—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Insurance Coverage ↔ relates to ↔ Biotech Life Sciences

19 Wikipedia bridge articles confirmed in both vertical ledgers. 274 deterministic cross-vertical edges. 7,036 external source links harvested. Every edge provenance-stamped. Every claim auditable.

19 QID Bridge Articles
274 Cross Edges
7,036 External Sources
308 Wikipedia Articles
21 🌲 Evergreen
187 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Insurance Coverage
× Biotech Life Sciences
QID Bridge Articles
19
confirmed Wikipedia overlap
Total Cross Edges
274
External Sources Harvested
7,036
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
College of Western Idaho
score: 1.1500  ·  type: exact_title_cross  ·  23 shared tokens
QID Bridge Titles (19)
College of Western IdahoIdahoBoise metropolitan areaTreasure ValleyBoise State UniversityUnited States Department of AgricultureBoise RiverOnline marketplaceMergers and acquisitionsBoise, IdahoCenters for Medicare & Medicaid ServicesOccupational Safety and Health AdministrationPrivate equityNampa, IdahoTrinity HealthAda County, IdahoCaldwell, IdahoCanyon County, IdahoMeridian, Idaho
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitancapitalhomeadacanyonwesterncollegenampaprogramstreasurevalleyagriculturalapproximatelynorthwestriverhealthdepartment
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 21:27:27 UTC
Content Hash
7db719d4179a9d42
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
19 BRIDGES
College of Western Idaho
Q5146875 EXACT TITLE 1.150
QID OVERLAP: Q5146875 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (23): "academic", "ada", "board", "boise", "campus", "canyon", "college", "development", "education", "governed", "idaho", "nampa", "population", "programs", "public", "reported", "residents", "students", "technical", "treasure".... | URL->A (1): https://cwi.edu/. | EXACT TITLE in insurance_coverage: "College of Western Idaho". | EXACT TITLE in biotech_life_sciences: "College of Western Idaho".
academicadaboardboisecampuscanyoncollegedevelopmenteducationgovernedidahonampapopulationprogramspublicreportedresidentsstudentstechnicaltreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (31): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "contains", "crop", "economy", "geographic", "idaho", "isolated", "land", "manufacturing", "million", "national", "northwest", "official", "periods".... | EXACT TITLE in insurance_coverage: "Idaho". | EXACT TITLE in biotech_life_sciences: "Idaho".
agriculturalagricultureapproximatelyassociatedbestboisecapitalcontainscropeconomygeographicidahoisolatedlandmanufacturingmillionnationalnorthwestofficialperiodspopulationproductsrelativelyriversectorseparatesmallsuppliestechnologyuses+1
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Boise metropolitan area
Q4938481 EXACT TITLE 1.000
QID OVERLAP: Q4938481 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (18): "ada", "boise", "canyon", "commonly", "designated", "home", "idaho", "main", "meridian", "metropolitan", "nampa", "nearly", "northwest", "percent", "population", "section", "treasure", "valley". | EXACT TITLE in biotech_life_sciences: "Boise metropolitan area".
adaboisecanyoncommonlydesignatedhomeidahomainmeridianmetropolitannampanearlynorthwestpercentpopulationsectiontreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (15): "agricultural", "association", "boise", "commerce", "historically", "idaho", "land", "local", "metropolitan", "region", "resources", "river", "treasure", "valley", "western". | EXACT TITLE in insurance_coverage: "Treasure Valley". | EXACT TITLE in biotech_life_sciences: "Treasure Valley".
agriculturalassociationboisecommercehistoricallyidaholandlocalmetropolitanregionresourcesrivertreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (19): "activity", "among", "boise", "business", "classified", "college", "education", "engineering", "health", "idaho", "independent", "million", "program", "programs", "public", "reported", "research", "teams", "university". | EXACT TITLE in insurance_coverage: "Boise State University". | EXACT TITLE in biotech_life_sciences: "Boise State University".
activityamongboisebusinessclassifiedcollegeeducationengineeringhealthidahoindependentmillionprogramprogramspublicreportedresearchteamsuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
United States Department of Agriculture
Q501542 EXACT TITLE 1.000
QID OVERLAP: Q501542 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:branch). | SHARED TOKENS (21): "administers", "agency", "agricultural", "agriculture", "approximately", "commercial", "communities", "current", "department", "directly", "federal", "government", "livestock", "national", "program", "programs", "reports", "resources", "trade", "usda".... | EXACT TITLE in insurance_coverage: "United States Department of Agriculture".
administersagencyagriculturalagricultureapproximatelycommercialcommunitiescurrentdepartmentdirectlyfederalgovernmentlivestocknationalprogramprogramsreportsresourcestradeusdaworks
Approximately 71% of the USDA's $213 billion budget goes towards nutrition assistance programs administered by the Food and Nutrition Service (FNS). The largest component of the FNS budget is the Supplemental Nutrition Assistance Program (formerly known as the 'Food Stamp' program), which is the cornerstone of USDA's nutrition assistance.
Technical and financial assistance The NRCS Strike Force Initiative has identified impoverished counties in Mississippi, Georgia and Arkansas to receive increased outreach and training regarding USDA assistance programs. USDA credits this increased outreach with generating a 196 percent increase in contracts, representing more than 250,000 acres of farmland, in its Environmental Quality Incentives Program. In 2001, NRCS funded and published a study, "Environmental Justice: Perceptions of Issues, Awareness and Assistance," focused on rural, Southern "Black Belt" counties and analyzing how the NRCS workforce could more effectively integrate environmental justice into impacted communities. The Farm Services Agency in 2011 devoted $100,000 of its Socially Disadvantaged Farmers and Ranchers program budget to improving its outreach to counties with persistent poverty. USDA's Risk Management Agency has initiated education and outreach to low-income farmers regarding use of biological controls, rather than pesticides, for pest control. The Rural Utilities Service administers water and wastewater loans, including SEARCH Grants that are targeted to financially distressed, small rural communities and other opportunities specifically for Alaskan Native villages. Mapping USFS has established several Urban Field Stations, to research urban natural resources' structure, function, stewardship, and benefits. By mapping urban tree coverage, the agency hopes to identify and prioritize EJ communities for urban forest projects. Another initiative highlighted by the agency is the Food and Nutrition Service and Economic Research Service's Food Desert Locator. The Locator provides a spatial view of food deserts, defined as a low-income census tract where a substantial number or share of residents has low access to a supermarket or large grocery store.
Overview The USDA is divided into eight distinct mission areas, each of which have at least one agency dedicated to the theme of the mission area: Farm Production and Conservation (FPAC) FPAC Business Center Farm Service Agency (FSA) Natural Resources Conservation Service (NRCS) Risk Management Agency (RMA) Food, Nutrition, and Consumer Services (FNCS) Food and Nutrition Service (FNS) Food Safety (FS) Food Safety and Inspection Service (FSIS) Marketing and Regulatory Programs (MRP)
Boise River
Q891080 EXACT TITLE 0.820
QID OVERLAP: Q891080 in insurance_coverage (tier:evergreen) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (6): "agricultural", "approximately", "boise", "idaho", "river", "western". | EXACT TITLE in insurance_coverage: "Boise River". | EXACT TITLE in biotech_life_sciences: "Boise River".
agriculturalapproximatelyboiseidahoriverwestern
ise, as well as part of the western Snake River Plain. The watershed encompasses approximately 4,100 square miles (11,000 km2) of highly diverse habitats, including alpine canyons, forest, rangeland, agricultural lands, and urban areas. Description The Boise River rises in three separate forks in the Sawtooth Range at elevations exceeding 10,000 feet (3,050 m), and is formed by the confluence of its North and Middle forks. The North Fork, 50 miles (80 km) long, rises in the Sawtooth Wilderness Area, along the Boise–Elmore county line, 60 miles (100 km) northeast of Boise. It flows generally southwest through the remote mountains in the Boise National Forest. The Middle Fork, approximately 52 miles (84 km) in length, rises within 12 miles (19 km) of the North Fork in the southern Sawtooth Wilderness Area in northeastern Elmore County. It flows west-southwest near the town of Atlanta, joining the North Fork to form the Boise River, approximately 15 miles (24 km) southeast of Idaho City.
History The river was called "Reed's River" in the early 19th century, named after Pacific Fur Company employee John Reed, who explored parts of the river throughout 1813 and 1814. The river is diverted to canals for irrigation on the plain west of what is now Boise. The dams that form the mountain reservoirs were constructed as part of the Bureau of Reclamation's "Boise Project" to provide agricultural irrigation, hydroelectricity, drinking water, and flood control to Boise and the Treasure Valley. The major projects' initial completion dates were: 1909 – Boise River Diversion Dam & New York Canal 1915 – Arrowrock Dam 1950 – Anderson Ranch Dam - (S. Fork) 1955 – Lucky Peak Dam - (U.S. Army Corps of Engineers) The Boise River was proposed for 50 years for a dam at Twin Springs, culminating in a 1966 Project Travois proposal, which would have used nuclear explosives to either create large amounts of rockfill aggregate for dam construction, or to induce a landslide that would have much the same effect. Project Travois was a component of Project Plowshare.
Recreation The river is a popular destination for floating, specifically on the Boise greenbelt. Tubers and floaters launch at Barber Park and land at Ann Morrison Park, between major irrigation diversion dams. Several minor diversion weirs are passed as well as several bridges on the 6-mile (10 km) trip. Water skiing is popular above the dam at the Lucky Peak Reservoir. On the lower (warmwater) course of the river, low summer flows and poorer water quality from agricultural runoff limit fishery production. This section of river supports a fair fishery for largemouth bass, smallmouth bass, and channel catfish. Upstream from Star, the river is a coldwater stream and supports a greater variety of fish. The most prevalent species on this section is mountain whitefish, as well as hatchery-reared rainbow trout, wild rainbow trout, and brown trout. Upstream from Lucky Peak and Arrowrock reservoirs, the river and its tributaries contain excellent populations of wild rainbow trout, mountain whitefish, and bull trout.
O
Q3390477 QID OVERLAP 0.800
QID OVERLAP: Q3390477 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (19): "availability", "consumer", "consumers", "general", "higher", "information", "multiple", "online", "operator", "process", "product", "products", "providers", "segment", "single", "site", "type", "types", "users".
availabilityconsumerconsumersgeneralhigherinformationmultipleonlineoperatorprocessproductproductsproviderssegmentsinglesitetypetypesusers
s of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
information is provided by multiple third parties. Online marketplaces are the primary type of multichannel ecommerce and can be a way to streamline the production process. In an online marketplace, consumer transactions are processed by the marketplace operator and then delivered and fulfilled by the participating retailers or wholesalers. These types of websites allow users to register and sell single items to many items for a "post-selling" fee. Because marketplaces aggregate products from a wide array of providers, the selection is wider, and availability is higher than in vendor-specific online retail stores.
is wider, and availability is higher than in vendor-specific online retail stores. Some online marketplaces have a wide variety of general interest products that cater to almost all the needs of the consumers, others are consumer specific and cater to a particular segment. B2B online marketplaces Business-to-business (B2B) online marketplaces are platforms that allow companies to buy and sell products or services to other businesses. These marketplaces typically focus on a specific product or service category and are used by businesses to find suppliers, negotiate prices, and manage logistics. Some examples of B2B online marketplaces include VerticalNet, Commerce One, and Covisint, which were some of the earliest B2B marketplaces to emerge in the early days of e-commerce.
Mergers and acquisitions
QID OVERLAP 0.800
QID OVERLAP: Q731112 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (40): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "certain", "consolidation", "control", "corporate", "create", "department", "described", "direct", "effects", "entity", "federal", "governed"....
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcertainconsolidationcontrolcorporatecreatedepartmentdescribeddirecteffectsentityfederalgovernedgovernmentlawlegalmanagementmarketoperatingoperationsorganizationownershipposition+10
In business, mergers and acquisitions (M&A) are transactions where the ownership of a company, business organization, or one of their operating units is transferred to or consolidated with another entity. They may happen through direct absorption, a merger, a tender offer or a hostile takeover. As a central aspect of corporate strategy and strategic management, M&A activity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
tivity enables companies to expand, diversify, restructure, or realign their competitive position. In legal terms, a merger is the consolidation of two entities into a single legal entity, whereas an acquisition occurs when one entity takes ownership of another entity's share capital, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
al, equity interests or assets. Both typically result in assets, liabilities, and operations being combined under unified control, and a transaction described as a merger may economically resemble an acquisition, and vice versa. M&A transactions are governed by corporate law and are typically subject to regulatory review, particularly under competition (antitrust) law. Many countries require notification and review of proposed mergers to allow the government to assess their potential effects on market competition. In the United States, for example, the Clayton Act prohibits any merger or acquisition that may "substantially lessen competition" or "tend to create a monopoly", and the Hart–Scott–Rodino Act requires providing advance notice to the U.S.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "employers", "home", "idaho", "locally", "major", "manufacturing", "metropolitan", "population", "river", "technology", "treasure", "valley".
adaannualboisecapitalemployershomeidaholocallymajormanufacturingmetropolitanpopulationrivertechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Centers for Medicare & Medicaid Services
Q5060058 QID OVERLAP 0.800
QID OVERLAP: Q5060058 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (30): "act", "administer", "administers", "administration", "agency", "care", "cms", "commonly", "department", "facilities", "federal", "financing", "gov", "health", "healthcare", "home", "human", "insurance", "medicaid", "medicare"....
actadministeradministersadministrationagencycarecmscommonlydepartmentfacilitiesfederalfinancinggovhealthhealthcarehomehumaninsurancemedicaidmedicarenursingoversightprocessprogramprogramsqualityreportsstandardssystemworks
ce portability standards. In addition to these programs, CMS has other responsibilities, including the administrative simplification standards from the Health Insurance Portability and Accountability Act of 1996 (HIPAA), quality standards in long-term care facilities (more commonly referred to as nursing homes) through its survey and certification process, clinical laboratory quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States.
ry quality standards under the Clinical Laboratory Improvement Amendments, and oversight of HealthCare.gov. CMS was previously known as the Health Care Financing Administration (HCFA) until 2001. CMS actively inspects and reports on every nursing home in the United States. This includes maintaining the 5-Star Quality Rating System. Organization The agency carries out its responsibilities from its national headquarters located in Woodlawn, Maryland, and its 10 regional offices. It is organized around six centers to support its key functions.
Workforce CMS employs over 6,000 people, of whom about 4,000 are located at its headquarters in Woodlawn, Maryland. The remaining employees are located in the Hubert H. Humphrey Building in Washington, D.C., the 10 regional offices listed below, and in various field offices located throughout the United States. The head of CMS is the administrator of the Centers for Medicare & Medicaid Services. The position is appointed by the president and confirmed by the Senate. On May 27, 2021, Chiquita Brooks-LaSure was sworn in as administrator, the first black woman to serve in the role. History Originally, the name "Medicare" in the United States referred to a program providing medical care for families of people serving in the military as part of the Dependents' Medical Care Act, which was passed in 1956. President Dwight D. Eisenhower held the first White House Conference on Aging in January 1961, in which creating a health care program for social security beneficiaries was proposed. President Lyndon B. Johnson signed the Social Security Amendments on July 30, 1965, establishing both Medicare and Medicaid. Arthur E. Hess, a deputy commissioner of the Social Security Administration, was named as first director of the Bureau of Health Insurance in 1965, placing him as the first executive in charge of the Medicare program. At the time, the program provided health insurance to 19 million Americans. The Social Security Administration (SSA) became responsible for the administration of Medicare and the Social and Rehabilitation Service (SRS) became responsible for the administration of Medicaid. Both agencies were organized under what was then known as the Department of Health, Education, and Welfare (HEW), in 1965. Since then, HEW, has been reorganized as the Department of Health and Human Services (HHS) in 1980. This consequently brought Medicare and Medicaid under the jurisdiction of the HHS. In March 1977, the Health Care Financing Administration (HCFA) was established under HEW. HCFA became responsible for the coordination of Medicare and Medicaid. The responsibility for enrolling beneficiaries into Medicare and processing premium payments remained with SSA. HCFA was renamed the Centers for Medicare & Medicaid Services on July 1, 2001. This was later codified in law by the Medicare Prescription Drug, Improvement, and Modernization Act of 2003. In 2013, a report by the inspector general found that CMS had paid $23 million in benefits to deceased beneficiaries in 2011. In April 2014, CMS released raw claims data from 2012 that gave a look into what types of doctors billed Medicare the most. In January 2018, CMS released guidelines for states to use to require Medicaid beneficiaries to continue receiving coverage. These guidelines came in response to then-President Trump's announcement that he would allow states to impose work requirements in Medicaid. In October, CMS reported a data breach of 75,000 people's personal data due to a hack. In February 2018, CMS removed a notice from its website that informed insurance companies they were not allowed to charge physicians a fee when the companies paid the doctors for their work. This has resulted in doctors being charged up to a 5% fee on their compensation, adding up to billions of dollars annually. In January 2021, CMS passed a rule that would cover "breakthrough technology" for four years after they received FDA approval. In September 2021, CMS submitted a proposal to repeal the rule based on safety concerns. On September 19, 2023, the Subcommittee on Health held a hearing titled "Examining Policies to Improve Seniors’ Access to Innovative Drugs, Medical Devices, and Technology." Dora Hughes, the acting director of the Center for Clinical Standards and Quality at the U.S. Centers for Medicare and Medicaid Services (CMS), defended the proposed Transitional Coverage for Emerging Technologies (TCET) pathway, which aims to restrict coverage for breakthrough medical devices to five reviews a year. Some lawmakers and medtech trade groups called for expanding the pathway to include diagnostics.
O
Q746186 QID OVERLAP 0.800
QID OVERLAP: Q746186 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (22): "act", "administration", "agency", "costs", "department", "education", "effects", "employment", "established", "federal", "health", "inspections", "labor", "law", "mission", "occupational", "outreach", "regulations", "regulatory", "standards"....
actadministrationagencycostsdepartmenteducationeffectsemploymentestablishedfederalhealthinspectionslaborlawmissionoccupationaloutreachregulationsregulatorystandardstrainingworking
States Department of Labor that originally had federal visitorial powers to inspect and examine workplaces. The United States Congress established the agency under the Occupational Safety and Health Act (OSH Act), which President Richard M. Nixon signed into law on December 29, 1970. OSHA's mission is to "assure safe and healthy working conditions for working men and women by setting and enforcing standards and by providing training, outreach, education, and assistance". The agency is also charged with enforcing a variety of whistleblower statutes and regulations.
History From its creation in 1934, the Bureau of Labor Standards of the Department of Labor addressed some work safety issues. The economic boom and associated labor turnover during World War II worsened work safety in nearly all areas of the United States economy, but after 1945 accidents again declined as long-term forces reasserted themselves. Additionally, new and powerful labor unions played an increasingly important role in worker safety post-World War II. In the 1960s, increasing economic expansion again led to rising injury rates, and the resulting political pressures led Congress to establish the Occupational Safety and Health Administration (OSHA) on April 28, 1971, the date that the Occupational Health and Safety Act became effective. The new agency incorporated much of what had been the original Bureau of Labor Standards. George Guenther was appointed by Labor Secretary James D. Hodgson as the agency's first director. OSHA has run a number of training, compliance assistance, and health and safety recognition programs throughout its history. The OSHA Training Institute, which trains government and private sector health and safety personnel, began in 1972. In 1978, the agency began a grant-making program, now called the Susan Harwood Training Grant Program, to train workers and employers in reducing workplace hazards.
OSH Act coverage The OSH Act covers most private-sector employers and their workers, in addition to some public-sector employers and workers in the 50 states and certain territories and jurisdictions under federal authority. Those jurisdictions include the District of Columbia, Puerto Rico, the Virgin Islands, American Samoa, Guam, Northern Mariana Islands, Wake Island, Johnston Island, and the Outer Continental Shelf Lands as defined in the Outer Continental Shelf Lands Act. Private sector employers The OSH Act covers most private sector employers in all 50 states, the District of Columbia, and other U.S. jurisdictions—either directly through federal OSHA or through an OSHA-approved state plan. State plans are OSHA-approved job safety and health programs operated by individual states instead of federal OSHA. Federal OSHA approves and monitors all state plans and provides as much as fifty percent of the funding for each program.
P
Q476115 QID OVERLAP 0.800
QID OVERLAP: Q476115 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (23): "business", "capital", "category", "changes", "control", "described", "development", "finance", "financing", "firms", "general", "management", "operational", "ownership", "private", "product", "products", "provide", "public", "rather"....
businesscapitalcategorychangescontroldescribeddevelopmentfinancefinancingfirmsgeneralmanagementoperationalownershipprivateproductproductsprovidepublicratherrolespecializedworking
l restructuring, management changes, and shifts in ownership and control. As a financial product, a private-equity fund is private capital for financing a long-term investment strategy in an illiquid business enterprise.
An Investment manager (the private equity investor) raises money from institutional investors (e.g., hedge funds, pension funds, university endowments, and ultra-high-net-worth individuals) to pursue a particular investment strategy. The fund's raised proceeds are placed into an investment fund, of which the investment manager acts as a general partner (GP) and the institutional investors act as limited partners (LPs). The investment manager then purchases equity ownership stakes in companies by using a combination of equity and debt financing, with the goal of generating returns on the equity invested, including any subsequent equity investments into the target companies, over a target horizon based on the particular investment fund and strategy (typically 4–7 years). From a financial modeling perspective, the primary levers available to private equity investors to drive returns are: Revenue growth Margin expansion (typically an EBITDA margin) Free cash flow generation / debt paydown Valuation multiple expansion (typically an Enterprise Value / EBITDA multiple) Value creation strategies can vary widely by private equity fund. For example, some investors may target increasing sales in new or existing markets (driving revenue growth), and others may look to reduce costs through headcount reduction (expanding margins). Many strategies incorporate some amount of corporate governance restructuring, for example, setting up a board of directors or updating the target's managerial reporting structure. The use of debt financing in acquiring companies increases an investment's return on equity by reducing the amount of initial equity required to purchase the target. Moreover, the interest payments are tax-deductible, so the debt financing reduces corporate taxes and thus increases total after-tax cash flows generated by the business. Following a series of high-profile bankruptcies, aggressive leverage usage by private equity funds has declined in recent decades. In 2005, approximately 70% of the average private equity acquisition represented debt, but it was closer to 50% in 2020. Firms that assume large operational risks (e.g., "turnarounds") will usually apply far lower leverage levels to acquired companies in order to provide management with more financial flexibility; firms taking fewer operational risks will often try to maximize available leverage and focus on investments that generate strong, stable cash flows needed to service the higher debt balances. Over time, "private equity" has come to refer to many different investment strategies, including leveraged buyout, distressed securities, venture capital, growth capital, and mezzanine capital.
Strategies The strategies private-equity firms may use are as follows, leveraged buyout being the most common. Leveraged buyout Leveraged buyout (LBO) refers to a strategy of making equity investments as part of a transaction in which a company, business unit, or business asset is acquired from the current shareholders typically with the use of financial leverage. The companies involved in these transactions are typically mature and generate operating cash flows. Private-equity firms view target companies as either Platform companies, which have sufficient scale and a successful business model to act as a stand-alone entity, or as add-on / tuck-in / bolt-on acquisitions, which would include companies with insufficient scale or other deficits. Leveraged buyouts involve a financial sponsor agreeing to an acquisition without itself committing all the capital required for the acquisition. To do this, the financial sponsor will raise acquisition debt, which looks to the cash flows of the acquisition target to make interest and principal payments. Acquisition debt in an LBO is often non-recourse to the financial sponsor and has no claim on other investments managed by the financial sponsor. Therefore, an LBO transaction's financial structure is particularly attractive to a fund's limited partners, allowing them the benefits of leverage, but limiting the degree of recourse of that leverage. This kind of financing structure leverage benefits an LBO's financial sponsor in two ways: (1) the investor only needs to provide a fraction of the capital for the acquisition, and (2) the returns to the investor will be enhanced, as long as the return on assets exceeds the cost of the debt. As a percentage of the purchase price for a leverage buyout target, the amount of debt used to finance a transaction varies according to the financial condition and history of the acquisition target, market conditions, the willingness of lenders to extend credit (both to the LBO's financial sponsors and the company to be acquired) and the interest costs and the ability of the company to cover those costs. Historically the debt portion of a LBO will range from 60 to 90% of the purchase price.
Nampa, Idaho
Q622633 QID OVERLAP 0.780
QID OVERLAP: Q622633 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (14): "according", "boise", "canyon", "college", "home", "idaho", "meridian", "metropolitan", "nampa", "northwest", "population", "principal", "university", "western".
accordingboisecanyoncollegehomeidahomeridianmetropolitannampanorthwestpopulationprincipaluniversitywestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
T
QID OVERLAP 0.740
QID OVERLAP: Q7842827 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (12): "care", "facilities", "health", "healthcare", "home", "hospital", "idaho", "network", "operates", "operating", "support", "system".
carefacilitieshealthhealthcarehomehospitalidahonetworkoperatesoperatingsupportsystem
Trinity Health is an American not-for-profit Catholic health system operating 92 hospitals in 22 states, including 120 continuing care locations encompassing home care, hospice, PACE and senior living facilities. Based in Livonia, Michigan, Trinity Health employs more than 120,000 people including 5,300 physicians. Sponsored by Catholic Health Ministries, Trinity Health operates facilities in the US states of Alabama, California, Connecticut, Delaware, Florida, Georgia, Idaho, Illinois, Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area.
Indiana, Iowa, Maine, Maryland, Massachusetts, Michigan, Nebraska, New Jersey, New York, North Carolina, Ohio, Oregon, Pennsylvania, and South Dakota. Trinity Health Chicopee is a comprehensive healthcare system that offers a wide range of services to patients in the Chicopee, Massachusetts area. The system includes a hospital, a network of outpatient clinics, and a variety of support services. History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
History In May 2000, Trinity Health was formed through a merger between Holy Cross Health System in South Bend, Indiana, and Mercy Health Services in Farmington Hills, Michigan. The new organization initially comprised 25 health ministries across seven states—California, Idaho, Indiana, Iowa, Maryland, Michigan, and Ohio—with 45,000 employees and 7,000 physicians. Trinity Health's headquarters were established first in Farmington Hills, Michigan, and later in Novi, Michigan. At the time, Trinity Health was the 10th largest health system in the nation and the fourth largest Catholic health care system in the country, by total number of hospitals and total bed count, respectively. It operated 47 acute-care hospitals, 432 outpatient facilities, 32 long-term care facilities, and numerous home health offices and hospice programs in 10 states. In 2013, Trinity Health and Catholic Health East merged into a single organization. It acquired St. Mary's Hospital in Waterbury, Connecticut in 2015. For 2018, revenue increased to $18.3 billion. Total assets of $26.2 billion were recorded, with operating income of $401.3 million. As of June 30, 2018, it had 94 acute care hospitals, and reached 22 states. In September 2018, Trinity Health formed Trinity Health Mid-Atlantic with three other hospitals. Trinity Health held a 50.4% stake in BayCare Health System, until June 27, 2024, when a Definitive Agreement signed between the two transferred $4.0 billion in cash from BayCare and disaffiliated Trinity Health as a corporate member. BayCare assumed full ownership of member hospitals and other facilities previously owned by Trinity Health, St. Anthony's Hospital and the five St.
Ada County, Idaho
Q109820 QID OVERLAP 0.700
QID OVERLAP: Q109820 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:evergreen). | SHARED TOKENS (10): "ada", "boise", "capital", "home", "idaho", "local", "metropolitan", "northwest", "population", "private".
adaboisecapitalhomeidaholocalmetropolitannorthwestpopulationprivate
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidahomakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in insurance_coverage (tier:branch) and biotech_life_sciences (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
255 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP255 edges
🌲 EVERGREEN2 edges
0.650
accurateactadministrationagainstagencyavailabilitybuildingscommunitiesconstructionconsumerscontrolcostscovereddevelopmentemergencyenforcementexistingfederalgenerallygovernment
SHARED TOKENS (37): "accurate", "act", "administration", "against", "agency", "availability", "buildings", "communities", "construction", "consumers", "control", "costs", "covered", "development", "emergency", "enforcement", "existing", "federal", "generally", "government".... | URL->A (1): http://www.floodsmart.gov/. | EXACT TITLE in insurance_coverage: "National Flood Insurance Program".
0.610
agencycommercecompensationdecisionsdepartmentestablishedidahoindustrialinsurancelaborresponsiblesystemworkers
SHARED TOKENS (13): "agency", "commerce", "compensation", "decisions", "department", "established", "idaho", "industrial", "insurance", "labor", "responsible", "system", "workers". | URL->A (1): https://iic.idaho.gov/. | EXACT TITLE in insurance_coverage: "Idaho Industrial Commission".
🌿 BRANCH187 edges
0.500
Antibody ↗ Q79460 EXACT TITLE
allowingbecomecapacityclassificationcontainsdeliverydemonstratedescribingdirectlydistributionessentialformfunctionsgeneralgenerallyhumanidentifyindividualleastless
SHARED TOKENS (30): "allowing", "become", "capacity", "classification", "contains", "delivery", "demonstrate", "describing", "directly", "distribution", "essential", "form", "functions", "general", "generally", "human", "identify", "individual", "least", "less".... | EXACT TITLE in biotech_life_sciences: "Antibody".
0.500
Biotechnology ↗ Q7108 EXACT TITLE
agricultureanimalsanotherbenefitscertainconsequentlycoredefinitionsdevelopmentdirectlyengineeringenvironmentalexistingfunctionsgenerallyhigherhumaninternationalknowledgelife
SHARED TOKENS (51): "agriculture", "animals", "another", "benefits", "certain", "consequently", "core", "definitions", "development", "directly", "engineering", "environmental", "existing", "functions", "generally", "higher", "human", "international", "knowledge", "life".... | EXACT TITLE in biotech_life_sciences: "Biotechnology".
0.500
amongapproximatelyboisecampusclassifiedestablishedidaholatermainoperatesprofessionalpublicrepresentedresearchstatewidestudentsuniversity
SHARED TOKENS (17): "among", "approximately", "boise", "campus", "classified", "established", "idaho", "later", "main", "operates", "professional", "public", "represented", "research", "statewide", "students", "university". | EXACT TITLE in biotech_life_sciences: "University of Idaho".
0.500
Microscopy ↗ Q1074953 EXACT TITLE
allowinganothercreatedevelopmentessentialhigherlifephysicalprocessremainssmallstandardsubjectstechnicalusesview
SHARED TOKENS (16): "allowing", "another", "create", "development", "essential", "higher", "life", "physical", "process", "remains", "small", "standard", "subjects", "technical", "uses", "view". | EXACT TITLE in biotech_life_sciences: "Microscopy".
0.500
accordingaccreditationagencyassociationbecomebetterbureaubusinessbusinessescodeconsumersevenindustryinternationallocalmissionnearlyoperatingorganizationorganizations
SHARED TOKENS (30): "according", "accreditation", "agency", "association", "become", "better", "bureau", "business", "businesses", "code", "consumers", "even", "industry", "international", "local", "mission", "nearly", "operating", "organization", "organizations".... | EXACT TITLE in insurance_coverage: "Better Business Bureau".
0.500
administrationboardcompensationcouncildatadatabasedepartmentdetermineexperienceheadquarteredinformationinsurancelabornationaloperatesorganizationreportedsupportssystemsworkers
SHARED TOKENS (20): "administration", "board", "compensation", "council", "data", "database", "department", "determine", "experience", "headquartered", "information", "insurance", "labor", "national", "operates", "organization", "reported", "supports", "systems", "workers". | EXACT TITLE in insurance_coverage: "National Council on Compensation Insurance".
0.500
Wildfire ↗ Q169950 EXACT TITLE
addchangeclassifiedcreatecreatesdependdirecteconomiceffectsequipmentfiregrowthhealthhumanlandland-uselevelslinesmanagementmaterial
SHARED TOKENS (30): "add", "change", "classified", "create", "creates", "depend", "direct", "economic", "effects", "equipment", "fire", "growth", "health", "human", "land", "land-use", "levels", "lines", "management", "material".... | EXACT TITLE in insurance_coverage: "Wildfire". | EXACT TITLE in biotech_life_sciences: "Wildfire".
0.500
Vaccine ↗ Q134808 EXACT TITLE
administrationagainstalreadyassociatedcontainsdescribeddevelopmentdiseaseseffectshealthlicensedorganizationpracticeproposedprotectivereportsresponsiblesystemtitle
SHARED TOKENS (19): "administration", "against", "already", "associated", "contains", "described", "development", "diseases", "effects", "health", "licensed", "organization", "practice", "proposed", "protective", "reports", "responsible", "system", "title". | EXACT TITLE in biotech_life_sciences: "Vaccine".
0.500
accordingamonganotherapplybenefitscertainclassifiedcontrolcorporatedatadecisionsdefinitionsdesigndevelopmentengineeringestimatesevaluationeveneventsfinance
SHARED TOKENS (46): "according", "among", "another", "apply", "benefits", "certain", "classified", "control", "corporate", "data", "decisions", "definitions", "design", "development", "engineering", "estimates", "evaluation", "even", "events", "finance".... | EXACT TITLE in insurance_coverage: "Risk management".
0.500
actaddadministrationauthoritycontrolfederalformlawmedicalmembersnationalprincipalproductprovisionsregulationsrequirementsstudy
SHARED TOKENS (17): "act", "add", "administration", "authority", "control", "federal", "form", "law", "medical", "members", "national", "principal", "product", "provisions", "regulations", "requirements", "study". | EXACT TITLE in biotech_life_sciences: "Federal Food, Drug, and Cosmetic Act".
0.500
accordingagencyamongamountassociationbenefitbenefitsbusinesscarecontractcostscoveredcoveringentityevidencefinancegovernmenthealthindividualinsurance
SHARED TOKENS (35): "according", "agency", "among", "amount", "association", "benefit", "benefits", "business", "care", "contract", "costs", "covered", "covering", "entity", "evidence", "finance", "government", "health", "individual", "insurance".... | EXACT TITLE in insurance_coverage: "Health insurance".
0.500
cannotcontractcostsdevelopmentevidenceexperienceforminstitutionsinternationallifemaintainmanagementmarketsmedicalneedorganizationorganizationsprovidequalityreal
SHARED TOKENS (27): "cannot", "contract", "costs", "development", "evidence", "experience", "form", "institutions", "international", "life", "maintain", "management", "markets", "medical", "need", "organization", "organizations", "provide", "quality", "real".... | EXACT TITLE in biotech_life_sciences: "Contract research organization".
0.500
additionalapplybenefitsbeyondbusinesscapacitycategoriesconductdescriptionemployeesentityextendgeneralgenerallyidentifiesidentifyinsuranceliabilitymeansoperations
SHARED TOKENS (35): "additional", "apply", "benefits", "beyond", "business", "capacity", "categories", "conduct", "description", "employees", "entity", "extend", "general", "generally", "identifies", "identify", "insurance", "liability", "means", "operations".... | EXACT TITLE in insurance_coverage: "Additional insured".
0.500
agenciesagencyapprovalsbuildingcategoryclassificationcomplexcropdirectlyengineeringgeneralhumanisolatedmarketmedicaloutsideperformanceproductproductsproposed
SHARED TOKENS (31): "agencies", "agency", "approvals", "building", "category", "classification", "complex", "crop", "directly", "engineering", "general", "human", "isolated", "market", "medical", "outside", "performance", "product", "products", "proposed".... | EXACT TITLE in biotech_life_sciences: "Biopharmaceutical".
0.500
amonganalysisappliedbetterchangedatadecisionsdescriptiondesigndisciplinesdiseasesdistributioneffectsengineeringenvironmentalexposuregeneralhealthhealthcarehistorically
SHARED TOKENS (40): "among", "analysis", "applied", "better", "change", "data", "decisions", "description", "design", "disciplines", "diseases", "distribution", "effects", "engineering", "environmental", "exposure", "general", "health", "healthcare", "historically".... | EXACT TITLE in biotech_life_sciences: "Epidemiology".
0.500
actadministrationagencyapplyenvironmentalfederalintendedlawprivateprotectionpublicqualityregulatedrequiredstandardssystemsystemswater
SHARED TOKENS (18): "act", "administration", "agency", "apply", "environmental", "federal", "intended", "law", "private", "protection", "public", "quality", "regulated", "required", "standards", "system", "systems", "water". | EXACT TITLE in biotech_life_sciences: "Safe Drinking Water Act".
0.500
Immunology ↗ Q101929 EXACT TITLE
againstassociatedbecomedisciplinesdiseasesembeddedessentialhealthlatermaintainphysicalrathersmallstudysurroundingsystemsystemsthemunusualwork
SHARED TOKENS (20): "against", "associated", "become", "disciplines", "diseases", "embedded", "essential", "health", "later", "maintain", "physical", "rather", "small", "study", "surrounding", "system", "systems", "them", "unusual", "work". | EXACT TITLE in biotech_life_sciences: "Immunology".
0.500
activityanimalsbettercomplexcouncilcovereddescribeddetaileddiscoverygoverninghigherlevelsmechanismsmedicalmodelorganizationphysicalplantsprocessesproposed
SHARED TOKENS (26): "activity", "animals", "better", "complex", "council", "covered", "described", "detailed", "discovery", "governing", "higher", "levels", "mechanisms", "medical", "model", "organization", "physical", "plants", "processes", "proposed".... | EXACT TITLE in biotech_life_sciences: "Molecular biology".
0.500
Yelp ↗ Q2299611 EXACT TITLE
annualapproximatelybecomebusinessbusinessescomcompetingdirectoryemployeesestimatesexpandedexternalfollowingheadquarteredinformationlatermarchmilliononlineoperates
SHARED TOKENS (29): "annual", "approximately", "become", "business", "businesses", "com", "competing", "directory", "employees", "estimates", "expanded", "external", "following", "headquartered", "information", "later", "march", "million", "online", "operates".... | EXACT TITLE in insurance_coverage: "Yelp".
0.500
annualanotherbecomebusinesscapitalcompleteconductconsequentlycontroldecisionsdevelopmentemployeesentityfacefinancefinancingfirmsformgrowthhistory
SHARED TOKENS (43): "annual", "another", "become", "business", "capital", "complete", "conduct", "consequently", "control", "decisions", "development", "employees", "entity", "face", "finance", "financing", "firms", "form", "growth", "history".... | EXACT TITLE in biotech_life_sciences: "Venture capital".
0.500
analysisbenefitsboardboardscarecertaincodescommonlyconductdesignateddetermineformhealthhumanindependentinstitutionalinternationalinvolvinglegallymain
SHARED TOKENS (37): "analysis", "benefits", "board", "boards", "care", "certain", "codes", "commonly", "conduct", "designated", "determine", "form", "health", "human", "independent", "institutional", "international", "involving", "legally", "main".... | EXACT TITLE in biotech_life_sciences: "Institutional review board".
0.500
agriculturalanotherindustrialindustrymainmunicipalplantsprocessprocessespurposetreatedtreatmenttypetypesuseswater
SHARED TOKENS (16): "agricultural", "another", "industrial", "industry", "main", "municipal", "plants", "process", "processes", "purpose", "treated", "treatment", "type", "types", "uses", "water". | EXACT TITLE in biotech_life_sciences: "Wastewater treatment".
0.500
amountapproximatelycommonlycomplexcurrentdepartmentengineeringenvironmentalfacilitieshistoricallyhistoryidahoknowledgenationalorganizationsprincipallyresearchsitewesternwritten
SHARED TOKENS (20): "amount", "approximately", "commonly", "complex", "current", "department", "engineering", "environmental", "facilities", "historically", "history", "idaho", "knowledge", "national", "organizations", "principally", "research", "site", "western", "written". | EXACT TITLE in biotech_life_sciences: "Idaho National Laboratory".
0.500
benefitbusinessescategorycertaincreateeconomichumanindividualinformationlandlawlegalmainmodernoriginalownershipprocessesproducerspropertypurpose
SHARED TOKENS (24): "benefit", "businesses", "category", "certain", "create", "economic", "human", "individual", "information", "land", "law", "legal", "main", "modern", "original", "ownership", "processes", "producers", "property", "purpose".... | EXACT TITLE in biotech_life_sciences: "Intellectual property".
0.500
analysisanalyticsbestbusinessdatadecisionsdescriptionhumanmakingmanagementmodelingonlineperformanceplanningpracticesquestionsrelatedreportingthereforetools
SHARED TOKENS (20): "analysis", "analytics", "best", "business", "data", "decisions", "description", "human", "making", "management", "modeling", "online", "performance", "planning", "practices", "questions", "related", "reporting", "therefore", "tools". | EXACT TITLE in insurance_coverage: "Business analytics".
0.500
Microbiology ↗ Q7193 EXACT TITLE
classifiedcomplexcurrentdesigneffectslesslifematerialmeansmedicalpossesssearchsmallstudythemtoolswork
SHARED TOKENS (17): "classified", "complex", "current", "design", "effects", "less", "life", "material", "means", "medical", "possess", "search", "small", "study", "them", "tools", "work". | EXACT TITLE in biotech_life_sciences: "Microbiology".
0.500
Pharmacy ↗ Q614304 EXACT TITLE
affordablebecomebenefitcareclassifiedcommonlydirecthealthinformationinstitutionallinksmodernofficepharmacypracticeproductsprofessionalrelatedscopesupplies
SHARED TOKENS (22): "affordable", "become", "benefit", "care", "classified", "commonly", "direct", "health", "information", "institutional", "links", "modern", "office", "pharmacy", "practice", "products", "professional", "related", "scope", "supplies".... | EXACT TITLE in insurance_coverage: "Pharmacy". | EXACT TITLE in biotech_life_sciences: "Pharmacy".
0.500
agreementsassociatedcontractcovereddeliverydeterminesevidencefinalformfoundgenerallyinsurancelegallypoliciespolicyrequiredrulestandardsubjecttypes
SHARED TOKENS (21): "agreements", "associated", "contract", "covered", "delivery", "determines", "evidence", "final", "form", "found", "generally", "insurance", "legally", "policies", "policy", "required", "rule", "standard", "subject", "types".... | EXACT TITLE in insurance_coverage: "Insurance policy".
0.500
Deed ↗ Q705914 EXACT TITLE
associatedcommonlyconcerningcontractdeliverydocumentinstrumentlawlegallessliabilitymodernownershippracticepropertytitletype
SHARED TOKENS (17): "associated", "commonly", "concerning", "contract", "delivery", "document", "instrument", "law", "legal", "less", "liability", "modern", "ownership", "practice", "property", "title", "type". | EXACT TITLE in insurance_coverage: "Deed". | EXACT TITLE in biotech_life_sciences: "Deed".
0.500
actadministrationagenciescertainclassificationclassificationscontroldecisionsdeterminedistributionenforcementestablishingfederalinternationalisolatedlawlistingmedicalnationalpolicy
SHARED TOKENS (26): "act", "administration", "agencies", "certain", "classification", "classifications", "control", "decisions", "determine", "distribution", "enforcement", "establishing", "federal", "international", "isolated", "law", "listing", "medical", "national", "policy".... | EXACT TITLE in biotech_life_sciences: "Controlled Substances Act".
0.500
amountanalysisautomationcontroldesigndeterminedevelopmentexternalformhundredsmeansmediapracticalprocessprocessesseparatesinglesmallsystemsystems
SHARED TOKENS (22): "amount", "analysis", "automation", "control", "design", "determine", "development", "external", "form", "hundreds", "means", "media", "practical", "process", "processes", "separate", "single", "small", "system", "systems".... | EXACT TITLE in biotech_life_sciences: "Microfluidics".
0.500
Virology ↗ Q7215 EXACT TITLE
agricultureanimalsappliedclassificationcoveringdetectiondiseasesfunctionshealthmedicalofficialplantsproposedresearchsourcestructurestudysubjectthemwelfare
SHARED TOKENS (20): "agriculture", "animals", "applied", "classification", "covering", "detection", "diseases", "functions", "health", "medical", "official", "plants", "proposed", "research", "source", "structure", "study", "subject", "them", "welfare". | EXACT TITLE in biotech_life_sciences: "Virology".
0.500
agriculturalappliedchemicalscontrolcreatedesignengineeringequipmentgenerallyknowledgemedicalprocessprocessesproductsrapidresearchspacestandardssystemstechnology
SHARED TOKENS (22): "agricultural", "applied", "chemicals", "control", "create", "design", "engineering", "equipment", "generally", "knowledge", "medical", "process", "processes", "products", "rapid", "research", "space", "standards", "systems", "technology".... | EXACT TITLE in biotech_life_sciences: "Biological engineering".
0.500
Patent ↗ Q253623 EXACT TITLE
accordingagreementsamongindustrialinternationallawlegalmakingmodelsnationalorganizationprivatepropertyprotectionpublicratherrequirementsscopesubjecttechnology
SHARED TOKENS (22): "according", "agreements", "among", "industrial", "international", "law", "legal", "making", "models", "national", "organization", "private", "property", "protection", "public", "rather", "requirements", "scope", "subject", "technology".... | EXACT TITLE in biotech_life_sciences: "Patent".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactaffordableannualassetsbecomebenefitscarecertaincostscoveredeconomiceligibilityestablishedexpandedfederalgeneralgovernmenthealthhealthcare
SHARED TOKENS (46): "access", "act", "affordable", "annual", "assets", "become", "benefits", "care", "certain", "costs", "covered", "economic", "eligibility", "established", "expanded", "federal", "general", "government", "health", "healthcare".... | EXACT TITLE in insurance_coverage: "Medicaid". | EXACT TITLE in biotech_life_sciences: "Medicaid".
0.500
actadvantagedeliverydirectlyenrollmenthealthinsurancelabormedicalmedicaremembersoperatororiginalplanprivateproviderssystemstype
SHARED TOKENS (18): "act", "advantage", "delivery", "directly", "enrollment", "health", "insurance", "labor", "medical", "medicare", "members", "operator", "original", "plan", "private", "providers", "systems", "type". | EXACT TITLE in insurance_coverage: "Medicare Advantage".
0.500
actadditionaladvantageaffordablebenefitscannotcarechangescommercecostscovereddeliveryeducationeligibilityessentialestimatesexistingexpandedfederalfound
SHARED TOKENS (49): "act", "additional", "advantage", "affordable", "benefits", "cannot", "care", "changes", "commerce", "costs", "covered", "delivery", "education", "eligibility", "essential", "estimates", "existing", "expanded", "federal", "found".... | EXACT TITLE in insurance_coverage: "Affordable Care Act".
0.500
agriculturalanalysisbetterbuildingcomplexdatadevelopmentengineeringinformationmodelingmodelsnetworksprocessregulationrolesinglesoftwarestatisticssystemstext
SHARED TOKENS (21): "agricultural", "analysis", "better", "building", "complex", "data", "development", "engineering", "information", "modeling", "models", "networks", "process", "regulation", "role", "single", "software", "statistics", "systems", "text".... | EXACT TITLE in biotech_life_sciences: "Bioinformatics".
0.500
academicactivitiesagenciesbeyondcollegecurriculumdevelopmenteconomiceducationformalgeneralgovernmentinstitutionalintendedleastlifeonlineprofessionalprogramsrather
SHARED TOKENS (28): "academic", "activities", "agencies", "beyond", "college", "curriculum", "development", "economic", "education", "formal", "general", "government", "institutional", "intended", "least", "life", "online", "professional", "programs", "rather".... | EXACT TITLE in insurance_coverage: "Continuing education".
0.500
Title insurance ↗ EXACT TITLE
againstamountbusinesscommercialcommonlycostscoveredestateevidencefireformfoundgeneralgenerallyindependentinstitutionalinsurancelandlawlegal
SHARED TOKENS (40): "against", "amount", "business", "commercial", "commonly", "costs", "covered", "estate", "evidence", "fire", "form", "found", "general", "generally", "independent", "institutional", "insurance", "land", "law", "legal".... | EXACT TITLE in insurance_coverage: "Title insurance".
0.500
affectagainstamountclaimcompensationcontractcostscovereddedicatedevenexpresslyfinancinggeneralindividualinsurancelegalliabilitymodernpoliciespolicy
SHARED TOKENS (27): "affect", "against", "amount", "claim", "compensation", "contract", "costs", "covered", "dedicated", "even", "expressly", "financing", "general", "individual", "insurance", "legal", "liability", "modern", "policies", "policy".... | EXACT TITLE in insurance_coverage: "Liability insurance".
0.500
actadministrationagencybureaudepartmentdistributionenforcementestablishedfederalgovernmentinvolvinglawnationaloperationsprotectionratherreportsresponsibleuses
SHARED TOKENS (19): "act", "administration", "agency", "bureau", "department", "distribution", "enforcement", "established", "federal", "government", "involving", "law", "national", "operations", "protection", "rather", "reports", "responsible", "uses". | EXACT TITLE in biotech_life_sciences: "Drug Enforcement Administration".
0.500
assetsbroaderbuildingscapitalcategoryconstructiondirectlyeconomicemploymentenvironmentalfacilitiesgovernmenthealthinfrastructuremunicipaloperatorphysicalprivateprotectionpublic
SHARED TOKENS (24): "assets", "broader", "buildings", "capital", "category", "construction", "directly", "economic", "employment", "environmental", "facilities", "government", "health", "infrastructure", "municipal", "operator", "physical", "private", "protection", "public".... | EXACT TITLE in insurance_coverage: "Public works". | EXACT TITLE in biotech_life_sciences: "Public works".
0.500
activityapprovedauthoritybecomebenefitcentercertaincompleteconductcontractcostsdatadesigndevelopmentfunctionsgeneratehealthhumanmedicalmultiple
SHARED TOKENS (37): "activity", "approved", "authority", "become", "benefit", "center", "certain", "complete", "conduct", "contract", "costs", "data", "design", "development", "functions", "generate", "health", "human", "medical", "multiple".... | EXACT TITLE in biotech_life_sciences: "Clinical trial".
0.500
agriculturalappliedconductconsumersdesigndevelopmentdirectlyevaluationlifemodernperformpracticesprocessesproductsscopestudytechnology
SHARED TOKENS (17): "agricultural", "applied", "conduct", "consumers", "design", "development", "directly", "evaluation", "life", "modern", "perform", "practices", "processes", "products", "scope", "study", "technology". | EXACT TITLE in biotech_life_sciences: "Food science".
0.500
affectanalysisassociatedcostsestablishingformhigherlatermaterialpresenceprocesspurposeresultseparatesitessmallersystemthemtypes
SHARED TOKENS (19): "affect", "analysis", "associated", "costs", "establishing", "form", "higher", "later", "material", "presence", "process", "purpose", "result", "separate", "sites", "smaller", "system", "them", "types". | EXACT TITLE in biotech_life_sciences: "Chromatography".
0.500
Insurance ↗ Q43183 EXACT TITLE
againstamountanothercertainclaimcontractcovereddesignatedentityestablishedformhealthinsurancemanagementmeansownershippolicyprotectionrelationshiprelatively
SHARED TOKENS (23): "against", "amount", "another", "certain", "claim", "contract", "covered", "designated", "entity", "established", "form", "health", "insurance", "management", "means", "ownership", "policy", "protection", "relationship", "relatively".... | EXACT TITLE in insurance_coverage: "Insurance". | EXACT TITLE in biotech_life_sciences: "Insurance".
0.500
academicboardsdepartmentgovernedhealthholdhumaninstitutionalinstitutionsinvolvingnearlyoversightpublicresearchreviewrulestandardsubjectstitlewelfare
SHARED TOKENS (20): "academic", "boards", "department", "governed", "health", "hold", "human", "institutional", "institutions", "involving", "nearly", "oversight", "public", "research", "review", "rule", "standard", "subjects", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Common Rule".
0.500
amongcarecurrentdesigndevelopmentengineeringequipmentgrowthhealthhealthcareindustrymakingmanagementmedicalprocurementrelevantresearchrolescopestandards
SHARED TOKENS (22): "among", "care", "current", "design", "development", "engineering", "equipment", "growth", "health", "healthcare", "industry", "making", "management", "medical", "procurement", "relevant", "research", "role", "scope", "standards".... | EXACT TITLE in biotech_life_sciences: "Biomedical engineering".
0.500
Contract ↗ Q93288 EXACT TITLE
activitiesagreementsapplybindingbusinesscategorycertaincodecommercialcontractcontractingdocumentdutiesenforcementestablishinggeneralgenerallygovernedindependentinternational
SHARED TOKENS (38): "activities", "agreements", "apply", "binding", "business", "category", "certain", "code", "commercial", "contract", "contracting", "document", "duties", "enforcement", "establishing", "general", "generally", "governed", "independent", "international".... | EXACT TITLE in insurance_coverage: "Contract". | EXACT TITLE in biotech_life_sciences: "Contract".
0.500
actamountassociatedbenefitcomplexcontrolsdesigndiscoveryengineeringestablishestablishedfederalgeneralintendedlaterlifemajormarketmedicalmodern
SHARED TOKENS (30): "act", "amount", "associated", "benefit", "complex", "controls", "design", "discovery", "engineering", "establish", "established", "federal", "general", "intended", "later", "life", "major", "market", "medical", "modern".... | EXACT TITLE in biotech_life_sciences: "Medical device".
0.500
Indemnity ↗ Q708399 EXACT TITLE
agencyanothercompensationcontracteventsexpresslyfollowingformholdinsurancelawmedicalperformprincipalpurchaserelationshiprelevantspecified
SHARED TOKENS (18): "agency", "another", "compensation", "contract", "events", "expressly", "following", "form", "hold", "insurance", "law", "medical", "perform", "principal", "purchase", "relationship", "relevant", "specified". | EXACT TITLE in insurance_coverage: "Indemnity".
0.500
Mortgage ↗ Q1210094 EXACT TITLE
benefitbuildingbusinessbusinessescapitalcommercialconvertsdemanddescribeddirectlyestateexistingformhomeintermediarieslawlegalmarketsmeansownership
SHARED TOKENS (28): "benefit", "building", "business", "businesses", "capital", "commercial", "converts", "demand", "described", "directly", "estate", "existing", "form", "home", "intermediaries", "law", "legal", "markets", "means", "ownership".... | EXACT TITLE in insurance_coverage: "Mortgage".
0.500
Pathology ↗ Q7208 EXACT TITLE
analysischangesdevelopmentdiseasesgeneralhumanmajormechanismsmedicalmodernphysicalpracticepracticesprocessesresearchstudysystemstreatmenttypes
SHARED TOKENS (19): "analysis", "changes", "development", "diseases", "general", "human", "major", "mechanisms", "medical", "modern", "physical", "practice", "practices", "processes", "research", "study", "systems", "treatment", "types". | EXACT TITLE in biotech_life_sciences: "Pathology".
0.500
accurateanalysisappliedchangesdevelopmentdiseasesengineeringevaluationformgenerallyhealthhealthcareidentifyknowledgelatermainmedicalperformpracticeprocess
SHARED TOKENS (31): "accurate", "analysis", "applied", "changes", "development", "diseases", "engineering", "evaluation", "form", "generally", "health", "healthcare", "identify", "knowledge", "later", "main", "medical", "perform", "practice", "process".... | EXACT TITLE in biotech_life_sciences: "Clinical chemistry".
0.500
academicactivitiesanalysisautomationcommercialconductdatadevelopmentgenerallygovernmentproceduresprocessprocessesprogramprogramsqualityremainrequiredresearchsoftware
SHARED TOKENS (23): "academic", "activities", "analysis", "automation", "commercial", "conduct", "data", "development", "generally", "government", "procedures", "process", "processes", "program", "programs", "quality", "remain", "required", "research", "software".... | EXACT TITLE in biotech_life_sciences: "Laboratory automation".
0.500
accessaddadvantageagentsanotherapproximatelyassociationbestbusinessbusinessescarechangecommercialcompensationcontractcontractorscontroldirectdirectlydistribution
SHARED TOKENS (68): "access", "add", "advantage", "agents", "another", "approximately", "association", "best", "business", "businesses", "care", "change", "commercial", "compensation", "contract", "contractors", "control", "direct", "directly", "distribution".... | EXACT TITLE in insurance_coverage: "Independent insurance agent".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagriculturechangeschemicalsconsolidationcontroldirectlydistributioneffectsenvironmentalformgrowthirrigationlandlesslivestockmaintainmanagementnetworkoperations
SHARED TOKENS (37): "agricultural", "agriculture", "changes", "chemicals", "consolidation", "control", "directly", "distribution", "effects", "environmental", "form", "growth", "irrigation", "land", "less", "livestock", "maintain", "management", "network", "operations".... | EXACT TITLE in insurance_coverage: "Irrigation". | EXACT TITLE in biotech_life_sciences: "Irrigation".
0.500
agencyamountapproximatelyauthoritybenefitbestbusinessescertainconstructiondirecteconomiceconomygovernmentgrowthinternationallocalorganizationorganizationspracticesprivate
SHARED TOKENS (35): "agency", "amount", "approximately", "authority", "benefit", "best", "businesses", "certain", "construction", "direct", "economic", "economy", "government", "growth", "international", "local", "organization", "organizations", "practices", "private".... | EXACT TITLE in biotech_life_sciences: "Government procurement".
0.500
amountappliedapplycareclaimconsumercontractcostscoveredcoveringeventsfiregeneralhealthhigherhomeinsurancelessmultipleplan
SHARED TOKENS (31): "amount", "applied", "apply", "care", "claim", "consumer", "contract", "costs", "covered", "covering", "events", "fire", "general", "health", "higher", "home", "insurance", "less", "multiple", "plan".... | EXACT TITLE in insurance_coverage: "Deductible".
0.500
actagenciesagentsallowingappointmentauthorizedbusinessentityfederalfoundgeneralidahoindependentindividualindustryinsurancelegallyperformplacementpolicies
SHARED TOKENS (25): "act", "agencies", "agents", "allowing", "appointment", "authorized", "business", "entity", "federal", "found", "general", "idaho", "independent", "individual", "industry", "insurance", "legally", "perform", "placement", "policies".... | EXACT TITLE in insurance_coverage: "Managing general agent".
0.500
Biochemistry ↗ Q7094 EXACT TITLE
agricultureappliedassociatedbecomecontrolcropdependsdisciplinesdiseaseseffectsengineeringexplainingfunctionshealthindustriallifemaintainmechanismsperformprocesses
SHARED TOKENS (29): "agriculture", "applied", "associated", "become", "control", "crop", "depends", "disciplines", "diseases", "effects", "engineering", "explaining", "functions", "health", "industrial", "life", "maintain", "mechanisms", "perform", "processes".... | EXACT TITLE in biotech_life_sciences: "Biochemistry".
0.500
actadministrationagencyassociatedauthoritycontrolcurrentdepartmentdirectlydiseasesemployeesfederalhealthhumanmedicalproductsprotectingpublicregulatedregulations
SHARED TOKENS (26): "act", "administration", "agency", "associated", "authority", "control", "current", "department", "directly", "diseases", "employees", "federal", "health", "human", "medical", "products", "protecting", "public", "regulated", "regulations".... | EXACT TITLE in biotech_life_sciences: "Food and Drug Administration".
0.500
appliedassociatedbenefitscapacitycapitalcostsdirectlydocumentestablishingexistingformgrowthinformationinstitutionallegalmarketofferingsprivateprocessproposed
SHARED TOKENS (28): "applied", "associated", "benefits", "capacity", "capital", "costs", "directly", "document", "establishing", "existing", "form", "growth", "information", "institutional", "legal", "market", "offerings", "private", "process", "proposed".... | EXACT TITLE in biotech_life_sciences: "Initial public offering".
0.500
academiccentercriticaleducationemployershigherinstitutionsknowledgelifemembersmissionprivatepublicratherresearchsitesstudentsuniversityvalue
SHARED TOKENS (19): "academic", "center", "critical", "education", "employers", "higher", "institutions", "knowledge", "life", "members", "mission", "private", "public", "rather", "research", "sites", "students", "university", "value". | EXACT TITLE in biotech_life_sciences: "Research university".
0.480
Biomaterial ↗ Q865663 EXACT TITLE
anothercaredevelopmentengineeringgrowthhistorymaterialmedicalproductsproposedpurposestudysystemsystems
SHARED TOKENS (14): "another", "care", "development", "engineering", "growth", "history", "material", "medical", "products", "proposed", "purpose", "study", "system", "systems". | EXACT TITLE in biotech_life_sciences: "Biomaterial".
0.480
activityamongcampusclassifiedenrollmentidahomainmeridianpercentprogramspublicresearchstudentsuniversity
SHARED TOKENS (14): "activity", "among", "campus", "classified", "enrollment", "idaho", "main", "meridian", "percent", "programs", "public", "research", "students", "university". | EXACT TITLE in biotech_life_sciences: "Idaho State University".
0.480
actaffordablebenefitscarecoveredessentialhealthinsurancelawmarketsoutsiderequirementsubjectwelfare
SHARED TOKENS (14): "act", "affordable", "benefits", "care", "covered", "essential", "health", "insurance", "law", "markets", "outside", "requirement", "subject", "welfare". | EXACT TITLE in insurance_coverage: "Essential health benefits".
0.480
changescriticaldevelopmentdiseasesengineeringhumanmajormechanismsmedicalphysicalregulationrolestructurework
SHARED TOKENS (14): "changes", "critical", "development", "diseases", "engineering", "human", "major", "mechanisms", "medical", "physical", "regulation", "role", "structure", "work". | EXACT TITLE in biotech_life_sciences: "Mechanobiology".
0.460
activityamountdependsdirectlyenvironmentalformhealthmaintainmajorphysicalrequiredwaterwork
SHARED TOKENS (13): "activity", "amount", "depends", "directly", "environmental", "form", "health", "maintain", "major", "physical", "required", "water", "work". | EXACT TITLE in biotech_life_sciences: "Drinking water".
0.460
agencyboisedepartmentenvironmentalfederalgovernmentidahomainmaintainedqualityregionalregulationsresponsible
SHARED TOKENS (13): "agency", "boise", "department", "environmental", "federal", "government", "idaho", "main", "maintained", "quality", "regional", "regulations", "responsible". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Environmental Quality".
0.460
Easement ↗ Q448405 EXACT TITLE
accessamonganotherbestenterlandlawownedpropertypublicpurposerealtype
SHARED TOKENS (13): "access", "among", "another", "best", "enter", "land", "law", "owned", "property", "public", "purpose", "real", "type". | EXACT TITLE in insurance_coverage: "Easement".
0.450
govgovernmenthealthnationalregistry
SHARED TOKENS (5): "gov", "government", "health", "national", "registry". | URL->B (1): http://www.clinicaltrials.gov/. | EXACT TITLE in biotech_life_sciences: "ClinicalTrials.gov".
0.440
Cleanroom ↗ Q794827 EXACT TITLE
commonlycontainsfacilitiesindustrialmaintainsmanufacturingmaterialprocessesresearchsmallerspacework
SHARED TOKENS (12): "commonly", "contains", "facilities", "industrial", "maintains", "manufacturing", "material", "processes", "research", "smaller", "space", "work". | EXACT TITLE in biotech_life_sciences: "Cleanroom".
0.440
Biosensor ↗ Q669391 EXACT TITLE
anotherassociatedcombinesconnectsdetectionengineeringgeneratematerialresponsiblestudyworkingworks
SHARED TOKENS (12): "another", "associated", "combines", "connects", "detection", "engineering", "generate", "material", "responsible", "study", "working", "works". | EXACT TITLE in biotech_life_sciences: "Biosensor".
0.440
agencybenefitsdepartmentdevelopmenteconomicidahoinsurancelaborprocessesresponsibletechnologyworkforce
SHARED TOKENS (12): "agency", "benefits", "department", "development", "economic", "idaho", "insurance", "labor", "processes", "responsible", "technology", "workforce". | EXACT TITLE in insurance_coverage: "Idaho Department of Labor". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Labor".
0.440
accordingalreadyapplycontroldesigndisciplinesengineeringexistingfoundmaterialsystemsthem
SHARED TOKENS (12): "according", "already", "apply", "control", "design", "disciplines", "engineering", "existing", "found", "material", "systems", "them". | EXACT TITLE in biotech_life_sciences: "Synthetic biology".
0.440
againsteventsfirehomeinsurancemainpoliciespolicypropertyprotectionrequirespecialized
SHARED TOKENS (12): "against", "events", "fire", "home", "insurance", "main", "policies", "policy", "property", "protection", "require", "specialized". | EXACT TITLE in insurance_coverage: "Property insurance".
0.420
administrationapplycannotdemandformhospitalmanufacturingpharmacyprovideregulationsrising
SHARED TOKENS (11): "administration", "apply", "cannot", "demand", "form", "hospital", "manufacturing", "pharmacy", "provide", "regulations", "rising". | EXACT TITLE in biotech_life_sciences: "Compounding".
0.420
accordingamountappliedbecomecomplexdetermineidentifiedidentitypatternstructurethem
SHARED TOKENS (11): "according", "amount", "applied", "become", "complex", "determine", "identified", "identity", "pattern", "structure", "them". | EXACT TITLE in biotech_life_sciences: "Mass spectrometry".
0.420
Toxicology ↗ Q7218 EXACT TITLE
academiceffectsexposureinfluencepracticepracticesrelationshipresearchstudysubjecttreatment
SHARED TOKENS (11): "academic", "effects", "exposure", "influence", "practice", "practices", "relationship", "research", "study", "subject", "treatment". | EXACT TITLE in biotech_life_sciences: "Toxicology".
0.420
agriculturalanimalscropdiseasesengineeringgrowthinvolvingplantspossessproductstools
SHARED TOKENS (11): "agricultural", "animals", "crop", "diseases", "engineering", "growth", "involving", "plants", "possess", "products", "tools". | EXACT TITLE in biotech_life_sciences: "Agricultural biotechnology".
0.400
combinesdescribedexpandedfunctionsindividualmodelingscopestatisticsstudysystem
SHARED TOKENS (10): "combines", "described", "expanded", "functions", "individual", "modeling", "scope", "statistics", "study", "system". | EXACT TITLE in biotech_life_sciences: "Neuroscience".
0.400
Lien ↗ Q4469383 EXACT TITLE
benefitcertainformgenerallyperformancepropertypurelysecuretypetypes
SHARED TOKENS (10): "benefit", "certain", "form", "generally", "performance", "property", "purely", "secure", "type", "types". | EXACT TITLE in insurance_coverage: "Lien".
0.400
amongcontractinstitutionsinsuranceliabilitypracticepublicrisksupportingvalue
SHARED TOKENS (10): "among", "contract", "institutions", "insurance", "liability", "practice", "public", "risk", "supporting", "value". | EXACT TITLE in insurance_coverage: "Underwriting".
0.380
associationassociationsfirmsindustrialindustryorganizationrelatedresearchserves
SHARED TOKENS (9): "association", "associations", "firms", "industrial", "industry", "organization", "related", "research", "serves". | EXACT TITLE in biotech_life_sciences: "Biotechnology Innovation Organization".
0.380
Forage ↗ Q13377214 EXACT TITLE
animalsannualcropdefinitiondirectlyhistoricallylivestockmaterialplants
SHARED TOKENS (9): "animals", "annual", "crop", "definition", "directly", "historically", "livestock", "material", "plants". | EXACT TITLE in biotech_life_sciences: "Forage".
0.380
Cell biology ↗ Q7141 EXACT TITLE
diseasesessentiallifemedicalresearchresponsiblestructurestudywork
SHARED TOKENS (9): "diseases", "essential", "life", "medical", "research", "responsible", "structure", "study", "work". | EXACT TITLE in biotech_life_sciences: "Cell biology".
0.380
actchaptercodefederalhealthlawpublictitlewelfare
SHARED TOKENS (9): "act", "chapter", "code", "federal", "health", "law", "public", "title", "welfare". | EXACT TITLE in biotech_life_sciences: "Public Health Service Act".
0.360
activitiesbusinessesinformationinfrastructureinsuranceproductrisktechnology
SHARED TOKENS (8): "activities", "businesses", "information", "infrastructure", "insurance", "product", "risk", "technology". | EXACT TITLE in insurance_coverage: "Cyber insurance".
0.360
Subrogation ↗ Q322457 EXACT TITLE
anotherbenefitinsurancelawlegalrelativelysubjectsystems
SHARED TOKENS (8): "another", "benefit", "insurance", "law", "legal", "relatively", "subject", "systems". | EXACT TITLE in insurance_coverage: "Subrogation".
0.360
formlawliabilityproductproductspropertypublicresponsible
SHARED TOKENS (8): "form", "law", "liability", "product", "products", "property", "public", "responsible". | EXACT TITLE in insurance_coverage: "Product liability".
0.360
animalsinformationmaterialmedicalplantsresearchtypeswritten
SHARED TOKENS (8): "animals", "information", "material", "medical", "plants", "research", "types", "written". | EXACT TITLE in biotech_life_sciences: "Biorepository".
0.350
federalgovernmenthealthmedicalmillionnationalrelatedreportstechnicalworks
SHARED TOKENS (10): "federal", "government", "health", "medical", "million", "national", "related", "reports", "technical", "works". | URL->B (1): http://clinicaltrials.gov/.
0.340
Hazardous waste ↗ EXACT TITLE
healthhumaninternationallocalmillionnationalregulated
SHARED TOKENS (7): "health", "human", "international", "local", "million", "national", "regulated". | EXACT TITLE in biotech_life_sciences: "Hazardous waste".
0.340
againstagriculturalcropgovernmentinsuranceproducersrelated
SHARED TOKENS (7): "against", "agricultural", "crop", "government", "insurance", "producers", "related". | EXACT TITLE in insurance_coverage: "Crop insurance".
0.340
Reinsurance ↗ Q476118 EXACT TITLE
againstcapacitycontractcostsinsuranceliabilitypolicies
SHARED TOKENS (7): "against", "capacity", "contract", "costs", "insurance", "liability", "policies". | EXACT TITLE in insurance_coverage: "Reinsurance".
0.340
Phlebotomy ↗ Q3595842 EXACT TITLE
involvingmakingmedicalprocesspurposetreatmentvolume
SHARED TOKENS (7): "involving", "making", "medical", "process", "purpose", "treatment", "volume". | EXACT TITLE in biotech_life_sciences: "Phlebotomy".
0.340
authorizationdeterminehealthinsurancemanagementprocessutilization
SHARED TOKENS (7): "authorization", "determine", "health", "insurance", "management", "process", "utilization". | EXACT TITLE in insurance_coverage: "Prior authorization".
0.340
affectanimalsdiseaseseconomicenvironmentalmanagementstudy
SHARED TOKENS (7): "affect", "animals", "diseases", "economic", "environmental", "management", "study". | EXACT TITLE in biotech_life_sciences: "Plant pathology".
0.320
analysisapplieddatamodelingrelationshipssystems
SHARED TOKENS (6): "analysis", "applied", "data", "modeling", "relationships", "systems". | EXACT TITLE in biotech_life_sciences: "Computational biology".
0.320
Escrow ↗ Q338451 EXACT TITLE
establishedholdinginsuranceobligationsprincipalproperty
SHARED TOKENS (6): "established", "holding", "insurance", "obligations", "principal", "property". | EXACT TITLE in insurance_coverage: "Escrow".
0.320
Surety ↗ Q748845 EXACT TITLE
againstamountcertaincontractfinanceprincipal
SHARED TOKENS (6): "against", "amount", "certain", "contract", "finance", "principal". | EXACT TITLE in insurance_coverage: "Surety".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in insurance_coverage: "Idaho Department of Health and Welfare". | EXACT TITLE in biotech_life_sciences: "Idaho Department of Health and Welfare".
0.320
Histology ↗ Q7168 EXACT TITLE
animalshistoricallymodernplantsstudyvisible
SHARED TOKENS (6): "animals", "historically", "modern", "plants", "study", "visible". | EXACT TITLE in biotech_life_sciences: "Histology".
0.300
activitiesassociatedbecomecarechangecostscoveredgenerallyhealthhomeinsuranceleastmedicaidmedicareneednursingpercentperformproductreceiving
SHARED TOKENS (23): "activities", "associated", "become", "care", "change", "costs", "covered", "generally", "health", "home", "insurance", "least", "medicaid", "medicare", "need", "nursing", "percent", "perform", "product", "receiving"....
0.300
againstappliedcapitaleconomicevenexposurefinancegenerallyidentifyingindividuallifemanagementmarketmodernoperationalpracticeprincipallyprotectingrelatedreporting
SHARED TOKENS (27): "against", "applied", "capital", "economic", "even", "exposure", "finance", "generally", "identifying", "individual", "life", "management", "market", "modern", "operational", "practice", "principally", "protecting", "related", "reporting"....
0.300
analysisappliedbeyondcommercialdatadefinitiondevelopmentenvironmentalequipmentevenfacilitiesfunctionsgenerallyhistoricallyinformationinfrastructuremanagementmanufacturingmarketsmodern
SHARED TOKENS (39): "analysis", "applied", "beyond", "commercial", "data", "definition", "development", "environmental", "equipment", "even", "facilities", "functions", "generally", "historically", "information", "infrastructure", "management", "manufacturing", "markets", "modern"....
0.300
accordingagriculturalagricultureamountcontroldirectenvironmentalfarmsgeneralgenerallygrowthhealthhistoryindustrylivestockpipelineproducersproductrolescale
SHARED TOKENS (25): "according", "agricultural", "agriculture", "amount", "control", "direct", "environmental", "farms", "general", "generally", "growth", "health", "history", "industry", "livestock", "pipeline", "producers", "product", "role", "scale"....
0.300
appliedbusinesscapitalcorporatedevelopmenteducationalemploymentgovernmenthigherinstitutionslocalnetworksprivatepublicrelatedresearchresultsupportingtechnologyvalley
SHARED TOKENS (20): "applied", "business", "capital", "corporate", "development", "educational", "employment", "government", "higher", "institutions", "local", "networks", "private", "public", "related", "research", "result", "supporting", "technology", "valley".
0.300
Life insurance ↗ Q626608 KW CROSS HIGH
benefitbenefitscapitalcategoriescontractdesigndesignatedeventsformgrowthindustryinsurancelegalliabilitylifemainmajormedicalmodernofferings
SHARED TOKENS (32): "benefit", "benefits", "capital", "categories", "contract", "design", "designated", "events", "form", "growth", "industry", "insurance", "legal", "liability", "life", "main", "major", "medical", "modern", "offerings"....
0.300
actbenefitscarecorporatecoveredcreatedirectdocumenteligibilityemployeeemployeesfoundhealthinsuranceobligationsplanpolicyprovisionsriskunless
SHARED TOKENS (20): "act", "benefits", "care", "corporate", "covered", "create", "direct", "document", "eligibility", "employee", "employees", "found", "health", "insurance", "obligations", "plan", "policy", "provisions", "risk", "unless".
0.300
activitiesanotherappliedapplyauthorityauthorizedbenefitsboardcapacityconductdecisionsdefinitionsevidencefollowingformgenerallyhealthcareindividualinformationinstitutional
SHARED TOKENS (47): "activities", "another", "applied", "apply", "authority", "authorized", "benefits", "board", "capacity", "conduct", "decisions", "definitions", "evidence", "following", "form", "generally", "healthcare", "individual", "information", "institutional"....
0.300
actadministrationapplyapprovedbenefitsboardcertaincommercialcompletecontroldatademonstratedesigndistributionevaluationhumaninformationinstitutionalintendedknowledge
SHARED TOKENS (43): "act", "administration", "apply", "approved", "benefits", "board", "certain", "commercial", "complete", "control", "data", "demonstrate", "design", "distribution", "evaluation", "human", "information", "institutional", "intended", "knowledge"....
0.300
actamongbestcertaincodedepartmentemergencyemployeeemployeesemployersemploymentgenerallygovernmenthealthinsuranceinternallawofficialplanprivate
SHARED TOKENS (28): "act", "among", "best", "certain", "code", "department", "emergency", "employee", "employees", "employers", "employment", "generally", "government", "health", "insurance", "internal", "law", "official", "plan", "private"....
0.300
associationassociationsinsuranceorganizationspolicies
SHARED TOKENS (5): "association", "associations", "insurance", "organizations", "policies". | EXACT TITLE in insurance_coverage: "Guaranty association".
0.300
Pharmacology ↗ Q128406 KW CROSS HIGH
carechemicalsclassifieddesigndeterminediscoverydistributioneffectsfunctionshealthmainmechanismsmedicalpharmacypracticeprocessesresearchrolesystems
SHARED TOKENS (19): "care", "chemicals", "classified", "design", "determine", "discovery", "distribution", "effects", "functions", "health", "main", "mechanisms", "medical", "pharmacy", "practice", "processes", "research", "role", "systems".
0.300
activitiesaffectcategoriesdesignatedenvironmentalestablishedexposurehealthhumanlessmillionmultiplequalityresultriskstandardstypetypes
SHARED TOKENS (18): "activities", "affect", "categories", "designated", "environmental", "established", "exposure", "health", "human", "less", "million", "multiple", "quality", "result", "risk", "standards", "type", "types".
0.300
careclassificationexplainsfollowinghealthcarehistoryidentifyinformationmajormedicalphysicalproceduresprocessprofessionalrequiredstatisticsstudyview
SHARED TOKENS (18): "care", "classification", "explains", "following", "healthcare", "history", "identify", "information", "major", "medical", "physical", "procedures", "process", "professional", "required", "statistics", "study", "view".
0.300
alreadyanotherassociatedbecomechangeconcerningcreatecurrentdevelopmentfoundmajormedicalphysicalprocessesrelatedrelevantresearchsubjectsystemstechnical
SHARED TOKENS (23): "already", "another", "associated", "become", "change", "concerning", "create", "current", "development", "found", "major", "medical", "physical", "processes", "related", "relevant", "research", "subject", "systems", "technical"....
0.300
anotherbecomecomplexconsolidationconsumersdescribeddirectlyeconomyfinalinternationalmakingmanagementmarketneedownedownershippositionproductproductsrather
SHARED TOKENS (23): "another", "become", "complex", "consolidation", "consumers", "described", "directly", "economy", "final", "international", "making", "management", "market", "need", "owned", "ownership", "position", "product", "products", "rather"....
0.300
actauthorizedbusinessescarechangeconcerningcoveredemployeesemployersentityfamilyfederalgenerallygovernshealthhealthcareinformationinsurancelawlife
SHARED TOKENS (32): "act", "authorized", "businesses", "care", "change", "concerning", "covered", "employees", "employers", "entity", "family", "federal", "generally", "governs", "health", "healthcare", "information", "insurance", "law", "life"....
0.300
affectanimalscarecontrolcoveringhealthhumanlivestockmaintainmanagementmedicalprofessionalresearchscopespecializedtreatmenttypewelfareworkworkers
SHARED TOKENS (20): "affect", "animals", "care", "control", "covering", "health", "human", "livestock", "maintain", "management", "medical", "professional", "research", "scope", "specialized", "treatment", "type", "welfare", "work", "workers".
0.300
actaffordableagainstapproximatelyassociatedbenefitscannotcarecommercialcostscoveringfederalformgovernmenthealthinsurancelevelsmajormedicaidmedical
SHARED TOKENS (42): "act", "affordable", "against", "approximately", "associated", "benefits", "cannot", "care", "commercial", "costs", "covering", "federal", "form", "government", "health", "insurance", "levels", "major", "medicaid", "medical"....
0.300
amongamountcomplexitycostsdescribeddesignateddevelopmenteconomicestategovernmentidentifylegalmodelsnationalprocesspropertyrealregulationsrequirementsresearch
SHARED TOKENS (23): "among", "amount", "complexity", "costs", "described", "designated", "development", "economic", "estate", "government", "identify", "legal", "models", "national", "process", "property", "real", "regulations", "requirements", "research"....
0.300
categoryconstructioncontractorsdefinitionequipmenthistoricalhistoricallyinsurancemedicalpropertyrelatedspecializedtransportationtypetypes
SHARED TOKENS (15): "category", "construction", "contractors", "definition", "equipment", "historical", "historically", "insurance", "medical", "property", "related", "specialized", "transportation", "type", "types".
0.300
Drought ↗ Q43059 KW CROSS HIGH
activityagricultureamountannualavailabilitybecomechangecostsdirectlyeconomiceconomyeffectsenvironmentalexperiencehealthhistoryhumanlesslevelslivestock
SHARED TOKENS (30): "activity", "agriculture", "amount", "annual", "availability", "become", "change", "costs", "directly", "economic", "economy", "effects", "environmental", "experience", "health", "history", "human", "less", "levels", "livestock"....
0.300
actadministrationagainstagenciesassetsauthoritybureaubusinesscertainchangescommonlycomplianceconsumerconsumerscostscouncildataeconomicestablishedfederal
SHARED TOKENS (37): "act", "administration", "against", "agencies", "assets", "authority", "bureau", "business", "certain", "changes", "commonly", "compliance", "consumer", "consumers", "costs", "council", "data", "economic", "established", "federal"....
0.300
actfederalgoverninglawresource
SHARED TOKENS (5): "act", "federal", "governing", "law", "resource". | EXACT TITLE in biotech_life_sciences: "Resource Conservation and Recovery Act".
0.300
commerceconsumersdecisionsdedicatedevaluationexperienceformonlineproductproductsprofessionalpurchasingreviewsitesusers
SHARED TOKENS (15): "commerce", "consumers", "decisions", "dedicated", "evaluation", "experience", "form", "online", "product", "products", "professional", "purchasing", "review", "sites", "users".
0.300
actadaanalysisannualcommonlycompensationcontractemploymentfamilyforminformationinsurancelaborlawliabilitymanagementmedicalnationalpracticesprivacy
SHARED TOKENS (26): "act", "ada", "analysis", "annual", "commonly", "compensation", "contract", "employment", "family", "form", "information", "insurance", "labor", "law", "liability", "management", "medical", "national", "practices", "privacy"....
0.300
Fidelity bond ↗ Q884117 KW CROSS HIGH
additionalagainstagreementsanotherassetsbenefitbusinessemployeesfireformgeneralinsuranceobligationsobtainpoliciespropertyprotectionpurchaseresultspecified
SHARED TOKENS (20): "additional", "against", "agreements", "another", "assets", "benefit", "business", "employees", "fire", "form", "general", "insurance", "obligations", "obtain", "policies", "property", "protection", "purchase", "result", "specified".
0.300
authorizedconcerningdepartmenteducationessentialfederalgeneralgovernmenthealthhealthcarehumanmattersmedicalmissionprivatepublicresponsibleseparatesystemwelfare
SHARED TOKENS (20): "authorized", "concerning", "department", "education", "essential", "federal", "general", "government", "health", "healthcare", "human", "matters", "medical", "mission", "private", "public", "responsible", "separate", "system", "welfare".
0.300
Plant breeding ↗ Q788558 KW CROSS HIGH
additionalagenciesagriculturalanimalsassociationscomplexcreatecropdeterminedevelopmentgovernmenthigherindustryinstitutionsinternationalknowledgelandmillionorganizationsplants
SHARED TOKENS (28): "additional", "agencies", "agricultural", "animals", "associations", "complex", "create", "crop", "determine", "development", "government", "higher", "industry", "institutions", "international", "knowledge", "land", "million", "organizations", "plants"....
0.300
appliedassociatedcertaindefinitionsengineeringformationfunctionsinvolvingmaintainmedicalperformpracticepurposerequirescopesupportsystemtypesuses
SHARED TOKENS (19): "applied", "associated", "certain", "definitions", "engineering", "formation", "functions", "involving", "maintain", "medical", "perform", "practice", "purpose", "require", "scope", "support", "system", "types", "uses".
0.300
accessaccurateactivitiesadministrationagencyannouncedassociationcapacitychangescontroldepartmentdiseaseseducationalenvironmentalfederalgovernmentheadquarteredhealthhumaninformation
SHARED TOKENS (38): "access", "accurate", "activities", "administration", "agency", "announced", "association", "capacity", "changes", "control", "department", "diseases", "educational", "environmental", "federal", "government", "headquartered", "health", "human", "information"....
0.300
documentdocumentationdocumentshistoricalidentifylawmaintainedofficeoriginalownershippropertyrecordregistryservestitle
SHARED TOKENS (15): "document", "documentation", "documents", "historical", "identify", "law", "maintained", "office", "original", "ownership", "property", "record", "registry", "serves", "title".
0.300
againstbusinessescertainclaimcommonlyconsultingcontractcostscovereddirectformgeneralinsurancelawlegalliabilitymedicalperformpolicypractice
SHARED TOKENS (24): "against", "businesses", "certain", "claim", "commonly", "consulting", "contract", "costs", "covered", "direct", "form", "general", "insurance", "law", "legal", "liability", "medical", "perform", "policy", "practice"....
0.300
amountanotherbetterbuildingdatadependfollowingformhomeinsuranceinventorymanagementmerelyordinaryoriginalpoliciespropertyresourcesrisksmaller
SHARED TOKENS (24): "amount", "another", "better", "building", "data", "depend", "following", "form", "home", "insurance", "inventory", "management", "merely", "ordinary", "original", "policies", "property", "resources", "risk", "smaller"....
0.300
Cell culture ↗ Q189082 KW CROSS HIGH
commonlycontainingdevelopmentessentialformgenerallygrowthhistoricalisolatedlinesmaintainedneedoriginaloutsideplantspopulationpracticeprocessregulatesrelated
SHARED TOKENS (26): "commonly", "containing", "development", "essential", "form", "generally", "growth", "historical", "isolated", "lines", "maintained", "need", "original", "outside", "plants", "population", "practice", "process", "regulates", "related"....
0.300
Medigap ↗ Q6806864 KW CROSS HIGH
accordingamountassociationcarecmsequipmenthealthhomehospitalinsurancemedicaidmedicalmedicaremillionnursingprivateprovidersrelatedreport
SHARED TOKENS (19): "according", "amount", "association", "care", "cms", "equipment", "health", "home", "hospital", "insurance", "medicaid", "medical", "medicare", "million", "nursing", "private", "providers", "related", "report".
0.300
Moral hazard ↗ Q44454 KW CROSS HIGH
actagencyanotherassociatedchangecostseconomicexposurehigherinformationinsurancelessprincipalrisktype
SHARED TOKENS (15): "act", "agency", "another", "associated", "change", "costs", "economic", "exposure", "higher", "information", "insurance", "less", "principal", "risk", "type".
0.300
accordinganalysisappliedbusinesschangesconstructiondemonstrateemploymentfinancehistoricallyidentifyinsurancemodelsmodernnewsoutlookphysicalproductsprofessionalprograms
SHARED TOKENS (28): "according", "analysis", "applied", "business", "changes", "construction", "demonstrate", "employment", "finance", "historically", "identify", "insurance", "models", "modern", "news", "outlook", "physical", "products", "professional", "programs"....
0.300
accordingactadditionalaffordableagainstagencyapproximatelybenefitsbureaucarecodecompliantdepartmentdutiesemployeesenforcementfederalgenerallygovernmenthistory
SHARED TOKENS (42): "according", "act", "additional", "affordable", "against", "agency", "approximately", "benefits", "bureau", "care", "code", "compliant", "department", "duties", "employees", "enforcement", "federal", "generally", "government", "history"....
0.300
analysisassetassociatedbecomebenefitsbroaderchangecostscriticaldocumentationeffectsevaluationeventsexposureidentifiesidentifyingincreasinglyindividualindustrialmanagement
SHARED TOKENS (28): "analysis", "asset", "associated", "become", "benefits", "broader", "change", "costs", "critical", "documentation", "effects", "evaluation", "events", "exposure", "identifies", "identifying", "increasingly", "individual", "industrial", "management"....
0.300
academicaccessagenciesannualapproximatelybusinessescapitalcovereddevelopmentdiscoverydocumentededucationeffectsessentialevaluationfirmsgrowthhealthhistoricalhuman
SHARED TOKENS (39): "academic", "access", "agencies", "annual", "approximately", "businesses", "capital", "covered", "development", "discovery", "documented", "education", "effects", "essential", "evaluation", "firms", "growth", "health", "historical", "human"....
0.300
accordingadministrationannualcenterchangescommercecomplianceentityevaluationeventsfacilitiesforminformationlegallicensemanufacturingproductproductsregulatedreports
SHARED TOKENS (24): "according", "administration", "annual", "center", "changes", "commerce", "compliance", "entity", "evaluation", "events", "facilities", "form", "information", "legal", "license", "manufacturing", "product", "products", "regulated", "reports"....
0.300
advantagebenefitbenefitsbetterconsumerscontractdemandeffectsevenhigherinformationinsurancelawlesslifemanagementmarketmarketsproductprovisions
SHARED TOKENS (30): "advantage", "benefit", "benefits", "better", "consumers", "contract", "demand", "effects", "even", "higher", "information", "insurance", "law", "less", "life", "management", "market", "markets", "product", "provisions"....
0.300
Google Maps ↗ Q12013 KW CROSS HIGH
accordingacquisitionsadditionalannouncedbusinessesconsumerdatadedicatedembeddedfoundlocalmarchorganizationsplanningplatformprogrampublicreportreportedsearch
SHARED TOKENS (24): "according", "acquisitions", "additional", "announced", "businesses", "consumer", "data", "dedicated", "embedded", "found", "local", "march", "organizations", "planning", "platform", "program", "public", "report", "reported", "search"....
0.300
anotherassociationbenefitbusinesscategoriescategoryclaimcontrolcreatesdirectdirectlyestablishfinanceforminsurancelicensedmaintainmanagementmeansowned
SHARED TOKENS (25): "another", "association", "benefit", "business", "categories", "category", "claim", "control", "creates", "direct", "directly", "establish", "finance", "form", "insurance", "licensed", "maintain", "management", "means", "owned"....
0.300
accessadministrationagencyassetbuildingbusinessdepartmentdevelopmentemergencyfederalgovernmentinfrastructurelocalmajormanagementorderspersonnelplanpropertyprovide
SHARED TOKENS (28): "access", "administration", "agency", "asset", "building", "business", "department", "development", "emergency", "federal", "government", "infrastructure", "local", "major", "management", "orders", "personnel", "plan", "property", "provide"....
0.300
carecategoriescommunitiescurrenteconomiceconomyfinanceformhealthhealthcareindustrymedicalpercentproductproductspurchasingrequirementssectorsystemteams
SHARED TOKENS (20): "care", "categories", "communities", "current", "economic", "economy", "finance", "form", "health", "healthcare", "industry", "medical", "percent", "product", "products", "purchasing", "requirements", "sector", "system", "teams".
0.300
actagainstagencyamongauthoritycommercialemployeefederalfirmsformholdinginsurancelaterlawlessmarketnovemberpdfregulatorytext
SHARED TOKENS (21): "act", "against", "agency", "among", "authority", "commercial", "employee", "federal", "firms", "form", "holding", "insurance", "later", "law", "less", "market", "november", "pdf", "regulatory", "text"....
0.300
communitiescontroldataindividualinfluencelinesmanagementmarketsnetworksonlineorganizationsproductproductsrelatedreputationreviewsearchsitesspacesystems
SHARED TOKENS (20): "communities", "control", "data", "individual", "influence", "lines", "management", "markets", "networks", "online", "organizations", "product", "products", "related", "reputation", "review", "search", "sites", "space", "systems".
0.300
agencyapproveddepartmenteducationemployeeemployeesenforcementenvironmentalestablishingfederalfederallygovernmentindependentinformationlegallevelslocalmattersnationalpermitting
SHARED TOKENS (29): "agency", "approved", "department", "education", "employee", "employees", "enforcement", "environmental", "establishing", "federal", "federally", "government", "independent", "information", "legal", "levels", "local", "matters", "national", "permitting"....
0.300
amongbenefitscompensationeconomicemployeeemployeesemployersemploymentformgeneralgenerallyhealthinsuranceliabilitymedicaloutsidereimbursementresultsystemwage
SHARED TOKENS (21): "among", "benefits", "compensation", "economic", "employee", "employees", "employers", "employment", "form", "general", "generally", "health", "insurance", "liability", "medical", "outside", "reimbursement", "result", "system", "wage"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
activitiesagenciescanyoncommercialconstructioncontrolcoveredhistoryhumanidahoirrigationmajornationalnorthwestpolicyprivateproductprogramsproposedpublic
SHARED TOKENS (28): "activities", "agencies", "canyon", "commercial", "construction", "control", "covered", "history", "human", "idaho", "irrigation", "major", "national", "northwest", "policy", "private", "product", "programs", "proposed", "public"....
0.300
againstanimalsbecomecommercialcomplexdevelopmentdiscoveryeffectsentityexperiencehealthhistoricallyhumanidentifiedidentifyidentifyingindustryisolatedmarketmeans
SHARED TOKENS (38): "against", "animals", "become", "commercial", "complex", "development", "discovery", "effects", "entity", "experience", "health", "historically", "human", "identified", "identify", "identifying", "industry", "isolated", "market", "means"....
0.300
activitiesanimalsassociatedcarechemicalscontainingdescribeddetaileddiseasesemergencyenvironmentalfacilitiesgeneralgeneratehealthhealthcarehomehospitalhumanindustrial
SHARED TOKENS (33): "activities", "animals", "associated", "care", "chemicals", "containing", "described", "detailed", "diseases", "emergency", "environmental", "facilities", "general", "generate", "health", "healthcare", "home", "hospital", "human", "industrial"....
0.300
againstassociatedbecomebroadercapacitycostscoveredextendinsurancelegalliabilitymanagementorganizationpoliciesregulatoryreimbursementresulttypewritten
SHARED TOKENS (19): "against", "associated", "become", "broader", "capacity", "costs", "covered", "extend", "insurance", "legal", "liability", "management", "organization", "policies", "regulatory", "reimbursement", "result", "type", "written".
0.300
accessagentscontrolequipmentestablishedfacilitieshealthhigherlevelsmultiplepersonnelproceduresprotectionprotectivereportsrequiredspecifiedsystemstraining
SHARED TOKENS (19): "access", "agents", "control", "equipment", "established", "facilities", "health", "higher", "levels", "multiple", "personnel", "procedures", "protection", "protective", "reports", "required", "specified", "systems", "training".
0.300
againstdetermineinsurancepropertyrisk
SHARED TOKENS (5): "against", "determine", "insurance", "property", "risk". | EXACT TITLE in insurance_coverage: "Flood insurance".
0.300
businessbusinessescommercialcovereddutiesgeneralgenerallyinsuranceliabilitymarketmedicaloperationspoliciespolicyproductprofessionalpropertypublicseparatetype
SHARED TOKENS (22): "business", "businesses", "commercial", "covered", "duties", "general", "generally", "insurance", "liability", "market", "medical", "operations", "policies", "policy", "product", "professional", "property", "public", "separate", "type"....
0.300
accordingactactivityadvantageamountassetbenefitbureauclaimcompensationfederalhealthinsuranceobtainorganizationsprocessproviderreceivesystemsthem
SHARED TOKENS (21): "according", "act", "activity", "advantage", "amount", "asset", "benefit", "bureau", "claim", "compensation", "federal", "health", "insurance", "obtain", "organizations", "process", "provider", "receive", "systems", "them"....
0.300
applyfederalregulatoryresearchstandards
SHARED TOKENS (5): "apply", "federal", "regulatory", "research", "standards". | EXACT TITLE in biotech_life_sciences: "Clinical Laboratory Improvement Amendments".
0.300
Actuary ↗ Q179985 KW CROSS HIGH
academicadditionalaffectanalysisappliedassetbecomebusinesscompletecomplexitydesigneducationhumaninformationinsuranceinvolvingknowledgeliabilitylicensingmanagement
SHARED TOKENS (33): "academic", "additional", "affect", "analysis", "applied", "asset", "become", "business", "complete", "complexity", "design", "education", "human", "information", "insurance", "involving", "knowledge", "liability", "licensing", "management"....
0.300
businessbusinessesconsultingeconomicemployersfinancingheadquarteredhealthinsurancemainmanagementmodelingoperatingprofessionalprogramrisk
SHARED TOKENS (16): "business", "businesses", "consulting", "economic", "employers", "financing", "headquartered", "health", "insurance", "main", "management", "modeling", "operating", "professional", "program", "risk".
0.300
evenoperatesstructurestudysystems
SHARED TOKENS (5): "even", "operates", "structure", "study", "systems". | EXACT TITLE in biotech_life_sciences: "Biomechanics".
0.300
applycodedesigndetailedengineeringevenexpandedfoundgeneralindustrialknowledgemarketprocessproductresearchstructurevalue
SHARED TOKENS (17): "apply", "code", "design", "detailed", "engineering", "even", "expanded", "found", "general", "industrial", "knowledge", "market", "process", "product", "research", "structure", "value".
0.300
againstamountbenefitcontractcoveredestateeventsfirefunctionsgenerallyhomeindividualinsuranceleastlifeobtainplanningpolicyprovidepurchase
SHARED TOKENS (24): "against", "amount", "benefit", "contract", "covered", "estate", "events", "fire", "functions", "generally", "home", "individual", "insurance", "least", "life", "obtain", "planning", "policy", "provide", "purchase"....
0.300
boardsbusinesscompensationconsumerconsumerscreateseconomicevidenceformgeneralgovernmentgrowthhealthhigherindividualinspectionslawleastlicenselicensed
SHARED TOKENS (47): "boards", "business", "compensation", "consumer", "consumers", "creates", "economic", "evidence", "form", "general", "government", "growth", "health", "higher", "individual", "inspections", "law", "least", "license", "licensed"....
0.300
actadditionalaffordablebusinessescareemployeesenrollmentfederalhealthinsurancelawmedicaidmillionnovemberoperationalorganizationsprivateprotectionpurchaseresponsible
SHARED TOKENS (23): "act", "additional", "affordable", "businesses", "care", "employees", "enrollment", "federal", "health", "insurance", "law", "medicaid", "million", "november", "operational", "organizations", "private", "protection", "purchase", "responsible"....
0.300
additionalagainstcombinescommonlyestatehomeindustryinsuranceliabilitypolicyprivatepropertyprotectionrealstandardtype
SHARED TOKENS (16): "additional", "against", "combines", "commonly", "estate", "home", "industry", "insurance", "liability", "policy", "private", "property", "protection", "real", "standard", "type".
0.300
agentsanalysisbecomebuildingchangesconstructiondetaileddetectiondiseasesessentialisolatedmainmedicaloriginalproceduresprocessrapidlyregionresearchsingle
SHARED TOKENS (22): "agents", "analysis", "become", "building", "changes", "construction", "detailed", "detection", "diseases", "essential", "isolated", "main", "medical", "original", "procedures", "process", "rapidly", "region", "research", "single"....
0.300
actadministrationagenciesappearbureaucurrentdepartmentdepartmentsdutiesestablishedfederalfinancegovernmentinstitutionsinternalmajormattersnationalofficepolicy
SHARED TOKENS (25): "act", "administration", "agencies", "appear", "bureau", "current", "department", "departments", "duties", "established", "federal", "finance", "government", "institutions", "internal", "major", "matters", "national", "office", "policy"....
0.300
agricultureanimalsanothercertaindiseaseshealthhumaninformationlifemajorpharmacyphysicalplantsqualityscalestandardstudytype
SHARED TOKENS (18): "agriculture", "animals", "another", "certain", "diseases", "health", "human", "information", "life", "major", "pharmacy", "physical", "plants", "quality", "scale", "standard", "study", "type".
0.300
actadministrationagencybenefitschangedepartmentemployeeestablishedgovernmentlabormanagementofficeprogramprovisionsreportingresponsibletitlewelfare
SHARED TOKENS (18): "act", "administration", "agency", "benefits", "change", "department", "employee", "established", "government", "labor", "management", "office", "program", "provisions", "reporting", "responsible", "title", "welfare".
0.300
actagainstamongdirectestablishedfederalhealthcareinsurancelaborlaterlawmajormedicaidmedicarenationalplanprogramprogramsproposalsingle
SHARED TOKENS (23): "act", "against", "among", "direct", "established", "federal", "healthcare", "insurance", "labor", "later", "law", "major", "medicaid", "medicare", "national", "plan", "program", "programs", "proposal", "single"....
0.300
activitiesadministersadministrationbenefitsbuildingdepartmentdepartmentsdirectlyeconomicemployersemploymentfederalgoverninggovernmenthealthhistorylabormillionmissionoccupational
SHARED TOKENS (30): "activities", "administers", "administration", "benefits", "building", "department", "departments", "directly", "economic", "employers", "employment", "federal", "governing", "government", "health", "history", "labor", "million", "mission", "occupational"....
0.300
Balance billing ↗ KW CROSS HIGH
amountcarecostscreateshealthcareinsurancemakingmarketmedicalneednetworkpracticeproviderprovidersrathersecuresubjectsystemthemtherefore
SHARED TOKENS (21): "amount", "care", "costs", "creates", "healthcare", "insurance", "making", "market", "medical", "need", "network", "practice", "provider", "providers", "rather", "secure", "subject", "system", "them", "therefore"....
0.300
activitiesamonganalysisanotherbettercentercompletecomplexconcerningconstructionconventionalcreatedatadescriptiondetaileddisciplineseffectsessentialexternalfunctions
SHARED TOKENS (46): "activities", "among", "analysis", "another", "better", "center", "complete", "complex", "concerning", "construction", "conventional", "create", "data", "description", "detailed", "disciplines", "effects", "essential", "external", "functions"....
0.300
accessactamongassociatedbenefitcodeconcerningconductcontainsdepartmenteffectsemployeeenforcementestablishesestablishingfederalindustryinformationinternallabor
SHARED TOKENS (26): "access", "act", "among", "associated", "benefit", "code", "concerning", "conduct", "contains", "department", "effects", "employee", "enforcement", "establishes", "establishing", "federal", "industry", "information", "internal", "labor"....
0.300
annualassetsbenefitsboardcannotcommercialcompensationcurrententityfiregeneralholdinginsurancelegallegallyliabilitylocalmultipleoperatesoutside
SHARED TOKENS (25): "annual", "assets", "benefits", "board", "cannot", "commercial", "compensation", "current", "entity", "fire", "general", "holding", "insurance", "legal", "legally", "liability", "local", "multiple", "operates", "outside"....
0.300
Request for proposal ↗ KW CROSS HIGH
bestbusinesscomplexcontractorsdocumentfinalforminformationoriginalprocessprocurementproductproposalqualityvendors
SHARED TOKENS (15): "best", "business", "complex", "contractors", "document", "final", "form", "information", "original", "process", "procurement", "product", "proposal", "quality", "vendors".
0.300
Technology transfer ↗ KW CROSS HIGH
academicactivityanalysisanotherbenefitcapacitycommercialconnectingcontrolcoredefinitiondevelopmentestablishesgovernmentindustrialinfluenceinstitutionsinstrumentknowledgelevels
SHARED TOKENS (37): "academic", "activity", "analysis", "another", "benefit", "capacity", "commercial", "connecting", "control", "core", "definition", "development", "establishes", "government", "industrial", "influence", "institutions", "instrument", "knowledge", "levels"....
0.300
amongbetterdecisionsdevelopmentengineeringhealthidentifiedindividualleastmedicalmodelnationalorganizationspracticesproductsproviderelatedrisksystemstherefore
SHARED TOKENS (21): "among", "better", "decisions", "development", "engineering", "health", "identified", "individual", "least", "medical", "model", "national", "organizations", "practices", "products", "provide", "related", "risk", "systems", "therefore"....
0.300
actannualbenefitcarecontractemergencyemployeesemployersfederallyhealthhealthcareinsurancemedicalorganizationproviderprovidersrequiredstatus
SHARED TOKENS (18): "act", "annual", "benefit", "care", "contract", "emergency", "employees", "employers", "federally", "health", "healthcare", "insurance", "medical", "organization", "provider", "providers", "required", "status".
🫐 BERRY66 edges
0.280
Proteomics ↗ Q471857 KW CROSS HIGH
activityanalysiscomplexityexpandedformationfunctionsgenerallyrequirementsscalescopesinglestructurestudysystem
SHARED TOKENS (14): "activity", "analysis", "complexity", "expanded", "formation", "functions", "generally", "requirements", "scale", "scope", "single", "structure", "study", "system".
0.280
amongbenefitsbuildingcommercialconsultingemployeefollowinginstitutionalinsurancelegallyoperationsprincipalreportedrisk
SHARED TOKENS (14): "among", "benefits", "building", "commercial", "consulting", "employee", "following", "institutional", "insurance", "legally", "operations", "principal", "reported", "risk".
0.280
additionalapplicablebusinessbusinessescoveredinsuranceoperationsphysicalpolicypositionprocesspropertytypetypes
SHARED TOKENS (14): "additional", "applicable", "business", "businesses", "covered", "insurance", "operations", "physical", "policy", "position", "process", "property", "type", "types".
0.280
Alfalfa ↗ Q156106 EXACT TITLE
commonlycropfamilylivestock
SHARED TOKENS (4): "commonly", "crop", "family", "livestock". | EXACT TITLE in biotech_life_sciences: "Alfalfa".
0.280
Aon plc ↗ Q739518 KW CROSS HIGH
capitalcenterconsultingheadquarteredhealthholdinghumaninsurancemanagementoperatesoperationsprofessionalrelatedrisk
SHARED TOKENS (14): "capital", "center", "consulting", "headquartered", "health", "holding", "human", "insurance", "management", "operates", "operations", "professional", "related", "risk".
0.280
agreementsalreadyanalysisbusinesscurrentdirectlyeconomyindustryonlinepercentproductproductssearchsites
SHARED TOKENS (14): "agreements", "already", "analysis", "business", "current", "directly", "economy", "industry", "online", "percent", "product", "products", "search", "sites".
0.280
State Farm ↗ Q2007336 EXACT TITLE
corporateinsurancepropertyprovider
SHARED TOKENS (4): "corporate", "insurance", "property", "provider". | EXACT TITLE in insurance_coverage: "State Farm".
0.280
againstdirectlyformfoundhealthindividualinsuranceliabilitylifemedicalorganizationpolicypropertyrisk
SHARED TOKENS (14): "against", "directly", "form", "found", "health", "individual", "insurance", "liability", "life", "medical", "organization", "policy", "property", "risk".
0.260
amongbenefitscompensationconsumersforminsurancemarketmillionoperationalownedpolicyratherrisk
SHARED TOKENS (13): "among", "benefits", "compensation", "consumers", "form", "insurance", "market", "million", "operational", "owned", "policy", "rather", "risk".
0.260
documentsestategovernmentmaintainsofficeownershippositionpropertyprovidepublicrealrecordsregistry
SHARED TOKENS (13): "documents", "estate", "government", "maintains", "office", "ownership", "position", "property", "provide", "public", "real", "records", "registry".
0.260
benefitcategorycontracthigherinsurancelifeordinarypoliciespolicyremainrepresentsrequiredvalue
SHARED TOKENS (13): "benefit", "category", "contract", "higher", "insurance", "life", "ordinary", "policies", "policy", "remain", "represents", "required", "value".
0.260
administersadministrationagencyagriculturalagriculturedepartmenthomenationalnetworkpolicyprogramsreportsstaff
SHARED TOKENS (13): "administers", "administration", "agency", "agricultural", "agriculture", "department", "home", "national", "network", "policy", "programs", "reports", "staff".
0.260
containingdatadetectionengineeringhealthinstrumentphysicalpopulationpracticeprocessresearchseparateuses
SHARED TOKENS (13): "containing", "data", "detection", "engineering", "health", "instrument", "physical", "population", "practice", "process", "research", "separate", "uses".
0.260
instrumentresearchstudy
SHARED TOKENS (3): "instrument", "research", "study". | EXACT TITLE in biotech_life_sciences: "Scientific instrument".
0.260
againstbenefitscorecreatesformfunctionsinsurancemaintainphysicalprotectionriskworkworking
SHARED TOKENS (13): "against", "benefits", "core", "creates", "form", "functions", "insurance", "maintain", "physical", "protection", "risk", "work", "working".
0.260
againstbuildingbuildingsconstructioncoveredequipmentinsuranceorganizationphysicalpropertyriskstructuretype
SHARED TOKENS (13): "against", "building", "buildings", "construction", "covered", "equipment", "insurance", "organization", "physical", "property", "risk", "structure", "type".
0.260
agencyagriculturalagriculturecropdepartmentfederalgovernmentinsurancemanagementownedprogramprotectionrisk
SHARED TOKENS (13): "agency", "agricultural", "agriculture", "crop", "department", "federal", "government", "insurance", "management", "owned", "program", "protection", "risk".
0.240
actappliedassociationauthoritybusinesscommercefederalgovernmentindustryinsurancelawregulation
SHARED TOKENS (12): "act", "applied", "association", "authority", "business", "commerce", "federal", "government", "industry", "insurance", "law", "regulation".
0.240
animalsbenefitcomplexeffectsinfluencemainmodelmodelsrelationshipsrepresentsstudytools
SHARED TOKENS (12): "animals", "benefit", "complex", "effects", "influence", "main", "model", "models", "relationships", "represents", "study", "tools".
0.240
approximatelyboisechamberdataevenfoundgovernmentidahomemberspopulationresidentssingle
SHARED TOKENS (12): "approximately", "boise", "chamber", "data", "even", "found", "government", "idaho", "members", "population", "residents", "single".
0.240
accordingagencycodecoveringgovernmenthomeinsuranceofficeseparatestandardssystemtype
SHARED TOKENS (12): "according", "agency", "code", "covering", "government", "home", "insurance", "office", "separate", "standards", "system", "type".
0.240
Cold chain ↗ KW CROSS HIGH
activitiesagriculturalassociatedchemicalsdistributionequipmentmaintainmanagementproductsqualityrequiresuses
SHARED TOKENS (12): "activities", "agricultural", "associated", "chemicals", "distribution", "equipment", "maintain", "management", "products", "quality", "requires", "uses".
0.220
Serology ↗ Q502159 EXACT TITLE
againststudy
SHARED TOKENS (2): "against", "study". | EXACT TITLE in biotech_life_sciences: "Serology".
0.220
actamountcoveredexistingformindividualinsuranceliabilitypoliciespolicytype
SHARED TOKENS (11): "act", "amount", "covered", "existing", "form", "individual", "insurance", "liability", "policies", "policy", "type".
0.220
agentsapproximatelybusinessesemployeesfireindependentinsuranceownedproductssmalltrade
SHARED TOKENS (11): "agents", "approximately", "businesses", "employees", "fire", "independent", "insurance", "owned", "products", "small", "trade".
0.220
administrationapprovedcouncilhumaninternationallinesmeansproceduresprogramregulationsregulatory
SHARED TOKENS (11): "administration", "approved", "council", "human", "international", "lines", "means", "procedures", "program", "regulations", "regulatory".
0.220
Water quality ↗ Q625376 KW CROSS HIGH
againstcompliancedeterminesgenerallyhealthhumanphysicalqualitystandardstreatmentwater
SHARED TOKENS (11): "against", "compliance", "determines", "generally", "health", "human", "physical", "quality", "standards", "treatment", "water".
0.220
beyondbusinessbusinessesexternalfacegrowthinfluencemodelprivatepublicrapid
SHARED TOKENS (11): "beyond", "business", "businesses", "external", "face", "growth", "influence", "model", "private", "public", "rapid".
0.220
Insurance law ↗ Q1037642 KW CROSS HIGH
businesscategoriesclaimconsumerinsurancelawpoliciespracticeregulationregulationssurrounding
SHARED TOKENS (11): "business", "categories", "claim", "consumer", "insurance", "law", "policies", "practice", "regulation", "regulations", "surrounding".
0.210
Biophysics ↗ Q7100 EXACT TITLE
study
SHARED TOKENS (1): "study". | EXACT TITLE in biotech_life_sciences: "Biophysics".
0.210
Biomarker ↗ EXACT TITLE
processes
SHARED TOKENS (1): "processes". | EXACT TITLE in biotech_life_sciences: "Biomarker".
0.200
commercialfamilyheadquarteredhealthinsurancelifeprivateproductspropertyreported
SHARED TOKENS (10): "commercial", "family", "headquartered", "health", "insurance", "life", "private", "products", "property", "reported".
0.200
againsteventsinsurancelegalliabilityphysicalprotectionprovideregionregulations
SHARED TOKENS (10): "against", "events", "insurance", "legal", "liability", "physical", "protection", "provide", "region", "regulations".
0.200
activitydiseasesenvironmentalhealthhumanlandpublicrisktransitionwildfire
SHARED TOKENS (10): "activity", "diseases", "environmental", "health", "human", "land", "public", "risk", "transition", "wildfire".
0.200
carehealthinsurancemedicalorganizationplanprovideproviderproviderstype
SHARED TOKENS (10): "care", "health", "insurance", "medical", "organization", "plan", "provide", "provider", "providers", "type".
0.200
benefitdirectestablishedinsurancelegalmajorownershippracticerelationshiprequirement
SHARED TOKENS (10): "benefit", "direct", "established", "insurance", "legal", "major", "ownership", "practice", "relationship", "requirement".
0.200
administrationbenefitdedicateddescribingeffectsinfluencemodelingmodelsrelationshipstudy
SHARED TOKENS (10): "administration", "benefit", "dedicated", "describing", "effects", "influence", "modeling", "models", "relationship", "study".
0.200
establishedfinancefirmsindustryonlineplatformsproductssystemstechnologytools
SHARED TOKENS (10): "established", "finance", "firms", "industry", "online", "platforms", "products", "systems", "technology", "tools".
0.180
agentscommercialcommonlyindependentindustrialinsuranceofficeoperationsproperty
SHARED TOKENS (9): "agents", "commercial", "commonly", "independent", "industrial", "insurance", "office", "operations", "property".
0.180
eventshistoryindependentinsurancelawsinglesmallstatisticsvalue
SHARED TOKENS (9): "events", "history", "independent", "insurance", "law", "single", "small", "statistics", "value".
0.180
contractcurrentevenindexedinsurancelifepolicytypevalue
SHARED TOKENS (9): "contract", "current", "even", "indexed", "insurance", "life", "policy", "type", "value".
0.180
commercialheadquarteredhomeinsurancelifeprivatetypeswaterwritten
SHARED TOKENS (9): "commercial", "headquartered", "home", "insurance", "life", "private", "types", "water", "written".
0.180
contractformgovernsinsurancelegalmakingmaterialmeansproposal
SHARED TOKENS (9): "contract", "form", "governs", "insurance", "legal", "making", "material", "means", "proposal".
0.160
approximatelycommonlyemployeesinsuranceoperatesownedpublicregional
SHARED TOKENS (8): "approximately", "commonly", "employees", "insurance", "operates", "owned", "public", "regional".
0.160
Kuna, Idaho ↗ KW CROSS HIGH
adaadditionalboiseidahometropolitannearlypercentpopulation
SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "metropolitan", "nearly", "percent", "population".
0.160
certainenvironmentalformrelationshiprelationshipsstudythemtypes
SHARED TOKENS (8): "certain", "environmental", "form", "relationship", "relationships", "study", "them", "types".
0.160
Payment bond ↗ Q7156776 KW CROSS HIGH
contractcontractorsfederalgovernmentmaterialperformancerequiredvalue
SHARED TOKENS (8): "contract", "contractors", "federal", "government", "material", "performance", "required", "value".
0.160
Select agent ↗ KW CROSS HIGH
agentsagriculturedepartmenthealthhumanlawpublicusda
SHARED TOKENS (8): "agents", "agriculture", "department", "health", "human", "law", "public", "usda".
0.160
certainintendedinternalmedicalprogramregulatedresearchsingle
SHARED TOKENS (8): "certain", "intended", "internal", "medical", "program", "regulated", "research", "single".
0.160
actdevelopmentfederalinsurancelawnationalprogramtitle
SHARED TOKENS (8): "act", "development", "federal", "insurance", "law", "national", "program", "title".
0.140
Medical test ↗ Q2671652 KW CROSS HIGH
analysisdeterminediseasesmedicalphysicalprocessestreatment
SHARED TOKENS (7): "analysis", "determine", "diseases", "medical", "physical", "processes", "treatment".
0.140
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyonidahometropolitanpopulationrapidly
SHARED TOKENS (7): "ada", "boise", "canyon", "idaho", "metropolitan", "population", "rapidly".
0.140
agentsassociationheadquarteredindependentinsurancenationalorganization
SHARED TOKENS (7): "agents", "association", "headquartered", "independent", "insurance", "national", "organization".
0.140
becomebindingcapabilitydiseasesmultiplesitestreatment
SHARED TOKENS (7): "become", "binding", "capability", "diseases", "multiple", "sites", "treatment".
0.140
Seed testing ↗ Q7445654 KW CROSS HIGH
analysisdedicateddeterminequalityresearchseedtrained
SHARED TOKENS (7): "analysis", "dedicated", "determine", "quality", "research", "seed", "trained".
0.120
amongcompensationinsurancemanagementriskworkers
SHARED TOKENS (6): "among", "compensation", "insurance", "management", "risk", "workers".
0.120
agriculturalidaholandmajornorthwestriver
SHARED TOKENS (6): "agricultural", "idaho", "land", "major", "northwest", "river".
0.120
associatedcarecostsformhealthinsurance
SHARED TOKENS (6): "associated", "care", "costs", "form", "health", "insurance".
0.120
compensationcontractinsuranceinternationalmultiplerepresents
SHARED TOKENS (6): "compensation", "contract", "insurance", "international", "multiple", "represents".
0.120
agencyeducationalperformprofessionalpublictrade
SHARED TOKENS (6): "agency", "educational", "perform", "professional", "public", "trade".
0.120
academiceducationhigherprofessionalqualificationsstudents
SHARED TOKENS (6): "academic", "education", "higher", "professional", "qualifications", "students".
0.120
Allstate ↗ Q2645636 KW CROSS HIGH
headquarteredhumanindependentinsuranceoperationsowned
SHARED TOKENS (6): "headquartered", "human", "independent", "insurance", "operations", "owned".
0.100
businesscompensationmanagementpublicregulation
SHARED TOKENS (5): "business", "compensation", "management", "public", "regulation".
0.100
bindingbuildingdecisionsidahomoved
SHARED TOKENS (5): "binding", "building", "decisions", "idaho", "moved".
0.100
insurancepolicyprivatepublictype
SHARED TOKENS (5): "insurance", "policy", "private", "public", "type".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseidahonorthwestpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "northwest", "population".
◈ Frequently Asked Questions
Insurance Coverage × Biotech Life Sciences — Treasure Valley
HAIKU · HIGH GATE
How do Centers for Medicare & Medicaid Services regulations affect biotech companies operating in the Treasure Valley?
Biotech firms in Boise and Nampa must comply with Centers for Medicare & Medicaid Services coverage determinations when their products or services involve federal health programs. Insurance coverage decisions by Centers for Medicare & Medicaid Services directly influence market access and reimbursement rates for life sciences companies headquartered in Ada County.
What role does Occupational Safety and Health Administration compliance play in biotech insurance coverage requirements for Treasure Valley laboratories?
Biotech operations in the Boise metropolitan area require Occupational Safety and Health Administration-compliant facilities, and insurers in Idaho factor these safety standards into coverage premiums and liability policies. Companies working with biological materials and pharmaceutical research must document Occupational Safety and Health Administration adherence to qualify for standard insurance coverage in the Treasure Valley.
How do mergers and acquisitions in Treasure Valley biotech affect insurance coverage portability?
When private equity or larger firms acquire biotech companies in Boise, existing insurance coverage policies must be reviewed and often renegotiated under new corporate structures. Mergers and acquisitions involving life sciences companies in Ada County typically require new insurance underwriting to cover the combined operational and liability exposure.
Why do biotech firms near College of Western Idaho and Boise State University need specialized insurance coverage?
Academic research partnerships between biotech companies and College of Western Idaho or Boise State University create unique liability and intellectual property insurance needs specific to the Boise region. Universities in the Treasure Valley require partner organizations to maintain specialized coverage for research collaborations and technology licensing agreements.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Insurance Coverage × Biotech Life Sciences 19 QID bridges 274 edges 7,036 ext links 2026-07-17 21:27:27 UTC 243954616082a7d4
Insurance Coverage corridor ↗ Biotech Life Sciences corridor ↗ Biotech Life Sciences × Insurance Coverage ↗ boisestandard.org/standard ↗
Parent Corridors
Insurance Coverage × All Other Verticals