granite Dam between 2007 and 2016. Upstream of the four lower dams, the Snake River watershed contains some of the best remaining spawning habitat in the Columbia River system, particularly along the Clearwater and Salmon Rivers; the latter is one of the longest undammed rivers in the continental US. A much depleted sockeye salmon run continues to spawn in Redfish Lake near Stanley, Idaho, more than 900 miles (1,400 km) inland from the Pacific Ocean.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in insurance_coverage (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (19): "among", "boise", "business", "classified", "college", "education", "engineering", "health", "idaho", "independent", "member", "million", "program", "programs", "public", "reported", "research", "university", "west". | EXACT TITLE in insurance_coverage: "Boise State University". | EXACT TITLE in water_rights: "Boise State University".
amongboisebusinessclassifiedcollegeeducationengineeringhealthidahoindependentmembermillionprogramprogramspublicreportedresearchuniversitywest
s and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Irrigation
Q11453 EXACT TITLE 1.000
QID OVERLAP: Q11453 in insurance_coverage (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (35): "agricultural", "agriculture", "application", "changes", "consolidation", "control", "directly", "distribution", "effects", "environmental", "form", "growth", "irrigation", "land", "landscape", "maintain", "management", "network", "occurs", "operations".... | EXACT TITLE in insurance_coverage: "Irrigation". | EXACT TITLE in water_rights: "Irrigation".
agriculturalagricultureapplicationchangesconsolidationcontroldirectlydistributioneffectsenvironmentalformgrowthirrigationlandlandscapemaintainmanagementnetworkoccursoperationsoutsidepracticepracticesprotectqualityrequiredrequiringresultriverrole+5
Surface irrigation, also known as gravity irrigation, is the oldest form of irrigation and has been in use for thousands of years. In surface (furrow, flood, or level basin) irrigation systems, water moves across the surface of agricultural lands to wet it and infiltrate into the soil. Water moves by following gravity or the slope of the land. Surface irrigation can be subdivided into furrow, border strip, or basin irrigation. It is often called flood irrigation when irrigation results in flooding or near-flooding of the cultivated land. Historically, surface irrigation has been the most common method for irrigating agricultural land in most parts of the world. The water application efficiency of surface irrigation is typically lower than that of other irrigation methods, due in part to limited control over applied depths. Surface irrigation involves significantly lower capital costs and energy requirements than pressurized irrigation systems. Hence, it is often the irrigation choice for developing nations, for low-value crops, and for large fields. Where water levels from the irrigation source permit, they are controlled by dikes (levees), usually plugged with soil. This is often seen in terraced rice fields (rice paddies), where the method is used to flood or control water levels in each distinct field.
Field Water Efficiency (%) = (Water Transpired by Crop ÷ Water Applied to Field) x 100 Increased irrigation efficiency has several positive outcomes for the farmer, the community, and the wider environment. Low application efficiency indicates that the amount of water applied to the field exceeds the crop or field requirements. Increasing the application efficiency means that the amount of crop produced per unit of water increases. Improved efficiency may be achieved by applying less water to an existing field or by using water more wisely, thereby achieving higher yields in the same area of land. In some parts of the world, farmers are charged for irrigation water; hence, over-application has a direct financial cost to the farmer. Irrigation often requires pumping energy (electricity or fossil fuels) to deliver water to the field or to supply the required operating pressure. Hence, increased efficiency will reduce both water and energy costs per unit of agricultural production. A reduction in water use on one field may allow the farmer to irrigate a larger area of land, increasing total agricultural production. Low efficiency usually means that excess water is lost through seepage or runoff, both of which can result in loss of crop nutrients or pesticides with potential adverse impacts on the surrounding environment. Improving the efficiency of irrigation is usually achieved in one of two ways: either by improving the system design or by optimizing the irrigation management. Improving system design includes converting from one form of irrigation to another (e.g., from furrow to drip irrigation) and making small changes to the current system (e.g., adjusting flow rates and operating pressures).
Archaeological investigations have found evidence of irrigation in areas lacking sufficient natural rainfall to support rainfed agriculture. Some of the earliest known use of the technology dates to the 6th millennium BCE in Khuzistan in the south-west of Iran. The site of Choga Mami, in present-day Iraq on the border with Iran, is believed to be the earliest to show the first canal irrigation in operation at about 6000 BCE. Irrigation was used to manipulate water in the alluvial plains of the Indus Valley Civilization, with its application estimated to have begun around 4500 BCE and to have drastically increased the size and prosperity of their agricultural settlements. The Indus Valley Civilization developed sophisticated irrigation and water-storage systems, including artificial reservoirs at Girnar dated to 3000 BCE, and an early canal irrigation system from c. 2600 BCE. Large-scale agriculture was practiced, with an extensive network of canals used for irrigation. Farmers in the Mesopotamian plain used irrigation from at least the third millennium BCE. They developed perennial irrigation, regularly watering crops throughout the growing season by coaxing water through a matrix of small channels formed in the field. Ancient Egyptians practiced basin irrigation using the flooding of the Nile to inundate land plots which had been surrounded by dikes. The flood water remained until the fertile sediment had settled before the engineers returned the surplus to the watercourse. There is evidence of the ancient Egyptian pharaoh Amenemhet III in the twelfth dynasty (about 1800 BCE) using the natural lake of the Faiyum Oasis as a reservoir to store surpluses of water for use during dry seasons.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in insurance_coverage (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (14): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in insurance_coverage: "Treasure Valley". | EXACT TITLE in water_rights: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalmetropolitanregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Idaho Legislature
Q4256974 EXACT TITLE 0.940
QID OVERLAP: Q4256974 in insurance_coverage (tier:branch) and water_rights (tier:evergreen). | SHARED TOKENS (12): "approximately", "boise", "data", "either", "even", "government", "idaho", "legislature", "population", "residents", "single", "south". | EXACT TITLE in water_rights: "Idaho Legislature".
approximatelyboisedataeitherevengovernmentidaholegislaturepopulationresidentssinglesouth
es, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
hich each elect one state senator and two representatives. There are no term limits for reelection of members of either chamber. Both chambers of the Legislature convene at the Idaho State Capitol in Boise. The crossing of upper and lower chamber of their districts into a single representing constituency is found in only seven of the fifty U.S. state legislatures, these are: Idaho, Arizona, Maryland, New Jersey, North Dakota, South Dakota, and Washington. Based on 2010 United States Decennial Census data, each legislative district in the state of Idaho had approximately 44,788 residents. Based on subsequent 2020 U.S.
Responsibilities According to the Legislature's website, the Idaho Legislature is responsible for translating the public will into policy for the state, levying taxes, appropriating public funds, and overseeing the administration of state agencies. These responsibilities are carried out through the legislative process - laws passed by elected representatives of the people, legislators. Location and time of operation The Idaho Legislature normally convenes at the Idaho State Capitol in downtown Boise. The Legislature meets annually from January until mid-March, although sessions have been known to last into May. The governor of Idaho may also call special sessions at any time. The Idaho State Capitol Commission was created by Governor Phil Batt in 1998. The Commission undertook the leading role of extensively remodeling the capitol building starting in 2007. The 2008 and 2009 sessions of the Idaho Legislature met in converted courtrooms in the old Ada County Courthouse.
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in insurance_coverage (tier:evergreen) and water_rights (tier:evergreen). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "river", "western". | EXACT TITLE in insurance_coverage: "Boise River". | EXACT TITLE in water_rights: "Boise River".
agriculturalapproximatelyboiseidahoriverwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (15): "according", "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeridianmetropolitannampanorthwestpopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (15): "ada", "annual", "boise", "capital", "home", "idaho", "level", "locally", "major", "manufacturing", "metropolitan", "population", "river", "treasure", "valley".
adaannualboisecapitalhomeidaholevellocallymajormanufacturingmetropolitanpopulationrivertreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "home", "idaho", "local", "metropolitan", "northwest", "population", "private", "streets".
adaboisecapitalhomeidaholocalmetropolitannorthwestpopulationprivatestreets
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Star, Idaho
Q1516815 QID OVERLAP 0.700
QID OVERLAP: Q1516815 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (10): "ada", "boise", "canyon", "century", "idaho", "metropolitan", "population", "schools", "star", "west".
adaboisecanyoncenturyidahometropolitanpopulationschoolsstarwest
Star is a city in northwestern Ada County, Idaho, with parts stretching into neighboring Canyon County. The population was 11,117 at the 2020 census, up from 5,793 in 2010. It was named in the 19th century by travelers on their way to Middleton and Boise who used the star on the school house to find east and west. The name stuck and it became Star, Idaho.
on the school house to find east and west. The name stuck and it became Star, Idaho. Today, it is a rapidly growing suburb of Boise and its schools are shared with Middleton School District and West Ada School District. Star is part of the Boise metropolitan area. Geography Star is located at 43°41′39″N 116°29′25″W (43.694084, -116.490225), at an elevation of 2,470 feet (753 m) above sea level.
2000 census As of the census of 2000, there were 1,795 people in 631 households, including 485 families, in the city. The population density was 2,092.5 inhabitants per square mile (807.9/km2). There were 681 housing units at an average density of 793.9 per square mile (306.5/km2). The racial makeup of the city was 92.87% White, 0.28% African American, 0.95% Native American, 0.22% Asian, 0.06% Pacific Islander, 0.89% from other races, and 4.74% from two or more races. Hispanic or Latino of any race were 4.29%. Of the 631 households 48.0% had children under the age of 18 living with them, 60.2% were married couples living together, 11.7% had a female householder with no husband present, and 23.1% were non-families. 16.8% of households were one person and 4.1% were one person aged 65 or older. The average household size was 2.82 and the average family size was 3.19. The age distribution was 33.2% under the age of 18, 9.9% from 18 to 24, 36.4% from 25 to 44, 14.8% from 45 to 64, and 5.7% 65 or older. The median age was 28 years. For every 100 females, there were 97.0 males. For every 100 females age 18 and over, there were 92.8 males. The median household income was $42,337 and the median family income was $46,458. Males had a median income of $31,028 versus $22,625 for females. The per capita income for the city was $15,864. About 5.4% of families and 8.5% of the population were below the poverty line, including 10.7% of those under age 18 and 13.6% of those age 65 or over. Education All of Star in Ada County is in the West Ada School District (Meridian Joint School District 2).
Caldwell, Idaho
Q849592 QID OVERLAP 0.700
QID OVERLAP: Q849592 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (10): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Kuna, Idaho
QID OVERLAP 0.660
QID OVERLAP: Q1515177 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "metropolitan", "percent", "population".
adaadditionalboiseidahokunametropolitanpercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Eagle, Idaho
Q1516870 QID OVERLAP 0.600
QID OVERLAP: Q1516870 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
adaboiseidahonorthwestpopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
In popular culture The 2008 show The Baby Borrowers was filmed in Eagle. Eagle was the filming location for the 1980 film Bronco Billy. Notable people Blake Bodily, soccer player Larry Craig, former U.S.
Idaho Supreme Court
Q5987471 QID OVERLAP 0.560
QID OVERLAP: Q5987471 in insurance_coverage (tier:branch) and water_rights (tier:branch). | SHARED TOKENS (3): "building", "decisions", "idaho".
buildingdecisionsidaho
he Idaho Supreme Court are binding on all other Idaho state courts. The only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
Video coverage The Idaho Supreme Court first permitted live video and audio coverage from its chambers in late 1978. See also Courts of Idaho References External links Idaho State Judiciary Idaho Architecture Project.org - Idaho Supreme Court building American Courthouses – Idaho Supreme Court building
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
255 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP255 edges
🌲 EVERGREEN3 edges
0.650
adabeganboisebureauconstructioncontroldamsdirectlyfederalfloodformsidahoirrigationleveloperatingoperationalprimaryprivatepurposeriver
SHARED TOKENS (21): "ada", "began", "boise", "bureau", "construction", "control", "dams", "directly", "federal", "flood", "forms", "idaho", "irrigation", "level", "operating", "operational", "primary", "private", "purpose", "river".... | URL->B (1): https://www.usbr.gov/pn/hydromet/boipaytea.html. | EXACT TITLE in water_rights: "Lucky Peak Dam".
0.650
accurateactadequateadministeredadministrationagencyassessmentsavailabilitybillionclaimsconstructionconsumerscontrolcostcostsdamagedevelopmentemergencyenforcementexisting
SHARED TOKENS (43): "accurate", "act", "adequate", "administered", "administration", "agency", "assessments", "availability", "billion", "claims", "construction", "consumers", "control", "cost", "costs", "damage", "development", "emergency", "enforcement", "existing".... | URL->A (1): http://www.floodsmart.gov/. | EXACT TITLE in insurance_coverage: "National Flood Insurance Program".
0.650
adaboardboisecanyoncollegecomprehensivecwidevelopmenteducationgovernedidahonampapopulationprimaryprogramspublicreportedresidentsservedtechnical
SHARED TOKENS (24): "ada", "board", "boise", "canyon", "college", "comprehensive", "cwi", "development", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public", "reported", "residents", "served", "technical".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in insurance_coverage: "College of Western Idaho". | EXACT TITLE in water_rights: "College of Western Idaho".
🌿 BRANCH178 edges
0.590
administrativeagencydecisionsdepartmentestablishedidahoindustriallaborlegislatureresponsiblesystemworkers
SHARED TOKENS (12): "administrative", "agency", "decisions", "department", "established", "idaho", "industrial", "labor", "legislature", "responsible", "system", "workers". | URL->A (1): https://iic.idaho.gov/. | EXACT TITLE in insurance_coverage: "Idaho Industrial Commission".
0.500
amongapproximatelyboiseclassifiedestablishedidaholatermainoperatesprofessionalpublicresearchschoolsstatewideuniversity
SHARED TOKENS (15): "among", "approximately", "boise", "classified", "established", "idaho", "later", "main", "operates", "professional", "public", "research", "schools", "statewide", "university". | EXACT TITLE in water_rights: "University of Idaho".
0.500
Well ↗ Q43483 EXACT TITLE
accessanotherconstructioncontainscreatedateenvironmentalexcavationhistoricallyleastmodernproviderequireresourcessitestructuresurroundingtreatmentuseswater
SHARED TOKENS (20): "access", "another", "construction", "contains", "create", "date", "environmental", "excavation", "historically", "least", "modern", "provide", "require", "resources", "site", "structure", "surrounding", "treatment", "uses", "water". | EXACT TITLE in insurance_coverage: "Well". | EXACT TITLE in water_rights: "Well".
0.500
Land use ↗ Q1165944 EXACT TITLE
agriculturalanotherassessmentscategoriescategorychangechangesclassificationdatadirectlyeffectsenvironmentalhistoricallylandland-usemajormanagementmodelingpracticesprimary
SHARED TOKENS (25): "agricultural", "another", "assessments", "categories", "category", "change", "changes", "classification", "data", "directly", "effects", "environmental", "historically", "land", "land-use", "major", "management", "modeling", "practices", "primary".... | EXACT TITLE in water_rights: "Land use".
0.500
Idaho ↗ Q1221 EXACT TITLE
agriculturalagricultureapproximatelyassociatedbestboisecapitalcenturycontainscropeconomygeographicidahoisolatedjulylandmanufacturingmillionnationalnorthwest
SHARED TOKENS (33): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "century", "contains", "crop", "economy", "geographic", "idaho", "isolated", "july", "land", "manufacturing", "million", "national", "northwest".... | EXACT TITLE in insurance_coverage: "Idaho". | EXACT TITLE in water_rights: "Idaho".
0.500
additionaladequateagriculturalboundariescapacitycenturycostcostsdepartmentformationindustrialoccursprocessesrateresourcessourcespacewater
SHARED TOKENS (18): "additional", "adequate", "agricultural", "boundaries", "capacity", "century", "cost", "costs", "department", "formation", "industrial", "occurs", "processes", "rate", "resources", "source", "space", "water". | EXACT TITLE in water_rights: "Geothermal energy".
0.500
anothercommonlydesigndistributionengineeringgoverninglocalmainmaintainedqualitystudysuppliessystemsystemswater
SHARED TOKENS (15): "another", "commonly", "design", "distribution", "engineering", "governing", "local", "main", "maintained", "quality", "study", "supplies", "system", "systems", "water". | EXACT TITLE in water_rights: "Hydrogeology".
0.500
accordingagencyassociationbecomebureaubusinessbusinessescenturycodeconsumerscustomerevenjulylocalmarketingmarketplaceoperatingorganizationspolicypractices
SHARED TOKENS (28): "according", "agency", "association", "become", "bureau", "business", "businesses", "century", "code", "consumers", "customer", "even", "july", "local", "marketing", "marketplace", "operating", "organizations", "policy", "practices".... | EXACT TITLE in insurance_coverage: "Better Business Bureau".
0.500
administrationboardcouncildatadatabasedepartmentdeterminedirectorsexperienceheadquarteredinformationlaborlossnationaloperatesrateratingreportedsupportssystems
SHARED TOKENS (21): "administration", "board", "council", "data", "database", "department", "determine", "directors", "experience", "headquartered", "information", "labor", "loss", "national", "operates", "rate", "rating", "reported", "supports", "systems".... | EXACT TITLE in insurance_coverage: "National Council on Compensation Insurance".
0.500
Wildfire ↗ Q169950 EXACT TITLE
changeclassifiedcreatecreatesdependdirecteconomiceffectsequipmentfiregrowthhealthlandland-uselevellinesmanagementmitigationmodernperiods
SHARED TOKENS (27): "change", "classified", "create", "creates", "depend", "direct", "economic", "effects", "equipment", "fire", "growth", "health", "land", "land-use", "level", "lines", "management", "mitigation", "modern", "periods".... | EXACT TITLE in insurance_coverage: "Wildfire". | EXACT TITLE in water_rights: "Wildfire".
0.500
Wheat ↗ Q15645384 EXACT TITLE
centurycropdemandessentialgeneralgrouplandlargermajormakingmillionpopulationqualityrecordrelativelysource
SHARED TOKENS (16): "century", "crop", "demand", "essential", "general", "group", "land", "larger", "major", "making", "million", "population", "quality", "record", "relatively", "source". | EXACT TITLE in water_rights: "Wheat".
0.500
accordingamonganotherapplyassessmentsclassifiedcomprehensivecontrolcorporatedatadecisionsdefinitionsdesigndevelopmentengineeringevaluationevenfinancehealthidentifying
SHARED TOKENS (39): "according", "among", "another", "apply", "assessments", "classified", "comprehensive", "control", "corporate", "data", "decisions", "definitions", "design", "development", "engineering", "evaluation", "even", "finance", "health", "identifying".... | EXACT TITLE in insurance_coverage: "Risk management". | EXACT TITLE in water_rights: "Risk management".
0.500
Groundwater ↗ Q161598 EXACT TITLE
agriculturalagriculturebecomebillioncapacitychangecommonlycontainsdistributioneffectsenvironmentalformformationindustriallandlevellossmajormunicipaloperating
SHARED TOKENS (35): "agricultural", "agriculture", "become", "billion", "capacity", "change", "commonly", "contains", "distribution", "effects", "environmental", "form", "formation", "industrial", "land", "level", "loss", "major", "municipal", "operating".... | EXACT TITLE in water_rights: "Groundwater".
0.500
actamongassociationauthoritybureauconstructioncontractsdepartmentestablishedextendfederalfundirrigationlandlaterlawmajormeridiannationalprogram
SHARED TOKENS (30): "act", "among", "association", "authority", "bureau", "construction", "contracts", "department", "established", "extend", "federal", "fund", "irrigation", "land", "later", "law", "major", "meridian", "national", "program".... | EXACT TITLE in water_rights: "Newlands Reclamation Act".
0.500
accordingadministeredagencyamongassociationbusinesscostscoveringentityevidencefinancegovernmenthealthindividualmembernationalplanspolicyprivateprovide
SHARED TOKENS (29): "according", "administered", "agency", "among", "association", "business", "costs", "covering", "entity", "evidence", "finance", "government", "health", "individual", "member", "national", "plans", "policy", "private", "provide".... | EXACT TITLE in insurance_coverage: "Health insurance".
0.500
additionalapplybeyondbusinesscapacitycategoriesconductdescriptiondirectorseitherentityextendgeneralgenerallyidentifiesidentifymeansofficersoperationspolicies
SHARED TOKENS (29): "additional", "apply", "beyond", "business", "capacity", "categories", "conduct", "description", "directors", "either", "entity", "extend", "general", "generally", "identifies", "identify", "means", "officers", "operations", "policies".... | EXACT TITLE in insurance_coverage: "Additional insured".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingdeterminedevelopmentformgovernmentgrowthindustriallandland-uselocalmunicipalityplanningpolicypropertyregulationsregulatoryrulessinglesystems
SHARED TOKENS (22): "allowing", "building", "determine", "development", "form", "government", "growth", "industrial", "land", "land-use", "local", "municipality", "planning", "policy", "property", "regulations", "regulatory", "rules", "single", "systems".... | EXACT TITLE in insurance_coverage: "Zoning". | EXACT TITLE in water_rights: "Zoning".
0.500
actagencybecomebureaudeliverydepartmentdevelopmentestablishedfederalgovernmentirrigationlawmanagementmillionprogramprovidingprovisionsresourcesalesource
SHARED TOKENS (22): "act", "agency", "become", "bureau", "delivery", "department", "development", "established", "federal", "government", "irrigation", "law", "management", "million", "program", "providing", "provisions", "resource", "sale", "source".... | EXACT TITLE in water_rights: "Bureau of Reclamation".
0.500
Dam ↗ Q12323 EXACT TITLE
additionalapplicationavailabilitybeganbuildingcenturyclassifiedconstructioncriticaldamsdesignengineeringexcessfloodfloodingfunctionsgoverninghealthindustrialirrigation
SHARED TOKENS (41): "additional", "application", "availability", "began", "building", "century", "classified", "construction", "critical", "dams", "design", "engineering", "excess", "flood", "flooding", "functions", "governing", "health", "industrial", "irrigation".... | EXACT TITLE in insurance_coverage: "Dam". | EXACT TITLE in water_rights: "Dam".
0.500
Yelp ↗ Q2299611 EXACT TITLE
acquiredannualapproximatelybecomebusinessbusinessescomcompetingdirectoryexpandedheadquarteredinformationlatermilliononlineoperatespracticepracticespublicpublished
SHARED TOKENS (29): "acquired", "annual", "approximately", "become", "business", "businesses", "com", "competing", "directory", "expanded", "headquartered", "information", "later", "million", "online", "operates", "practice", "practices", "public", "published".... | EXACT TITLE in insurance_coverage: "Yelp".
0.500
Stormwater ↗ Q1421263 EXACT TITLE
becomecreatedemanddirectlyfloodinglandmajorpopulationrelatedresourcestormwatertimingtreatmentvolumewater
SHARED TOKENS (15): "become", "create", "demand", "directly", "flooding", "land", "major", "population", "related", "resource", "stormwater", "timing", "treatment", "volume", "water". | EXACT TITLE in insurance_coverage: "Stormwater". | EXACT TITLE in water_rights: "Stormwater".
0.500
agriculturalanotherindustrialmainmeanmunicipaloptionsprocessprocessespurposetreatedtreatmenttypesuseswater
SHARED TOKENS (15): "agricultural", "another", "industrial", "main", "mean", "municipal", "options", "process", "processes", "purpose", "treated", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Wastewater treatment".
0.500
analysisbestbusinessdatadecisionsdescriptionmakingmanagementmodelingonlineperformanceplanningpracticesrelatedthereforetools
SHARED TOKENS (16): "analysis", "best", "business", "data", "decisions", "description", "making", "management", "modeling", "online", "performance", "planning", "practices", "related", "therefore", "tools". | EXACT TITLE in insurance_coverage: "Business analytics".
0.500
administrativeapproximatelybecomebillioncenturychangeclassifiedcreatecreatescurrentdevelopmenteconomiceducationeitherenvironmentalessentialformedgrowthhealthinstitutional
SHARED TOKENS (47): "administrative", "approximately", "become", "billion", "century", "change", "classified", "create", "creates", "current", "development", "economic", "education", "either", "environmental", "essential", "formed", "growth", "health", "institutional".... | EXACT TITLE in water_rights: "Urbanization".
0.500
agricultureboisebureaucivilengineeringidahoirrigationlevelnationaloperatedprimaryprovidepurposeriverwaterwestern
SHARED TOKENS (16): "agriculture", "boise", "bureau", "civil", "engineering", "idaho", "irrigation", "level", "national", "operated", "primary", "provide", "purpose", "river", "water", "western". | EXACT TITLE in water_rights: "Arrowrock Dam".
0.500
agreementsassociatedclaimscontractsdeliverydeterminesevidencefinalformformsgenerallylegallylosspoliciespolicypriorrequiredrulespecificsubject
SHARED TOKENS (21): "agreements", "associated", "claims", "contracts", "delivery", "determines", "evidence", "final", "form", "forms", "generally", "legally", "loss", "policies", "policy", "prior", "required", "rule", "specific", "subject".... | EXACT TITLE in insurance_coverage: "Insurance policy".
0.500
Deed ↗ Q705914 EXACT TITLE
associatedcommonlyconcerningdeedsdeliverydocumentlawlegallicensesmodernownershipperiodpracticepropertytitle
SHARED TOKENS (15): "associated", "commonly", "concerning", "deeds", "delivery", "document", "law", "legal", "licenses", "modern", "ownership", "period", "practice", "property", "title". | EXACT TITLE in insurance_coverage: "Deed". | EXACT TITLE in water_rights: "Deed".
0.500
Hydrology ↗ Q42250 EXACT TITLE
civildatadistributionengineeringenvironmentalmanagementmarinephysicalplanningpolicyqualityrelatedresearchresourcesstudywater
SHARED TOKENS (16): "civil", "data", "distribution", "engineering", "environmental", "management", "marine", "physical", "planning", "policy", "quality", "related", "research", "resources", "study", "water". | EXACT TITLE in water_rights: "Hydrology".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactaffordableannualassetsbecomebillioncostcostseconomicestablishedexpandedfederalformedgeneralgovernmenthealthhomelimitedmaintain
SHARED TOKENS (42): "access", "act", "affordable", "annual", "assets", "become", "billion", "cost", "costs", "economic", "established", "expanded", "federal", "formed", "general", "government", "health", "home", "limited", "maintain".... | EXACT TITLE in insurance_coverage: "Medicaid".
0.500
actadditionalaffordablecallscannotchangescostsdeliveryeducationessentialexistingexpandedfederalhealthincreasesindividualintendedlawlegallist
SHARED TOKENS (41): "act", "additional", "affordable", "calls", "cannot", "changes", "costs", "delivery", "education", "essential", "existing", "expanded", "federal", "health", "increases", "individual", "intended", "law", "legal", "list".... | EXACT TITLE in insurance_coverage: "Affordable Care Act".
0.500
analysisbestbroaderbuildingchangechangescontroldescribingeffectseitherengineeringfloodfloodingindividualinfrastructurelandscapelevelmanagementmitigationpractice
SHARED TOKENS (29): "analysis", "best", "broader", "building", "change", "changes", "control", "describing", "effects", "either", "engineering", "flood", "flooding", "individual", "infrastructure", "landscape", "level", "management", "mitigation", "practice".... | EXACT TITLE in insurance_coverage: "Flood management".
0.500
agenciesbeyondcollegecontinuingdevelopmenteconomiceducationeitherformsfrequentlygeneralgovernmentinstitutionalintendedleastonlineprofessionalprogramsratherseparate
SHARED TOKENS (25): "agencies", "beyond", "college", "continuing", "development", "economic", "education", "either", "forms", "frequently", "general", "government", "institutional", "intended", "least", "online", "professional", "programs", "rather", "separate".... | EXACT TITLE in insurance_coverage: "Continuing education". | EXACT TITLE in water_rights: "Continuing education".
0.500
Title insurance ↗ EXACT TITLE
businessbuyerscommercialcommonlycostsdeedsdefectsestateevidencefireformformedgeneralgenerallyindependentinstitutionallandlawlegallender
SHARED TOKENS (42): "business", "buyers", "commercial", "commonly", "costs", "deeds", "defects", "estate", "evidence", "fire", "form", "formed", "general", "generally", "independent", "institutional", "land", "law", "legal", "lender".... | EXACT TITLE in insurance_coverage: "Title insurance".
0.500
affectclaimclaimscostcostsdamageevenexpresslyfinancingformedfundgeneralgroupindividuallegallossmembermodernpoliciespolicy
SHARED TOKENS (30): "affect", "claim", "claims", "cost", "costs", "damage", "even", "expressly", "financing", "formed", "fund", "general", "group", "individual", "legal", "loss", "member", "modern", "policies", "policy".... | EXACT TITLE in insurance_coverage: "Liability insurance".
0.500
assetsbroadercapitalcategoryconstructiondamsdirectlyeconomiceitheremploymentenvironmentalfacilitiesgovernmenthealthinfrastructuremunicipaloperatorphysicalprivateprotection
SHARED TOKENS (26): "assets", "broader", "capital", "category", "construction", "dams", "directly", "economic", "either", "employment", "environmental", "facilities", "government", "health", "infrastructure", "municipal", "operator", "physical", "private", "protection".... | EXACT TITLE in insurance_coverage: "Public works". | EXACT TITLE in water_rights: "Public works".
0.500
accordingagriculturalagriculturechangesclassificationcontainingenvironmentalformformshomeindustrialmakingphysicalprimaryrequired
SHARED TOKENS (15): "according", "agricultural", "agriculture", "changes", "classification", "containing", "environmental", "form", "forms", "home", "industrial", "making", "physical", "primary", "required". | EXACT TITLE in water_rights: "Food processing".
0.500
Real estate ↗ Q684740 EXACT TITLE
acquisitionbusinesscommercialentityestategeneralgovernmentintendedlandlawlegalmeansownedownershipprivatepropertypublicpurposerealresources
SHARED TOKENS (23): "acquisition", "business", "commercial", "entity", "estate", "general", "government", "intended", "land", "law", "legal", "means", "owned", "ownership", "private", "property", "public", "purpose", "real", "resources".... | EXACT TITLE in insurance_coverage: "Real estate". | EXACT TITLE in water_rights: "Real estate".
0.500
Water treatment ↗ EXACT TITLE
appropriateenvironmentalhealthindustrialirrigationprocessprocessesqualityreceivingresourceriverspecificsystemstreatmentuseswater
SHARED TOKENS (16): "appropriate", "environmental", "health", "industrial", "irrigation", "process", "processes", "quality", "receiving", "resource", "river", "specific", "systems", "treatment", "uses", "water". | EXACT TITLE in water_rights: "Water treatment".
0.500
Telemetry ↗ Q209867 EXACT TITLE
commonlycontrolcostdatadigitalequipmentinstructionsmechanismsmediamodernneednetworkoperatephysicalreceivereceivingrequiresystems
SHARED TOKENS (18): "commonly", "control", "cost", "data", "digital", "equipment", "instructions", "mechanisms", "media", "modern", "need", "network", "operate", "physical", "receive", "receiving", "require", "systems". | EXACT TITLE in water_rights: "Telemetry".
0.500
Insurance ↗ Q43183 EXACT TITLE
anotherclaimclaimsdamageentityestablishedexcessformhealthlossmanagementmeansownershippolicyprimaryprotectprotectionrelationshiprelativelyrequired
SHARED TOKENS (22): "another", "claim", "claims", "damage", "entity", "established", "excess", "form", "health", "loss", "management", "means", "ownership", "policy", "primary", "protect", "protection", "relationship", "relatively", "required".... | EXACT TITLE in insurance_coverage: "Insurance".
0.500
Contract ↗ Q93288 EXACT TITLE
agreementsapplybusinesscategorycivilcodecommercialcontractsdatedocumentdutieseitherenforcementestablishinggeneralgenerallygovernedindependentlawlegal
SHARED TOKENS (39): "agreements", "apply", "business", "category", "civil", "code", "commercial", "contracts", "date", "document", "duties", "either", "enforcement", "establishing", "general", "generally", "governed", "independent", "law", "legal".... | EXACT TITLE in insurance_coverage: "Contract". | EXACT TITLE in water_rights: "Contract".
0.500
Surveying ↗ Q816425 EXACT TITLE
analysisboundariescivilconstructiondevelopmentdigitalengineeringequipmentestablishformsgovernmenthistorylandlawlegalmappingownershipplanningprofessionalproperty
SHARED TOKENS (27): "analysis", "boundaries", "civil", "construction", "development", "digital", "engineering", "equipment", "establish", "forms", "government", "history", "land", "law", "legal", "mapping", "ownership", "planning", "professional", "property".... | EXACT TITLE in water_rights: "Surveying".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
buildingbusinessbusinessescapitalcivilcommercialconvertsdemanddescribeddirectlyeitherestateexistingformhomelawlegallendermarketsmeans
SHARED TOKENS (33): "building", "business", "businesses", "capital", "civil", "commercial", "converts", "demand", "described", "directly", "either", "estate", "existing", "form", "home", "law", "legal", "lender", "markets", "means".... | EXACT TITLE in insurance_coverage: "Mortgage".
0.500
administeredadministersagencyagriculturalagricultureapproximatelybillioncommercialcurrentdepartmentdirectlyfederalgovernmentmembernationalprogramprogramsreportsresourcesserved
SHARED TOKENS (21): "administered", "administers", "agency", "agricultural", "agriculture", "approximately", "billion", "commercial", "current", "department", "directly", "federal", "government", "member", "national", "program", "programs", "reports", "resources", "served".... | EXACT TITLE in insurance_coverage: "United States Department of Agriculture".
0.500
actaddressingadministeredagencychangescontrolcoordinationdirectlyenvironmentalfederalformgoverninginvolvinglawlegislationmaintainmajormodernownedphysical
SHARED TOKENS (30): "act", "addressing", "administered", "agency", "changes", "control", "coordination", "directly", "environmental", "federal", "form", "governing", "involving", "law", "legislation", "maintain", "major", "modern", "owned", "physical".... | EXACT TITLE in water_rights: "Clean Water Act".
0.500
accessagentanotherappropriateapproximatelyassociationbestbusinessbusinesseschangechannelclaimsclientscommercialcontractorscontroldamagedirectdirectlydistribution
SHARED TOKENS (60): "access", "agent", "another", "appropriate", "approximately", "association", "best", "business", "businesses", "change", "channel", "claims", "clients", "commercial", "contractors", "control", "damage", "direct", "directly", "distribution".... | EXACT TITLE in insurance_coverage: "Independent insurance agent".
0.500
associationbestcontractorscontroldescribedeitherequipmentevaluationmodernprocessprofileprotectregulatedrequiredresourcesearchwater
SHARED TOKENS (17): "association", "best", "contractors", "control", "described", "either", "equipment", "evaluation", "modern", "process", "profile", "protect", "regulated", "required", "resource", "search", "water". | EXACT TITLE in water_rights: "Well drilling".
0.500
actapplicationenterexcessexpresslygenerallyincreasesirrigationneedperiodpermitqualityrequirementsrisksurroundinguseswater
SHARED TOKENS (17): "act", "application", "enter", "excess", "expressly", "generally", "increases", "irrigation", "need", "period", "permit", "quality", "requirements", "risk", "surrounding", "uses", "water". | EXACT TITLE in water_rights: "Return flow".
0.500
applyclaimclaimsconsumercostcostscoveringdamageexcessfirefirmfrequentlygeneralhealthholderhomelosspaidplanplans
SHARED TOKENS (29): "apply", "claim", "claims", "consumer", "cost", "costs", "covering", "damage", "excess", "fire", "firm", "frequently", "general", "health", "holder", "home", "loss", "paid", "plan", "plans".... | EXACT TITLE in insurance_coverage: "Deductible".
0.500
actagenciesagentallowingauthorizedbusinessclaimscontractsentityfederalgeneralidahoindependentindividuallegallylimitedplacementpoliciespolicyregulatory
SHARED TOKENS (23): "act", "agencies", "agent", "allowing", "authorized", "business", "claims", "contracts", "entity", "federal", "general", "idaho", "independent", "individual", "legally", "limited", "placement", "policies", "policy", "regulatory".... | EXACT TITLE in insurance_coverage: "Managing general agent".
0.500
actagricultureapproximatelybeganboardboisebureaucapacityconstructiondesignhomeidahoirrigationlaborlawlevelmonthsnationaloperatedprimary
SHARED TOKENS (30): "act", "agriculture", "approximately", "began", "board", "boise", "bureau", "capacity", "construction", "design", "home", "idaho", "irrigation", "labor", "law", "level", "months", "national", "operated", "primary".... | EXACT TITLE in water_rights: "Anderson Ranch Dam".
0.500
agriculturecapitalcommercialcostcostsdependinstitutionalirrigationlargerpersonnelpolicypracticeproviderspublicqualityregulationseparatesurroundingsystemsystems
SHARED TOKENS (22): "agriculture", "capital", "commercial", "cost", "costs", "depend", "institutional", "irrigation", "larger", "personnel", "policy", "practice", "providers", "public", "quality", "regulation", "separate", "surrounding", "system", "systems".... | EXACT TITLE in water_rights: "Water supply".
0.500
Arsenic ↗ Q871 EXACT TITLE
agencyclassifiedcontainingdetermineenvironmentalessentialformformsgrouphealthlargerlistoccursprimaryproposedprotectionresearchriskrolesites
SHARED TOKENS (22): "agency", "classified", "containing", "determine", "environmental", "essential", "form", "forms", "group", "health", "larger", "list", "occurs", "primary", "proposed", "protection", "research", "risk", "role", "sites".... | EXACT TITLE in water_rights: "Arsenic".
0.480
containsdamsformindustrialirrigationlandmajorreportsresultsurroundingtreatmenttypesuseswater
SHARED TOKENS (14): "contains", "dams", "form", "industrial", "irrigation", "land", "major", "reports", "result", "surrounding", "treatment", "types", "uses", "water". | EXACT TITLE in water_rights: "Surface water".
0.480
Nitrate ↗ Q49916468 EXACT TITLE
agriculturalassociatedcontainingdirectexcesshealthhistoricallymanufacturingmeansmillionmodernprocessessourcewater
SHARED TOKENS (14): "agricultural", "associated", "containing", "direct", "excess", "health", "historically", "manufacturing", "means", "million", "modern", "processes", "source", "water". | EXACT TITLE in water_rights: "Nitrate".
0.480
adaboisebureaucanyonchannelidahoirrigationoperatedprimaryrivertreasurevalleywaterwestern
SHARED TOKENS (14): "ada", "boise", "bureau", "canyon", "channel", "idaho", "irrigation", "operated", "primary", "river", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "Boise River Diversion Dam".
0.480
adaapproximatelyboisecanyoncapacitychannelidahoirrigationriversystemtreasurevalleywaterwestern
SHARED TOKENS (14): "ada", "approximately", "boise", "canyon", "capacity", "channel", "idaho", "irrigation", "river", "system", "treasure", "valley", "water", "western". | EXACT TITLE in water_rights: "New York Canal".
0.480
actdeliverydirectlyhealthlaboroperatoroptionsplanplanspriorprivateprovidersspecificsystems
SHARED TOKENS (14): "act", "delivery", "directly", "health", "labor", "operator", "options", "plan", "plans", "prior", "private", "providers", "specific", "systems". | EXACT TITLE in insurance_coverage: "Medicare Advantage".
0.480
Aquifer ↗ Q208791 EXACT TITLE
beyondclassifiedformationhomeindustriallandlayermajorregionrelatedsourcestudyunderlyingwater
SHARED TOKENS (14): "beyond", "classified", "formation", "home", "industrial", "land", "layer", "major", "region", "related", "source", "study", "underlying", "water". | EXACT TITLE in water_rights: "Aquifer".
0.480
Indemnity ↗ Q708399 EXACT TITLE
agencyagentanothercontractsdamageexpresslyformlawlimitedlossprincipalpurchaserelationshipspecified
SHARED TOKENS (14): "agency", "agent", "another", "contracts", "damage", "expressly", "form", "law", "limited", "loss", "principal", "purchase", "relationship", "specified". | EXACT TITLE in insurance_coverage: "Indemnity".
0.460
billiondependsdirectlyeitherenvironmentalformhealthmaintainmajorphysicalrequiredwaterwork
SHARED TOKENS (13): "billion", "depends", "directly", "either", "environmental", "form", "health", "maintain", "major", "physical", "required", "water", "work". | EXACT TITLE in water_rights: "Drinking water".
0.460
accessanotherdescribingestateevenlegalnamespropertyspecifictitleunderlyingviewwater
SHARED TOKENS (13): "access", "another", "describing", "estate", "even", "legal", "names", "property", "specific", "title", "underlying", "view", "water". | EXACT TITLE in water_rights: "Beneficial use".
0.460
agencyboisedepartmentenvironmentalfederalgovernmentidahomainmaintainedqualityregionalregulationsresponsible
SHARED TOKENS (13): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "main", "maintained", "quality", "regional", "regulations", "responsible". | EXACT TITLE in water_rights: "Idaho Department of Environmental Quality".
0.460
damagefirefloodformshomelossmainpoliciespolicypropertyprotectionrequirespecialized
SHARED TOKENS (13): "damage", "fire", "flood", "forms", "home", "loss", "main", "policies", "policy", "property", "protection", "require", "specialized". | EXACT TITLE in insurance_coverage: "Property insurance".
0.440
compliancecontactdeterminesfrequentlygenerallyhealthoptionsphysicalqualitystandardstreatmentwater
SHARED TOKENS (12): "compliance", "contact", "determines", "frequently", "generally", "health", "options", "physical", "quality", "standards", "treatment", "water". | EXACT TITLE in water_rights: "Water quality".
0.440
annualapplicationapproximatelyboundariescapacitycontainsdirectevenformationmeanprimarysource
SHARED TOKENS (12): "annual", "application", "approximately", "boundaries", "capacity", "contains", "direct", "even", "formation", "mean", "primary", "source". | EXACT TITLE in water_rights: "Geothermal heating".
0.440
commercialdirectlyindustrialinfrastructureoccursseparateservedservingstormwatersystemsystemstreatment
SHARED TOKENS (12): "commercial", "directly", "industrial", "infrastructure", "occurs", "separate", "served", "serving", "stormwater", "system", "systems", "treatment". | EXACT TITLE in water_rights: "Sanitary sewer".
0.420
anothercurrentevenexcessformslevelmakingprocessratesingletreated
SHARED TOKENS (11): "another", "current", "even", "excess", "forms", "level", "making", "process", "rate", "single", "treated". | EXACT TITLE in water_rights: "Radionuclide".
0.420
agriculturalapproximatelychangeindustrialirrigationresourceresourcesriversourcesouthwater
SHARED TOKENS (11): "agricultural", "approximately", "change", "industrial", "irrigation", "resource", "resources", "river", "source", "south", "water". | EXACT TITLE in water_rights: "Water resources".
0.420
anotherboundariescommonlyengineeringenvironmentallandratherriversinglesystemwater
SHARED TOKENS (11): "another", "boundaries", "commonly", "engineering", "environmental", "land", "rather", "river", "single", "system", "water". | EXACT TITLE in water_rights: "Drainage basin".
0.420
administrationagencyassociateddepartmenteconomicfederalmarinenationalofficeresourcesresponsible
SHARED TOKENS (11): "administration", "agency", "associated", "department", "economic", "federal", "marine", "national", "office", "resources", "responsible". | EXACT TITLE in water_rights: "National Marine Fisheries Service".
0.420
Snowpack ↗ Q18575846 EXACT TITLE
agricultureannualchangeclassificationfloodingformationphysicalprovideresourcestudywater
SHARED TOKENS (11): "agriculture", "annual", "change", "classification", "flooding", "formation", "physical", "provide", "resource", "study", "water". | EXACT TITLE in water_rights: "Snowpack".
0.400
Ditch ↗ Q2048319 EXACT TITLE
channelcommonlyirrigationmajorproviderequiredsourcethemwaterwhose
SHARED TOKENS (10): "channel", "commonly", "irrigation", "major", "provide", "required", "source", "them", "water", "whose". | EXACT TITLE in water_rights: "Ditch".
0.400
MODFLOW ↗ Q6716996 EXACT TITLE
beyondcodecommercialmodeloperatingprogrampublicsourcesystemstext
SHARED TOKENS (10): "beyond", "code", "commercial", "model", "operating", "program", "public", "source", "systems", "text". | EXACT TITLE in water_rights: "MODFLOW".
0.400
Lien ↗ Q4469383 EXACT TITLE
applicationformformsgenerallyholderperformancepropertyretainspecifictypes
SHARED TOKENS (10): "application", "form", "forms", "generally", "holder", "performance", "property", "retain", "specific", "types". | EXACT TITLE in insurance_coverage: "Lien". | EXACT TITLE in water_rights: "Lien".
0.400
generallyirrigationlawlegalphysicalriversourcesystemsuserswater
SHARED TOKENS (10): "generally", "irrigation", "law", "legal", "physical", "river", "source", "systems", "users", "water". | EXACT TITLE in water_rights: "Water right".
0.400
actaffordableessentialhealthlawmarketsoutsideplansrequirementsubject
SHARED TOKENS (10): "act", "affordable", "essential", "health", "law", "markets", "outside", "plans", "requirement", "subject". | EXACT TITLE in insurance_coverage: "Essential health benefits".
0.380
capacitychannelfloodinglandmajoroccursrecordvolumewater
SHARED TOKENS (9): "capacity", "channel", "flooding", "land", "major", "occurs", "record", "volume", "water". | EXACT TITLE in water_rights: "Streamflow".
0.380
Escrow ↗ Q338451 EXACT TITLE
accountagentestablishedholdingobligationsprimaryprincipalpropertytransaction
SHARED TOKENS (9): "account", "agent", "established", "holding", "obligations", "primary", "principal", "property", "transaction". | EXACT TITLE in insurance_coverage: "Escrow".
0.380
adjudicationdeterminesevidencelegalobligationsprocessprocessesreviewsshows
SHARED TOKENS (9): "adjudication", "determines", "evidence", "legal", "obligations", "process", "processes", "reviews", "shows". | EXACT TITLE in insurance_coverage: "Adjudication". | EXACT TITLE in water_rights: "Adjudication".
0.380
amongdamageinstitutionslosspracticepublicrisksupportingvalue
SHARED TOKENS (9): "among", "damage", "institutions", "loss", "practice", "public", "risk", "supporting", "value". | EXACT TITLE in insurance_coverage: "Underwriting".
0.360
agriculturebuildingdevelopmentestatelandlandscapepurposereal
SHARED TOKENS (8): "agriculture", "building", "development", "estate", "land", "landscape", "purpose", "real". | EXACT TITLE in water_rights: "Land development".
0.360
agriculturalirrigationlocalmanagementprocessesresourcerolewater
SHARED TOKENS (8): "agricultural", "irrigation", "local", "management", "processes", "resource", "role", "water". | EXACT TITLE in water_rights: "Evapotranspiration".
0.340
agriculturalcropeithergovernmentlossprotectrelated
SHARED TOKENS (7): "agricultural", "crop", "either", "government", "loss", "protect", "related". | EXACT TITLE in insurance_coverage: "Crop insurance".
0.340
Subrogation ↗ Q322457 EXACT TITLE
anothercivillawlegalrelativelysubjectsystems
SHARED TOKENS (7): "another", "civil", "law", "legal", "relatively", "subject", "systems". | EXACT TITLE in insurance_coverage: "Subrogation".
0.340
determinefloodfloodinglosspropertyriskspecific
SHARED TOKENS (7): "determine", "flood", "flooding", "loss", "property", "risk", "specific". | EXACT TITLE in insurance_coverage: "Flood insurance".
0.340
capacitydeliveryeitherperiodspracticetransferswater
SHARED TOKENS (7): "capacity", "delivery", "either", "periods", "practice", "transfers", "water". | EXACT TITLE in water_rights: "Water banking".
0.320
authorizationdeterminehealthmanagementpriorprocess
SHARED TOKENS (6): "authorization", "determine", "health", "management", "prior", "process". | EXACT TITLE in insurance_coverage: "Prior authorization".
0.320
formlawlimitedpropertypublicresponsible
SHARED TOKENS (6): "form", "law", "limited", "property", "public", "responsible". | EXACT TITLE in insurance_coverage: "Product liability".
0.320
environmentaloccursprimaryprocessprocesseswater
SHARED TOKENS (6): "environmental", "occurs", "primary", "process", "processes", "water". | EXACT TITLE in water_rights: "Groundwater recharge".
0.300
Reservoir ↗ Q131681 EXACT TITLE
buildingexistingformspacewater
SHARED TOKENS (5): "building", "existing", "form", "space", "water". | EXACT TITLE in water_rights: "Reservoir".
0.300
appropriatecapitalclaimseconomicevenfinancefirmgenerallyidentifyingindividualmanagementmarketmodernoperationalplanspracticeprincipallyprotectingraterelated
SHARED TOKENS (26): "appropriate", "capital", "claims", "economic", "even", "finance", "firm", "generally", "identifying", "individual", "management", "market", "modern", "operational", "plans", "practice", "principally", "protecting", "rate", "related"....
0.300
Acequia ↗ Q1385463 KW CROSS HIGH
agriculturalagriculturedateformhealthhistoricalirrigationmaintainedmanagementoperatedpracticeregionresourcesystemswater
SHARED TOKENS (15): "agricultural", "agriculture", "date", "form", "health", "historical", "irrigation", "maintained", "management", "operated", "practice", "region", "resource", "systems", "water".
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
capitalcategoriescivilclaimscontractsdesigneitherformformsgrowthholderlegalmainmajormodernofferingsphysicalpoliciespolicyprotection
SHARED TOKENS (25): "capital", "categories", "civil", "claims", "contracts", "design", "either", "form", "forms", "growth", "holder", "legal", "main", "major", "modern", "offerings", "physical", "policies", "policy", "protection"....
0.300
actadministrativeclaimscontractscorporatecreatedirectdocumentemployeegrouphealthobligationsplanplanspolicyprovisionsriskunless
SHARED TOKENS (18): "act", "administrative", "claims", "contracts", "corporate", "create", "direct", "document", "employee", "group", "health", "obligations", "plan", "plans", "policy", "provisions", "risk", "unless".
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcommercialcorecostsdescribeddevelopmentenvironmentalexistingformgeographicgrowthindustrialinfrastructurelandlossmodernplanning
SHARED TOKENS (30): "agency", "associated", "become", "building", "commercial", "core", "costs", "described", "development", "environmental", "existing", "form", "geographic", "growth", "industrial", "infrastructure", "land", "loss", "modern", "planning"....
0.300
analysisanotherbroaderbusinessdatadatabasedateengineeringessentialgeographicindexinformationinstitutionalmanagementoperationsorganizationsphysicalplanningproceduresprocesses
SHARED TOKENS (29): "analysis", "another", "broader", "business", "data", "database", "date", "engineering", "essential", "geographic", "index", "information", "institutional", "management", "operations", "organizations", "physical", "planning", "procedures", "processes"....
0.300
actamongbestcodecontinuingdepartmentemergencyemployeeemploymentgenerallygovernmentgrouphealthlawofficialplanplansprivateprogrampublic
SHARED TOKENS (25): "act", "among", "best", "code", "continuing", "department", "emergency", "employee", "employment", "generally", "government", "group", "health", "law", "official", "plan", "plans", "private", "program", "public"....
0.300
controlcreateequipmentfacilitiesindividualindustrialmaintainmanufacturingmodernneedprocessreceiveresearchsinglespecializedsurroundingsystemsworking
SHARED TOKENS (18): "control", "create", "equipment", "facilities", "individual", "industrial", "maintain", "manufacturing", "modern", "need", "process", "receive", "research", "single", "specialized", "surrounding", "systems", "working".
0.300
Property law ↗ Q1149275 KW CROSS HIGH
acquisitionanothercivileconomiceffectseitherenforcementenvironmentalgenerallygoverninggovernslandlawlegalmajorownershipprivatepropertypublicreal
SHARED TOKENS (24): "acquisition", "another", "civil", "economic", "effects", "either", "enforcement", "environmental", "generally", "governing", "governs", "land", "law", "legal", "major", "ownership", "private", "property", "public", "real"....
0.300
adaboisecanyoncommonlyhomeidaholargermainmeridianmetropolitannampanorthwestpercentpopulationsectiontreasurevalley
SHARED TOKENS (17): "ada", "boise", "canyon", "commonly", "home", "idaho", "larger", "main", "meridian", "metropolitan", "nampa", "northwest", "percent", "population", "section", "treasure", "valley".
0.300
agriculturalagriculturebusinessescostcostsdirectdistributioneffectsenvironmentalindustrialirrigationmanagementmunicipaloptionspracticeprocessregionremainrequiresource
SHARED TOKENS (28): "agricultural", "agriculture", "businesses", "cost", "costs", "direct", "distribution", "effects", "environmental", "industrial", "irrigation", "management", "municipal", "options", "practice", "process", "region", "remain", "require", "source"....
0.300
actadequateadministeredagenciesauthoritycodecomprehensivedependdescribeddevelopmentdirectseconomicfederalgrowthlawlegislationmarinemeansmechanismsnational
SHARED TOKENS (30): "act", "adequate", "administered", "agencies", "authority", "code", "comprehensive", "depend", "described", "development", "directs", "economic", "federal", "growth", "law", "legislation", "marine", "means", "mechanisms", "national"....
0.300
anotherbecomebeganconsolidationconsumersdescribeddirectlyeconomyfinalfirmmakingmanagementmarketmarketplacememberneedownedownershipratherrelated
SHARED TOKENS (23): "another", "become", "began", "consolidation", "consumers", "described", "directly", "economy", "final", "firm", "making", "management", "market", "marketplace", "member", "need", "owned", "ownership", "rather", "related"....
0.300
adjudicationadministrationadministrativeagenciesanothercenturychangescivilcontroldecisionseconomiceducationenforcementenvironmentalexpandedgenerallygoverninggovernmentlawlegal
SHARED TOKENS (31): "adjudication", "administration", "administrative", "agencies", "another", "century", "changes", "civil", "control", "decisions", "economic", "education", "enforcement", "environmental", "expanded", "generally", "governing", "government", "law", "legal"....
0.300
availabilityconsumerconsumersgeneralinformationmarketplaceonlineoperatorprimaryprocessproviderssinglesitespecifictransactionstypesusers
SHARED TOKENS (17): "availability", "consumer", "consumers", "general", "information", "marketplace", "online", "operator", "primary", "process", "providers", "single", "site", "specific", "transactions", "types", "users".
0.300
accountadditionalagricultureannualboisecenturychangechangescoursedatadescribedexperienceextendgeneralgenerallyhistoryidahoincreasesleastmodel
SHARED TOKENS (27): "account", "additional", "agriculture", "annual", "boise", "century", "change", "changes", "course", "data", "described", "experience", "extend", "general", "generally", "history", "idaho", "increases", "least", "model"....
0.300
actadministrativeauthorizedbusinesseschangeconcerningentitiesentityfederalgenerallygovernsgrouphealthinformationlawlimitedmaintainednationalplanspolicies
SHARED TOKENS (29): "act", "administrative", "authorized", "businesses", "change", "concerning", "entities", "entity", "federal", "generally", "governs", "group", "health", "information", "law", "limited", "maintained", "national", "plans", "policies"....
0.300
actaffordableapproximatelyassociatedcannotcommercialcostscoveringfederalformgovernmenthealthmajormillionpaidplanspopulationpracticesprivateprogram
SHARED TOKENS (34): "act", "affordable", "approximately", "associated", "cannot", "commercial", "costs", "covering", "federal", "form", "government", "health", "major", "million", "paid", "plans", "population", "practices", "private", "program"....
0.300
amongcostsdescribeddevelopmenteconomicentitiesestategovernmentidentifylegalnationalprocesspropertyrealregulationsrequirementsresearchstudysystemtransaction
SHARED TOKENS (21): "among", "costs", "described", "development", "economic", "entities", "estate", "government", "identify", "legal", "national", "process", "property", "real", "regulations", "requirements", "research", "study", "system", "transaction"....
0.300
actadministrationagenciesassetsauthoritybillionbureaubusinesschangescommonlycomplianceconsumerconsumerscostscouncildataeconomicestablishedfederalfirms
SHARED TOKENS (39): "act", "administration", "agencies", "assets", "authority", "billion", "bureau", "business", "changes", "commonly", "compliance", "consumer", "consumers", "costs", "council", "data", "economic", "established", "federal", "firms"....
0.300
Eutrophication ↗ Q156698 KW CROSS HIGH
agriculturecontrolsdescribingdevelopmentenvironmentalgeneralgrowthindustrialmainoccurspoliciesprocessprogramresultriversourcewater
SHARED TOKENS (17): "agriculture", "controls", "describing", "development", "environmental", "general", "growth", "industrial", "main", "occurs", "policies", "process", "program", "result", "river", "source", "water".
0.300
actadaanalysisannualcivilclaimscommonlyemploymentforminformationlaborlawmanagementnationalpracticesprofessionalrelatedtitletypesviolations
SHARED TOKENS (20): "act", "ada", "analysis", "annual", "civil", "claims", "commonly", "employment", "form", "information", "labor", "law", "management", "national", "practices", "professional", "related", "title", "types", "violations".
0.300
Fidelity bond ↗ Q884117 KW CROSS HIGH
additionalagreementsanotherassetsbusinesseitherfireformgenerallossobligationsobtainpoliciespropertyprotectprotectionpurchaseresultspecificspecified
SHARED TOKENS (20): "additional", "agreements", "another", "assets", "business", "either", "fire", "form", "general", "loss", "obligations", "obtain", "policies", "property", "protect", "protection", "purchase", "result", "specific", "specified".
0.300
addressingadministeredauthorizedconcerningdepartmenteducationessentialfederalgeneralgovernmenthealthmattersprimaryprivateprovidingpublicresponsibleseparatesystem
SHARED TOKENS (19): "addressing", "administered", "authorized", "concerning", "department", "education", "essential", "federal", "general", "government", "health", "matters", "primary", "private", "providing", "public", "responsible", "separate", "system".
0.300
Right of way ↗ KW CROSS HIGH
authorityestategovernmentlandlegallineslocalmainmeanoperateownershipphysicalprivaterealretainright-of-wayrights-of-wayspecificstatusthem
SHARED TOKENS (22): "authority", "estate", "government", "land", "legal", "lines", "local", "main", "mean", "operate", "ownership", "physical", "private", "real", "retain", "right-of-way", "rights-of-way", "specific", "status", "them"....
0.300
civildocumentdocumentationdocumentshistoricalidentifylawmaintainedofficeownersownershippropertyrecordservestitletransfers
SHARED TOKENS (16): "civil", "document", "documentation", "documents", "historical", "identify", "law", "maintained", "office", "owners", "ownership", "property", "record", "serves", "title", "transfers".
0.300
businessescivilclaimcommonlyconsultingcostcostsdirectformformsgenerallawlegallossnamespolicypracticeprofessionalprotectrequired
SHARED TOKENS (21): "businesses", "civil", "claim", "commonly", "consulting", "cost", "costs", "direct", "form", "forms", "general", "law", "legal", "loss", "names", "policy", "practice", "professional", "protect", "required"....
0.300
anotherbuildingdamagedatadependfloodformhomehomeownersinventorylargerlossmanagementmerelyordinarypoliciespropertyresourcesriskstudy
SHARED TOKENS (21): "another", "building", "damage", "data", "depend", "flood", "form", "home", "homeowners", "inventory", "larger", "loss", "management", "merely", "ordinary", "policies", "property", "resources", "risk", "study"....
0.300
agriculturalagriculturebecomebuildingcategorychangesconstructioncontrolgenerallylandlocalmakingmanagementoperationsprincipalqualityregulaterequiresriversingle
SHARED TOKENS (25): "agricultural", "agriculture", "become", "building", "category", "changes", "construction", "control", "generally", "land", "local", "making", "management", "operations", "principal", "quality", "regulate", "requires", "river", "single"....
0.300
Moral hazard ↗ Q44454 KW CROSS HIGH
actagencyagentanotherassociatedchangecostcostseconomicincreasesinformationplaceprincipalrisktransaction
SHARED TOKENS (15): "act", "agency", "agent", "another", "associated", "change", "cost", "costs", "economic", "increases", "information", "place", "principal", "risk", "transaction".
0.300
accordingaccountinganalysisbusinesschangesconstructionemploymentexaminationsfinancehistoricallyidentifymodernnewsphysicalprofessionalprofessionalsprogramspublishedreportrisk
SHARED TOKENS (24): "according", "accounting", "analysis", "business", "changes", "construction", "employment", "examinations", "finance", "historically", "identify", "modern", "news", "physical", "professional", "professionals", "programs", "published", "report", "risk"....
0.300
accordingactadditionalaffordableagencyapproximatelybureaucivilcodedepartmentdutieseitherenforcementfederalfundgenerallygovernmenthistoryincreasesindividual
SHARED TOKENS (39): "according", "act", "additional", "affordable", "agency", "approximately", "bureau", "civil", "code", "department", "duties", "either", "enforcement", "federal", "fund", "generally", "government", "history", "increases", "individual"....
0.300
accountanalysisassessmentsassetassociatedbecomebroaderchangecostcostscriticaldocumentationeffectsevaluationformsidentifiesidentifyingincreasinglyindividualindustrial
SHARED TOKENS (31): "account", "analysis", "assessments", "asset", "associated", "become", "broader", "change", "cost", "costs", "critical", "documentation", "effects", "evaluation", "forms", "identifies", "identifying", "increasingly", "individual", "industrial"....
0.300
actadministersarticlesassociatedauthorizationdevelopmentenvironmentalfloodindexinfrastructurenationalnetpdfprotectionpublicrequirementsresourcestextwater
SHARED TOKENS (19): "act", "administers", "articles", "associated", "authorization", "development", "environmental", "flood", "index", "infrastructure", "national", "net", "pdf", "protection", "public", "requirements", "resources", "text", "water".
0.300
additionalcommercialconsumersdistributionfacilitiesfiregenerallyindustriallocallyneednetworkprivateprovideprovidingpublicratherriverseparatesystemsystems
SHARED TOKENS (23): "additional", "commercial", "consumers", "distribution", "facilities", "fire", "generally", "industrial", "locally", "need", "network", "private", "provide", "providing", "public", "rather", "river", "separate", "system", "systems"....
0.300
amongapproximatelyassociationboisebureaucanyoncapacitycontainscreatesdamsdirectlyedgefederalformationidaholevellocalnampanationaloffice
SHARED TOKENS (28): "among", "approximately", "association", "boise", "bureau", "canyon", "capacity", "contains", "creates", "dams", "directly", "edge", "federal", "formation", "idaho", "level", "local", "nampa", "national", "office"....
0.300
Sugar beet ↗ Q151964 EXACT TITLE
classifiedcontainsgroupmillionwhose
SHARED TOKENS (5): "classified", "contains", "group", "million", "whose". | EXACT TITLE in water_rights: "Sugar beet".
0.300
buyersconsumerscontractsdamagedemandeffectseveninformationlargerlawmanagementmarketmarketsprovisionspurchasequalityreflectsrisksalethem
SHARED TOKENS (22): "buyers", "consumers", "contracts", "damage", "demand", "effects", "even", "information", "larger", "law", "management", "market", "markets", "provisions", "purchase", "quality", "reflects", "risk", "sale", "them"....
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingacquiredacquisitionsadditionalannouncedapplicationbeganbillionbusinessesconsumerconverteddataembeddedlocalmapmappingorganizationsownersplanningplatform
SHARED TOKENS (32): "according", "acquired", "acquisitions", "additional", "announced", "application", "began", "billion", "businesses", "consumer", "converted", "data", "embedded", "local", "map", "mapping", "organizations", "owners", "planning", "platform"....
0.300
anotherassociationbusinesscategoriescategoryclaimcontrolcreatesdirectdirectlyeitherestablishfinancefirmformgrouplicensedmaintainmanagementmeans
SHARED TOKENS (29): "another", "association", "business", "categories", "category", "claim", "control", "creates", "direct", "directly", "either", "establish", "finance", "firm", "form", "group", "licensed", "maintain", "management", "means"....
0.300
accessadministrationagencyassetbuildingbusinessdepartmentdevelopmentemergencyentitiesfederalgovernmentinfrastructurelocalmajormanagementoccurspersonnelplaceplan
SHARED TOKENS (30): "access", "administration", "agency", "asset", "building", "business", "department", "development", "emergency", "entities", "federal", "government", "infrastructure", "local", "major", "management", "occurs", "personnel", "place", "plan"....
0.300
acquisitionacquisitionsactanotherassetsbusinesscapitalconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentitiesentityfederalgovernedgovernment
SHARED TOKENS (41): "acquisition", "acquisitions", "act", "another", "assets", "business", "capital", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entities", "entity", "federal", "governed", "government"....
0.300
actagencyamongauthoritycommercialdirectoremployeefederalfirmfirmsformgroupholdinglaterlawlegislationmarketmemberpdfregulate
SHARED TOKENS (23): "act", "agency", "among", "authority", "commercial", "director", "employee", "federal", "firm", "firms", "form", "group", "holding", "later", "law", "legislation", "market", "member", "pdf", "regulate"....
0.300
addressingcivilconstructioncontrolcreatedesignengineeringenvironmentalhealthindustriallawlicensinglocalmaintainmanagementmunicipalplansprofessionalproposedprotect
SHARED TOKENS (29): "addressing", "civil", "construction", "control", "create", "design", "engineering", "environmental", "health", "industrial", "law", "licensing", "local", "maintain", "management", "municipal", "plans", "professional", "proposed", "protect"....
0.300
controlcustomerdatadigitalfeesgroupindividuallinesmanagementmarketingmarketsonlineorganizationsprotectrelatedreviewsearchsitesspacesystems
SHARED TOKENS (21): "control", "customer", "data", "digital", "fees", "group", "individual", "lines", "management", "marketing", "markets", "online", "organizations", "protect", "related", "review", "search", "sites", "space", "systems"....
0.300
accountagentagreementsalreadyanalysisbusinesscomparecurrentdirectlyeconomylistingsmarketingonlinepercentreviewssearchsitesvertical
SHARED TOKENS (18): "account", "agent", "agreements", "already", "analysis", "business", "compare", "current", "directly", "economy", "listings", "marketing", "online", "percent", "reviews", "search", "sites", "vertical".
0.300
agencyapprovedbegandepartmenteducationemployeeenforcementenvironmentalestablishingfederalgovernmentindependentinformationjulylegallevellocalmattersnationalpermitting
SHARED TOKENS (29): "agency", "approved", "began", "department", "education", "employee", "enforcement", "environmental", "establishing", "federal", "government", "independent", "information", "july", "legal", "level", "local", "matters", "national", "permitting"....
0.300
agricultureassessmentsbillioncapacitychangechangescurrentdemanddevelopmenteconomicenvironmentalexpandingexperienceinformationinfrastructureleastlocalmanagementmeanneed
SHARED TOKENS (32): "agriculture", "assessments", "billion", "capacity", "change", "changes", "current", "demand", "development", "economic", "environmental", "expanding", "experience", "information", "infrastructure", "least", "local", "management", "mean", "need"....
0.300
amongcoursedamageeconomicemployeeemploymentformgeneralgenerallyhealthlimitedlossoutsideplaceplansprovidingresultsystemworkers
SHARED TOKENS (19): "among", "course", "damage", "economic", "employee", "employment", "form", "general", "generally", "health", "limited", "loss", "outside", "place", "plans", "providing", "result", "system", "workers".
0.300
associatedbecomebroadercapacitycivilcostsdirectorsextendlegallossmanagementofficerspoliciesregulatoryresultsimultaneously
SHARED TOKENS (16): "associated", "become", "broader", "capacity", "civil", "costs", "directors", "extend", "legal", "loss", "management", "officers", "policies", "regulatory", "result", "simultaneously".
0.300
businessbusinessesclaimscommercialdamagedirectorsdutiesgeneralgenerallymarketofficersoperationspoliciespolicyprofessionalpropertypublicseparatespecifictypes
SHARED TOKENS (21): "business", "businesses", "claims", "commercial", "damage", "directors", "duties", "general", "generally", "market", "officers", "operations", "policies", "policy", "professional", "property", "public", "separate", "specific", "types"....
0.300
accordingaccountactapplicationassetbureauclaimclaimscostfederalhealthobtainoccursorganizationsprocessproviderreceivereceivedsystemsthem
SHARED TOKENS (21): "according", "account", "act", "application", "asset", "bureau", "claim", "claims", "cost", "federal", "health", "obtain", "occurs", "organizations", "process", "provider", "receive", "received", "systems", "them"....
0.300
affectagricultureanalysisapplicationdamageedgehealthlandlegislationmakingmanagementmeansmechanismsmodeloccursprotectionpublicqualityrathersite
SHARED TOKENS (26): "affect", "agriculture", "analysis", "application", "damage", "edge", "health", "land", "legislation", "making", "management", "means", "mechanisms", "model", "occurs", "protection", "public", "quality", "rather", "site"....
0.300
accountingamongcapacityconstructiondamsdemanddirectenvironmentalfloodinglandlossmakingpopulationprincipallyprovideregionremainsriverrolesource
SHARED TOKENS (22): "accounting", "among", "capacity", "construction", "dams", "demand", "direct", "environmental", "flooding", "land", "loss", "making", "population", "principally", "provide", "region", "remains", "river", "role", "source"....
0.300
Seed company ↗ Q3478395 KW CROSS HIGH
agriculturalappropriatebusinesscenturycommercialcropdatefacilitiesgenerallygrowthhomeindependentlargermaintainsmodernmonthsnationalplanningprotectpublished
SHARED TOKENS (27): "agricultural", "appropriate", "business", "century", "commercial", "crop", "date", "facilities", "generally", "growth", "home", "independent", "larger", "maintains", "modern", "months", "national", "planning", "protect", "published"....
0.300
Actuary ↗ Q179985 KW CROSS HIGH
additionaladministrativeaffectanalysisassessmentsassetbecomebusinesscenturycompletecostdesigneducationexaminationinformationinvolvinglicensingmanagementmechanismsmitigation
SHARED TOKENS (34): "additional", "administrative", "affect", "analysis", "assessments", "asset", "become", "business", "century", "complete", "cost", "design", "education", "examination", "information", "involving", "licensing", "management", "mechanisms", "mitigation"....
0.300
businessbusinessesconsultingeconomicfinancingfirmheadquarteredhealthintermediarymainmanagementmodelingoperatingplansprofessionalprogramrisk
SHARED TOKENS (17): "business", "businesses", "consulting", "economic", "financing", "firm", "headquartered", "health", "intermediary", "main", "management", "modeling", "operating", "plans", "professional", "program", "risk".
0.300
actaddressingadequateagenciesagreementsassessmentscenturychangecomplianceconcerningcontroldevelopmenteconomicenforcementenvironmentalestablishgrowthintersectsinvolvinglaw
SHARED TOKENS (36): "act", "addressing", "adequate", "agencies", "agreements", "assessments", "century", "change", "compliance", "concerning", "control", "development", "economic", "enforcement", "environmental", "establish", "growth", "intersects", "involving", "law"....
0.300
Water metering ↗ Q268503 KW CROSS HIGH
associationbuildingcommercialdeterminemanufacturingmodernoutsidepracticeprocesspublicrequiredrequirementsstandardssystemtypesvolumewaterworks
SHARED TOKENS (18): "association", "building", "commercial", "determine", "manufacturing", "modern", "outside", "practice", "process", "public", "required", "requirements", "standards", "system", "types", "volume", "water", "works".
0.300
administersadministrationagencyagriculturalagriculturedepartmentdirectorformedhomemarketingnationalnetworkpolicyprogramsreportsstaff
SHARED TOKENS (16): "administers", "administration", "agency", "agricultural", "agriculture", "department", "director", "formed", "home", "marketing", "national", "network", "policy", "programs", "reports", "staff".
0.300
actagenciesagencyapplyassessmentsauthoritycouncildecisionseffectsenvironmentalestablishedfederalfinalgovernmentlawnationalpoliciespolicyproposedquality
SHARED TOKENS (26): "act", "agencies", "agency", "apply", "assessments", "authority", "council", "decisions", "effects", "environmental", "established", "federal", "final", "government", "law", "national", "policies", "policy", "proposed", "quality"....
0.300
accessalreadybestcannotcompetingcontrolcostsentityessentialfederalformsfrequentlygovernmentinfrastructurelineslocalmaintainsmarketmodernoperates
SHARED TOKENS (32): "access", "already", "best", "cannot", "competing", "control", "costs", "entity", "essential", "federal", "forms", "frequently", "government", "infrastructure", "lines", "local", "maintains", "market", "modern", "operates"....
0.300
actaffectagriculturalanotherchangecommercialcurrentdamagedemanddevelopmenteithergrowthirrigationlevellocallossmanagementmanufacturingmunicipalpolicies
SHARED TOKENS (31): "act", "affect", "agricultural", "another", "change", "commercial", "current", "damage", "demand", "development", "either", "growth", "irrigation", "level", "local", "loss", "management", "manufacturing", "municipal", "policies"....
0.300
claimsdateeitherestatefirefunctionsgenerallyhomeindividualleastlimitedobtainpaidperiodplanningpolicyprovideprovidingpurchaserate
SHARED TOKENS (24): "claims", "date", "either", "estate", "fire", "functions", "generally", "home", "individual", "least", "limited", "obtain", "paid", "period", "planning", "policy", "provide", "providing", "purchase", "rate"....
0.300
businessconsumerconsumerscreatescustomereconomicevidenceformfrequentlygeneralgovernmentgrowthhealthindividuallawleastlicenselicensedlicensinglicensure
SHARED TOKENS (42): "business", "consumer", "consumers", "creates", "customer", "economic", "evidence", "form", "frequently", "general", "government", "growth", "health", "individual", "law", "least", "license", "licensed", "licensing", "licensure"....
0.300
actadministersadministrationadministrativeagencycommonlydepartmentfacilitiesfederalfinancinggovhealthhomepartnershipprocessprogramprogramsqualityratingreports
SHARED TOKENS (24): "act", "administers", "administration", "administrative", "agency", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "home", "partnership", "process", "program", "programs", "quality", "rating", "reports"....
0.300
actadditionalaffordablebeganbusinessesfederalhealthlawmarketplacemillionmonthsoperationalorganizationsplansprivateprotectionpurchaseresponsiblestandardized
SHARED TOKENS (19): "act", "additional", "affordable", "began", "businesses", "federal", "health", "law", "marketplace", "million", "months", "operational", "organizations", "plans", "private", "protection", "purchase", "responsible", "standardized".
0.300
actadministeredagenciesapproximatelyauthorityauthorizedbillionbuildingbusinesscapacitycivilconductconstructioncontroldamagedamsdepartmentdesigndirectdirectly
SHARED TOKENS (59): "act", "administered", "agencies", "approximately", "authority", "authorized", "billion", "building", "business", "capacity", "civil", "conduct", "construction", "control", "damage", "dams", "department", "design", "direct", "directly"....
0.300
actadministeredadministrationagenciesbureaucurrentdepartmentdepartmentsdutiesestablishedfederalfinancegovernmentinstitutionslicenseslimitedmajormattersmembernational
SHARED TOKENS (26): "act", "administered", "administration", "agencies", "bureau", "current", "department", "departments", "duties", "established", "federal", "finance", "government", "institutions", "licenses", "limited", "major", "matters", "member", "national"....
0.300
agencyapproximatelyauthoritybestbusinessesconstructioncontractsdirecteconomiceconomygovernmentgroupgrowthlocalorganizationspracticesprivateprocessprocurementpublic
SHARED TOKENS (32): "agency", "approximately", "authority", "best", "businesses", "construction", "contracts", "direct", "economic", "economy", "government", "group", "growth", "local", "organizations", "practices", "private", "process", "procurement", "public"....
0.300
actadministrationagencycostsdepartmenteducationeffectsemploymentestablishedfederalfirmhealthlaborlawoccupationaloutreachprovidingregulationsregulatoryshown
SHARED TOKENS (23): "act", "administration", "agency", "costs", "department", "education", "effects", "employment", "established", "federal", "firm", "health", "labor", "law", "occupational", "outreach", "providing", "regulations", "regulatory", "shown"....
0.300
Pumping station ↗ KW CROSS HIGH
agriculturalallowinganothercontainingcriticalcustomerdemanddesigndevelopmentenvironmentalequipmentessentialfacilitiesfloodinghistoricalinfrastructurelandlevelmanagementmodern
SHARED TOKENS (31): "agricultural", "allowing", "another", "containing", "critical", "customer", "demand", "design", "development", "environmental", "equipment", "essential", "facilities", "flooding", "historical", "infrastructure", "land", "level", "management", "modern"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedcenturycommonlyconnectdevelopmenteasementseitherevenexpandedfinalfunctionsgovernmentlandlaterlegalobtainowners
SHARED TOKENS (36): "acquisition", "another", "application", "authorized", "century", "commonly", "connect", "development", "easements", "either", "even", "expanded", "final", "functions", "government", "land", "later", "legal", "obtain", "owners"....
0.300
addressingaffectagriculturalagriculturechangechangesdevelopmentdirecteconomiceffectsenterenvironmentallandlocalmajormanagementmitigationoperationspracticesquality
SHARED TOKENS (29): "addressing", "affect", "agricultural", "agriculture", "change", "changes", "development", "direct", "economic", "effects", "enter", "environmental", "land", "local", "major", "management", "mitigation", "operations", "practices", "quality"....
0.300
Private equity ↗ Q476115 KW CROSS HIGH
businesscapitalcategorychangescontroldescribeddevelopmenteitherfinancefinancingfirmfirmsfundgenerallimitedmanagementoperationalownershipprivateprovide
SHARED TOKENS (27): "business", "capital", "category", "changes", "control", "described", "development", "either", "finance", "financing", "firm", "firms", "fund", "general", "limited", "management", "operational", "ownership", "private", "provide"....
0.300
agenciescivilconstructiondamsdepartmentsdesignengineeringfirmsgovernmentinfrastructurelocallymunicipalnationalphysicalplaceprivateprofessionalpublicsectorsystems
SHARED TOKENS (21): "agencies", "civil", "construction", "dams", "departments", "design", "engineering", "firms", "government", "infrastructure", "locally", "municipal", "national", "physical", "place", "private", "professional", "public", "sector", "systems"....
0.300
boisebureaucapacitydamsidahoirrigationnampanationalplaceprogramproviderivertreasurevalleywaterwestern
SHARED TOKENS (16): "boise", "bureau", "capacity", "dams", "idaho", "irrigation", "nampa", "national", "place", "program", "provide", "river", "treasure", "valley", "water", "western".
0.300
agencycurrentdatadepartmentfederalgovernmentheadquarteredlandscapemajorpublicregulatoryresearchresourcesspacestudywhosework
SHARED TOKENS (17): "agency", "current", "data", "department", "federal", "government", "headquartered", "landscape", "major", "public", "regulatory", "research", "resources", "space", "study", "whose", "work".
0.300
actadministrationagencychangedepartmentemployeeestablishedgovernmentlabormanagementofficepriorprogramprovisionsresponsibletitle
SHARED TOKENS (16): "act", "administration", "agency", "change", "department", "employee", "established", "government", "labor", "management", "office", "prior", "program", "provisions", "responsible", "title".
0.300
actadministeredamongdirectestablishedfederallaborlaterlawmajornationalplanprogramprogramssinglesupportsystem
SHARED TOKENS (17): "act", "administered", "among", "direct", "established", "federal", "labor", "later", "law", "major", "national", "plan", "program", "programs", "single", "support", "system".
0.300
administersadministrationbuildingdepartmentdepartmentsdirectlyeconomicemploymentfederalgoverninggovernmenthealthhistorylabormembermillionoccupationalpurposeregulationsreports
SHARED TOKENS (25): "administers", "administration", "building", "department", "departments", "directly", "economic", "employment", "federal", "governing", "government", "health", "history", "labor", "member", "million", "occupational", "purpose", "regulations", "reports"....
0.300
Balance billing ↗ KW CROSS HIGH
administrativecostcostscreatesfeesincreasesmakingmarketneednetworkpracticeproviderprovidersrathersubjectsystemthemthereforevalue
SHARED TOKENS (19): "administrative", "cost", "costs", "creates", "fees", "increases", "making", "market", "need", "network", "practice", "provider", "providers", "rather", "subject", "system", "them", "therefore", "value".
0.300
accessactamongappropriateassociatedcodeconcerningconductcontainsdepartmentdisclosureeffectsemployeeenforcementestablishesestablishingfederalinformationlaborlaw
SHARED TOKENS (30): "access", "act", "among", "appropriate", "associated", "code", "concerning", "conduct", "contains", "department", "disclosure", "effects", "employee", "enforcement", "establishes", "establishing", "federal", "information", "labor", "law"....
0.300
accessagreementsamongassociatedavailabilitybecomechangescontrolcorporatedescribingdisputeseconomicgovernmenthistoryincreasesindividualinstitutionsirrigationlevellimited
SHARED TOKENS (40): "access", "agreements", "among", "associated", "availability", "become", "changes", "control", "corporate", "describing", "disputes", "economic", "government", "history", "increases", "individual", "institutions", "irrigation", "level", "limited"....
0.300
annualassetsbillionboardcannotcommercialcontractscurrentdirectorsentityfiregeneralgroupholdinghomeownerslegallegallylistlocaloperates
SHARED TOKENS (25): "annual", "assets", "billion", "board", "cannot", "commercial", "contracts", "current", "directors", "entity", "fire", "general", "group", "holding", "homeowners", "legal", "legally", "list", "local", "operates"....
0.300
acquiringactapprovalsapprovedbuildingcommercialconstructioncontractorscostscreatesdesigndeterminedevelopersdevelopmenteconomicenvironmentalestateexistingfinancinggrowth
SHARED TOKENS (39): "acquiring", "act", "approvals", "approved", "building", "commercial", "construction", "contractors", "costs", "creates", "design", "determine", "developers", "development", "economic", "environmental", "estate", "existing", "financing", "growth"....
0.300
Oregon Trail ↗ Q862312 KW CROSS HIGH
businesscenturycompletecoursecurrentestablishedformidahoincreasinglymakingmodernownersriverseparatevalleywestwestern
SHARED TOKENS (17): "business", "century", "complete", "course", "current", "established", "form", "idaho", "increasingly", "making", "modern", "owners", "river", "separate", "valley", "west", "western".
🫐 BERRY74 edges
0.280
associatedbecomechangecostsgenerallyhealthhomeleastneedoccurspercentreceivingrelativelyrequire
SHARED TOKENS (14): "associated", "become", "change", "costs", "generally", "health", "home", "least", "need", "occurs", "percent", "receiving", "relatively", "require".
0.280
associationassociationsorganizationspolicies
SHARED TOKENS (4): "association", "associations", "organizations", "policies". | EXACT TITLE in insurance_coverage: "Guaranty association".
0.280
amongbillionbuildingcommercialconsultingemployeegroupindexinstitutionallegallyoperationsprincipalreportedrisk
SHARED TOKENS (14): "among", "billion", "building", "commercial", "consulting", "employee", "group", "index", "institutional", "legally", "operations", "principal", "reported", "risk".
0.280
additionalapplicablebusinessbusinessescomprehensivedamagelossoperationsphysicalpolicyprimaryprocesspropertytypes
SHARED TOKENS (14): "additional", "applicable", "business", "businesses", "comprehensive", "damage", "loss", "operations", "physical", "policy", "primary", "process", "property", "types".
0.280
businessesinformationinfrastructurerisk
SHARED TOKENS (4): "businesses", "information", "infrastructure", "risk". | EXACT TITLE in insurance_coverage: "Cyber insurance".
0.280
compareconsumerscustomerdecisionsevaluationexperienceformonlineprofessionalpurchasingreviewreviewssitesusers
SHARED TOKENS (14): "compare", "consumers", "customer", "decisions", "evaluation", "experience", "form", "online", "professional", "purchasing", "review", "reviews", "sites", "users".
0.280
Aon plc ↗ Q739518 KW CROSS HIGH
capitalconsultingfirmgroupheadquarteredhealthholdingmanagementoperatesoperationsplansprofessionalrelatedrisk
SHARED TOKENS (14): "capital", "consulting", "firm", "group", "headquartered", "health", "holding", "management", "operates", "operations", "plans", "professional", "related", "risk".
0.280
State Farm ↗ Q2007336 EXACT TITLE
corporategrouppropertyprovider
SHARED TOKENS (4): "corporate", "group", "property", "provider". | EXACT TITLE in insurance_coverage: "State Farm".
0.280
Request for proposal ↗ KW CROSS HIGH
bestbusinesscontractorscontractscustomerdocumentfinalforminformationprocessprocurementqualitysubmittedvendors
SHARED TOKENS (14): "best", "business", "contractors", "contracts", "customer", "document", "final", "form", "information", "process", "procurement", "quality", "submitted", "vendors".
0.260
categoryconstructioncontractorsequipmenthistoricalhistoricallylossmarinepropertyrelatedspecializedtransportationtypes
SHARED TOKENS (13): "category", "construction", "contractors", "equipment", "historical", "historically", "loss", "marine", "property", "related", "specialized", "transportation", "types".
0.260
Reinsurance ↗ Q476118 EXACT TITLE
capacitycostspolicies
SHARED TOKENS (3): "capacity", "costs", "policies". | EXACT TITLE in insurance_coverage: "Reinsurance".
0.260
Alfalfa ↗ Q156106 EXACT TITLE
commonlycropsouth
SHARED TOKENS (3): "commonly", "crop", "south". | EXACT TITLE in water_rights: "Alfalfa".
0.260
agencyassociationidaho
SHARED TOKENS (3): "agency", "association", "idaho". | EXACT TITLE in water_rights: "Idaho State Bar".
0.260
Maize ↗ Q11575 KW CROSS HIGH
annualbecomebillioncommercialcontainscropeitheressentialmainmajormoderntreatmentuses
SHARED TOKENS (13): "annual", "become", "billion", "commercial", "contains", "crop", "either", "essential", "main", "major", "modern", "treatment", "uses".
0.260
agencyagriculturalagriculturecropdepartmententitiesfederalgovernmentmanagementownedprogramprotectionrisk
SHARED TOKENS (13): "agency", "agricultural", "agriculture", "crop", "department", "entities", "federal", "government", "management", "owned", "program", "protection", "risk".
0.260
Trinity Health ↗ KW CROSS HIGH
comprehensivecontinuingfacilitieshealthhomeidahonetworkoperatesoperatingseniorsouthsupportsystem
SHARED TOKENS (13): "comprehensive", "continuing", "facilities", "health", "home", "idaho", "network", "operates", "operating", "senior", "south", "support", "system".
0.260
actannualemergencyentitiesgrouphealthoptionsplansprofessionalsproviderprovidersrequiredstatus
SHARED TOKENS (13): "act", "annual", "emergency", "entities", "group", "health", "options", "plans", "professionals", "provider", "providers", "required", "status".
0.240
amongconsumerseitherformmarketmillionoperationalownedpolicyprotectratherrisk
SHARED TOKENS (12): "among", "consumers", "either", "form", "market", "million", "operational", "owned", "policy", "protect", "rather", "risk".
0.240
deedsdocumentsestategovernmentmaintainsofficeownershippropertyprovidepublicrealrecords
SHARED TOKENS (12): "deeds", "documents", "estate", "government", "maintains", "office", "ownership", "property", "provide", "public", "real", "records".
0.240
allowingdirectlyeitherirrigationmaintainednetworkoperatedplacesystemsystemstypeswater
SHARED TOKENS (12): "allowing", "directly", "either", "irrigation", "maintained", "network", "operated", "place", "system", "systems", "types", "water".
0.240
agriculturalindustriallegalmerelyownershipperiodpriorpurposesourcesystemuserswater
SHARED TOKENS (12): "agricultural", "industrial", "legal", "merely", "ownership", "period", "prior", "purpose", "source", "system", "users", "water".
0.240
Medigap ↗ Q6806864 KW CROSS HIGH
accordingassociationequipmenthealthhomemillionplansprivateprovidersrelatedreportsupplement
SHARED TOKENS (12): "according", "association", "equipment", "health", "home", "million", "plans", "private", "providers", "related", "report", "supplement".
0.240
corecreatesformfunctionsmaintainpaidphysicalprotectionprovidingriskworkworking
SHARED TOKENS (12): "core", "creates", "form", "functions", "maintain", "paid", "physical", "protection", "providing", "risk", "work", "working".
0.220
actexcessexistingextendsformhomeownersindividualpoliciespolicyprimaryunderlying
SHARED TOKENS (11): "act", "excess", "existing", "extends", "form", "homeowners", "individual", "policies", "policy", "primary", "underlying".
0.220
categorydatelimitedordinarypaidpoliciespolicyremainrepresentsrequiredvalue
SHARED TOKENS (11): "category", "date", "limited", "ordinary", "paid", "policies", "policy", "remain", "represents", "required", "value".
0.220
Surety ↗ Q748845 EXACT TITLE
financeprincipal
SHARED TOKENS (2): "finance", "principal". | EXACT TITLE in insurance_coverage: "Surety".
0.220
Agriculture in Idaho ↗ KW CROSS HIGH
agriculturalagricultureeconomyfarmsidaholandmillionrepresentsrolesalesector
SHARED TOKENS (11): "agricultural", "agriculture", "economy", "farms", "idaho", "land", "million", "represents", "role", "sale", "sector".
0.220
controlgoverninglawownershippropertyqualityregulationsrelatedresourceresourceswater
SHARED TOKENS (11): "control", "governing", "law", "ownership", "property", "quality", "regulations", "related", "resource", "resources", "water".
0.220
actchaptercodedevelopmentfederallawlegislationpurposeregulationtitlewater
SHARED TOKENS (11): "act", "chapter", "code", "development", "federal", "law", "legislation", "purpose", "regulation", "title", "water".
0.220
additionalcommonlyestatehomehomeownerslosspolicyprivatepropertyprotectionreal
SHARED TOKENS (11): "additional", "commonly", "estate", "home", "homeowners", "loss", "policy", "private", "property", "protection", "real".
0.220
adaboisecontainsidahometropolitannationalpopulationsectionstarvalleywestern
SHARED TOKENS (11): "ada", "boise", "contains", "idaho", "metropolitan", "national", "population", "section", "star", "valley", "western".
0.220
Insurance law ↗ Q1037642 KW CROSS HIGH
businesscategoriesclaimclaimsconsumerlawpoliciespracticeregulationregulationssurrounding
SHARED TOKENS (11): "business", "categories", "claim", "claims", "consumer", "law", "policies", "practice", "regulation", "regulations", "surrounding".
0.200
actassociationauthoritybusinessfederalgovernmentlawlimitedregulateregulation
SHARED TOKENS (10): "act", "association", "authority", "business", "federal", "government", "law", "limited", "regulate", "regulation".
0.200
topics
EXACT TITLE in insurance_coverage: "Subdivision". | EXACT TITLE in water_rights: "Subdivision".
0.200
Abandon ↗ Q397584 EXACT TITLE
topics
EXACT TITLE in water_rights: "Abandon".
0.200
Payette River ↗ Q3373254 KW CROSS HIGH
agriculturalidaholargermajornationalriversectionsouthvalleywest
SHARED TOKENS (10): "agricultural", "idaho", "larger", "major", "national", "river", "section", "south", "valley", "west".
0.200
Septic tank ↗ Q386300 KW CROSS HIGH
commonlyinvolvingprimaryprocessesratesystemsystemsthereforetreatedtreatment
SHARED TOKENS (10): "commonly", "involving", "primary", "processes", "rate", "system", "systems", "therefore", "treated", "treatment".
0.200
Forfeit ↗ Q16738558 EXACT TITLE
topics
EXACT TITLE in water_rights: "Forfeit".
0.200
Aquifer test ↗ Q446124 KW CROSS HIGH
applyboundarieschangedataeffectsengineeringmodelrealsystemwater
SHARED TOKENS (10): "apply", "boundaries", "change", "data", "effects", "engineering", "model", "real", "system", "water".
0.200
demanddistributionfiremainmaintainedprotectsuppliessystemsystemswater
SHARED TOKENS (10): "demand", "distribution", "fire", "main", "maintained", "protect", "supplies", "system", "systems", "water".
0.200
damagedirectestablishedlegallossmajorownershippracticerelationshiprequirement
SHARED TOKENS (10): "damage", "direct", "established", "legal", "loss", "major", "ownership", "practice", "relationship", "requirement".
0.200
accountcostcurrentevenexcessfeesindexpolicyratevalue
SHARED TOKENS (10): "account", "cost", "current", "even", "excess", "fees", "index", "policy", "rate", "value".
0.200
accordingagencycodecoveringgovernmenthomeofficeseparatestandardssystem
SHARED TOKENS (10): "according", "agency", "code", "covering", "government", "home", "office", "separate", "standards", "system".
0.200
damagedirectlyformhealthindividualmarinepolicypropertyrepairrisk
SHARED TOKENS (10): "damage", "directly", "form", "health", "individual", "marine", "policy", "property", "repair", "risk".
0.200
buildingconstructioncontractordamageequipmentlossphysicalpropertyriskstructure
SHARED TOKENS (10): "building", "construction", "contractor", "damage", "equipment", "loss", "physical", "property", "risk", "structure".
0.180
approximatelycommonlygrouplistoperatesownedpriorpublicregional
SHARED TOKENS (9): "approximately", "commonly", "group", "list", "operates", "owned", "prior", "public", "regional".
0.180
amongdetermineslandlawownershippossesspropertysystemwater
SHARED TOKENS (9): "among", "determines", "land", "law", "ownership", "possess", "property", "system", "water".
0.180
Payment bond ↗ Q7156776 KW CROSS HIGH
contractorcontractorscontractsfederalgovernmentpaidperformancerequiredvalue
SHARED TOKENS (9): "contractor", "contractors", "contracts", "federal", "government", "paid", "performance", "required", "value".
0.180
billioncommercialcommonlyindependentindustriallistofficeoperationsproperty
SHARED TOKENS (9): "billion", "commercial", "commonly", "independent", "industrial", "list", "office", "operations", "property".
0.180
bureaucontainsexpandedmajornorthwestriversouthwestwestern
SHARED TOKENS (9): "bureau", "contains", "expanded", "major", "northwest", "river", "south", "west", "western".
0.180
damagelegalphysicalprimaryprotectionprovideregionregulationsspecific
SHARED TOKENS (9): "damage", "legal", "physical", "primary", "protection", "provide", "region", "regulations", "specific".
0.180
Lateral canal ↗ Q6495566 KW CROSS HIGH
anothercourseexistingfloodperiodsprovideright-of-wayriverwater
SHARED TOKENS (9): "another", "course", "existing", "flood", "periods", "provide", "right-of-way", "river", "water".
0.180
applicationdigitalestablishedfinancefirmsonlineplatformssystemstools
SHARED TOKENS (9): "application", "digital", "established", "finance", "firms", "online", "platforms", "systems", "tools".
0.160
billioncommercialheadquarteredhealthhomeownersprivatepropertyreported
SHARED TOKENS (8): "billion", "commercial", "headquartered", "health", "homeowners", "private", "property", "reported".
0.160
distributionfloodformirrigationmanagementpracticesthereforewater
SHARED TOKENS (8): "distribution", "flood", "form", "irrigation", "management", "practices", "therefore", "water".
0.160
businessclaimsdamagelitigationlossmanagementpublicregulation
SHARED TOKENS (8): "business", "claims", "damage", "litigation", "loss", "management", "public", "regulation".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahometropolitannampapopulationwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "metropolitan", "nampa", "population", "western".
0.160
agencycontinuingdepartmentfederalgovernmentmanagementprotectworking
SHARED TOKENS (8): "agency", "continuing", "department", "federal", "government", "management", "protect", "working".
0.160
actdevelopmentfederalfloodlawnationalprogramtitle
SHARED TOKENS (8): "act", "development", "federal", "flood", "law", "national", "program", "title".
0.160
cropequipmentformedirrigationlandsectionsystemswater
SHARED TOKENS (8): "crop", "equipment", "formed", "irrigation", "land", "section", "systems", "water".
0.140
associatedexaminationhistoryidahonorthwestwestwestern
SHARED TOKENS (7): "associated", "examination", "history", "idaho", "northwest", "west", "western".
0.140
establishedidaholegislaturemakingpopulationregionsource
SHARED TOKENS (7): "established", "idaho", "legislature", "making", "population", "region", "source".
0.140
demandeffectsenvironmentalphysicalpracticesupplieswater
SHARED TOKENS (7): "demand", "effects", "environmental", "physical", "practice", "supplies", "water".
0.140
clientshealthplanprovideproviderprovidersthird-party
SHARED TOKENS (7): "clients", "health", "plan", "provide", "provider", "providers", "third-party".
0.140
commercialheadquarteredhomelistprivatetypeswater
SHARED TOKENS (7): "commercial", "headquartered", "home", "list", "private", "types", "water".
0.140
contractsfactsformgovernslegalmakingmeans
SHARED TOKENS (7): "contracts", "facts", "form", "governs", "legal", "making", "means".
0.120
boisecanyonidahometropolitannampapopulation
SHARED TOKENS (6): "boise", "canyon", "idaho", "metropolitan", "nampa", "population".
0.120
historyindependentlawmeansinglevalue
SHARED TOKENS (6): "history", "independent", "law", "mean", "single", "value".
0.120
approximatelybusinessesfiregroupindependentowned
SHARED TOKENS (6): "approximately", "businesses", "fire", "group", "independent", "owned".
0.120
linesownershipprivatepropertypublicresources
SHARED TOKENS (6): "lines", "ownership", "private", "property", "public", "resources".
0.120
environmentalhealthlandpublicriskwildfire
SHARED TOKENS (6): "environmental", "health", "land", "public", "risk", "wildfire".
0.120
Allstate ↗ Q2645636 KW CROSS HIGH
billionheadquarteredindependentlistoperationsowned
SHARED TOKENS (6): "billion", "headquartered", "independent", "list", "operations", "owned".
0.100
amongclaimsmanagementriskworkers
SHARED TOKENS (5): "among", "claims", "management", "risk", "workers".
0.100
agentbuyersintermediaryrepresentsspecific
SHARED TOKENS (5): "agent", "buyers", "intermediary", "represents", "specific".
◈ Frequently Asked Questions
Insurance Coverage × Water Rights — Treasure Valley
HAIKU · HIGH GATE
Do standard homeowner policies in Boise and Nampa cover losses from irrigation water diversion disputes?
Standard homeowner policies sold in Ada County and Canyon County typically exclude coverage for damages arising from water rights conflicts or irrigation system failures tied to Snake River or Boise River allocation disputes. Property owners in the Treasure Valley metropolitan area should review their coverage documents with their insurer to determine whether water rights easement disputes trigger exclusions under their current policies.
How do Idaho Legislature water rights laws affect crop insurance eligibility for agricultural operations in Star and Caldwell?
Agricultural producers in Canyon County and surrounding Treasure Valley jurisdictions must maintain valid water rights documentation under Idaho statute to qualify for crop insurance coverage during drought years. Lenders and insurers in the region increasingly require proof of senior water rights on the Snake River or Boise River system before approving irrigation-dependent operations for multi-peril policies.
What insurance considerations apply to commercial properties along easements affecting Snake River water access in the Treasure Valley?
Commercial property insurers in Boise, Nampa, Caldwell, and Kuna assess liability and business interruption risks when easements grant third parties water extraction rights across a policyholder's land. Ada County and Canyon County title insurance companies now flag water rights easements as material restrictions that may limit coverage for income-producing properties dependent on uninterrupted irrigation access.
How does drought-related water rationing by the Idaho Legislature impact drought insurance claims for Treasure Valley agricultural operations?
When Idaho Legislature-mandated drought restrictions reduce Snake River allocations to farms in Ada County, Canyon County, and surrounding areas, drought insurance policies typically require claimants to prove compliance with official water reduction orders. Boise State University agricultural extension programs advise Treasure Valley operators that coverage denials often result when policyholders fail to document government-imposed water cutbacks alongside their crop losses.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Insurance Coverage × Water Rights 18 QID bridges 273 edges 6,911 ext links 2026-07-17 21:32:05 UTC e9ef4706d2e37262
Insurance Coverage corridor ↗ Water Rights corridor ↗ Water Rights × Insurance Coverage ↗ boisestandard.org/standard ↗
Parent Corridors
Insurance Coverage × All Other Verticals