—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Procurement Public Spending ↔ relates to ↔ Transportation Infrastructure

29 Wikipedia bridge articles confirmed in both vertical ledgers. 233 deterministic cross-vertical edges. 6,135 external source links harvested. Every edge provenance-stamped. Every claim auditable.

29 QID Bridge Articles
233 Cross Edges
6,135 External Sources
272 Wikipedia Articles
33 🌲 Evergreen
155 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Procurement Public Spending
× Transportation Infrastructure
QID Bridge Articles
29
confirmed Wikipedia overlap
Total Cross Edges
233
External Sources Harvested
6,135
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho
score: 1.0000  ·  type: exact_title_cross  ·  28 shared tokens
QID Bridge Titles (20)
IdahoInfrastructureTreasure ValleyApprenticeshipFederal Aviation AdministrationLogisticsPublic worksPublic transportSurveyingBoise State UniversityBoise AirportBridgeCivil engineeringCollege of Western IdahoFederal Highway AdministrationTransportation planningParatransitNampa, IdahoTraffic lightBoise, Idaho
Shared Semantics (20 tokens)
boiseidahopopulationpublicgovernmenttransportationadamilesprivatelocalcapitalwesternairportsenvironmentphysicalprogramsroadssystemsprofessionalprovide
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:56:02 UTC
Content Hash
de300383cfd18b57
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
29 BRIDGES
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "agricultural", "agriculture", "approximately", "associated", "best", "boise", "capital", "contains", "distinct", "economy", "idaho", "land", "methods", "miles", "million", "national", "official", "oregon", "population", "products".... | EXACT TITLE in procurement_public_spending: "Idaho". | EXACT TITLE in transportation_infrastructure: "Idaho".
agriculturalagricultureapproximatelyassociatedbestboisecapitalcontainsdistincteconomyidaholandmethodsmilesmillionnationalofficialoregonpopulationproductsseparatesignificantsmallsuppliestechnologyuseswestwestern
astern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
ate and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
ches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Infrastructure
Q121359 EXACT TITLE 1.000
QID OVERLAP: Q121359 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (45): "access", "agencies", "airports", "bridges", "conditions", "created", "development", "different", "distinct", "economic", "economy", "emergency", "environment", "environmental", "especially", "facilities", "firms", "general", "goal", "health".... | EXACT TITLE in procurement_public_spending: "Infrastructure". | EXACT TITLE in transportation_infrastructure: "Infrastructure".
accessagenciesairportsbridgesconditionscreateddevelopmentdifferentdistincteconomiceconomyemergencyenvironmentenvironmentalespeciallyfacilitiesfirmsgeneralgoalhealthindustrialinfrastructureinstitutionslawmanagementofficialparksphysicalpolicyprivate+15
l structures such as roads, railways, bridges, airports, public transit systems, tunnels, water supply, sewers, electrical grids, and telecommunications (including Internet connectivity and broadband access). In general, infrastructure has been defined as "the physical components of interrelated systems providing commodities and services essential to enable, sustain, or enhance societal living conditions" and maintain the surrounding environment. Especially in light of the massive societal transformations needed to mitigate and adapt to climate change, contemporary infrastructure conversations frequently focus on sustainable development and green infrastructure. Acknowledging this importance, the international community has created policy focused on sustainable infrastructure through the Sustainable Development Goals, especially Sustainable Development Goal 8 "Industry, Innovation and Infrastructure". One way to describe different types of infrastructure is to classify them as two distinct kinds: hard infrastructure and soft infrastructure. Hard infrastructure is the physical plant and networks necessary for the functioning of a modern industrial society or industry. This includes utilities, waste management, transport facilities, and telecom networks. Soft infrastructure is all the institutions that maintain the economic, health, social, environmental, and cultural standards of a place.
Sustainable energy Sustainable energy infrastructure includes types of renewable energy power plants as well as the means of exchange from the plant to the homes and businesses that use that energy. Renewable energy includes well researched and widely implemented methods such as wind, solar, and hydraulic power, as well as newer and less commonly used types of power creation such as fusion energy. Sustainable energy infrastructure must maintain a strong supply relative to demand, and must also maintain sufficiently low prices for consumers so as not to decrease demand. Any type of renewable energy infrastructure that fails to meet these consumption and price requirements will ultimately be forced out of the market by prevailing non renewable energy sources. Sustainable water Sustainable water infrastructure is focused on a community's sufficient access to clean, safe drinking water. Water is a public good along with electricity, which means that sustainable water catchment and distribution systems must remain affordable to all members of a population. "Sustainable Water" may refer to a nation or community's ability to be self-sustainable, with enough water to meet multiple needs including agriculture, industry, sanitation, and drinking water. It can also refer to the holistic and effective management of water resources.
Masdar City is a proposed zero emission smart city that will be contracted in the United Arab Emirates. Some individuals have referred to this planned settlement as "utopia-like", due to the fact that it will feature multiple sustainable infrastructure elements, including energy, water, waste management, and transportation. Masdar City will have a power infrastructure containing renewable energy methods including solar energy. Masdar City is located in a desert region, meaning that sustainable collection and distribution of water is dependent on the city's ability to use water at innovative stages of the water cycle. The city will use groundwater, greywater, seawater, blackwater, and other water resources to obtain both drinking and landscaping water. Initially, Masdar City will be waste-free. Recycling and other waste management and waste reduction methods will be encouraged. Additionally, the city will implement a system to convert waste into fertilizer, which will decrease the amount of space needed for waste accumulation as well as provide an environmentally friendly alternative to traditional fertilizer production methods. No cars will be allowed in Masdar City, contributing to low carbon emissions within the city boundaries. Instead, alternative transportation options will be prioritized during infrastructure development. This means that a bike lane network will be accessible and comprehensive, and other options will also be available. See also References Bibliography Koh, Jae Myong (2018) Green Infrastructure Financing: Institutional Investors, PPPs and Bankable Projects, London: Palgrave Macmillan. ISBN 978-3-319-71769-2. Nurre, Sarah G.; Cavdaroglu, Burak; Mitchell, John E.; Sharkey, Thomas C.; Wallace, William A. (December 2012). "Restoring infrastructure systems: An integrated network design and scheduling (INDS) problem". European Journal of Operational Research. 223 (3): 794–806. doi:10.1016/j.ejor.2012.07.010. Ascher, Kate (2007). The works: anatomy of a city. Researched by Wendy Marech (Reprint ed.). New York: Penguin Press. ISBN 978-0-14-311270-9. Larry W. Beeferman, "Pension Fund Investment in Infrastructure: A Resource Paper", Capital Matter (Occasional Paper Series), No. 3 December 2008 A. Eberhard, "Infrastructure Regulation in Developing Countries", PPIAF Working Paper No. 4 (2007) World Bank M. Nicolas J. Firzli and Vincent Bazi, "Infrastructure Investments in an Age of Austerity: The Pension and Sovereign Funds Perspective", published jointly in Revue Analyse Financière, Q4 2011 issue, pp. 34–37 and USAK/JTW July 30, 2011 (online edition) Hayes, Brian (2005). Infrastructure: the book of everything for the industrial landscape (1st ed.). New York: Norton. ISBN 978-0-393-32959-9. Huler, Scott (2010). On the grid: a plot of land, an average neighborhood, and the systems that make our world work. Emmaus, PA: Rodale. ISBN 978-1-60529-647-0. Georg Inderst, "Pension Fund Investment in Infrastructure", OECD Working Papers on Insurance and Private Pensions, No. 32 (2009) Dalakoglou, Dimitris (2017). The Road: An Ethnography of (Im)mobility, space and cross-border infrastructures.
Treasure Valley
Q7836726 EXACT TITLE 1.000
QID OVERLAP: Q7836726 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (16): "agricultural", "association", "boise", "historically", "idaho", "land", "local", "lower", "opportunities", "oregon", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in procurement_public_spending: "Treasure Valley". | EXACT TITLE in transportation_infrastructure: "Treasure Valley".
agriculturalassociationboisehistoricallyidaholandlocalloweropportunitiesoregonregionresourcesruraltreasurevalleywestern
, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
Apprenticeship
Q20773771 EXACT TITLE 1.000
QID OVERLAP: Q20773771 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (17): "certification", "competence", "complete", "extend", "field", "formal", "labor", "license", "master", "permanent", "potential", "practitioners", "professional", "reach", "regulated", "system", "training". | EXACT TITLE in transportation_infrastructure: "Apprenticeship".
certificationcompetencecompleteextendfieldformallaborlicensemasterpermanentpotentialpractitionersprofessionalreachregulatedsystemtraining
Apprenticeship lengths vary significantly across sectors, professions, roles and cultures. In some cases, people who successfully complete an apprenticeship can reach the "journeyman" or professional certification level of competence. In other cases, they can be offered a permanent job at the company that provided the placement.
Expansion into services, agriculture, and mining sectors Cost-sharing between the industry and government Formalization of informal apprenticeships Alignment with the National Vocational Qualifications Framework (Pakistan NVQF) Increased female participation Financial incentives for industries exceeding apprentice requirements Joint assessment and certification by the industry, Chamber of Commerce, and government Switzerland In Switzerland, after the end of compulsory schooling, two thirds of young people follow a vocational training. Ninety percent of them are in the dual education system. Switzerland has an apprenticeship similarly to Germany and Austria. The educational system is ternar, which is basically dual education system with mandatory practical courses.
Length Apprenticeships with a length of 2 years are for persons with weaker school results. The certificate awarded after successfully completing a 2-year apprenticeship is called "Attestation de formation professionnelle" (AFP) in French, "Eidgenössisches Berufsattest" (EBA) in German and "Certificato federale di formazione pratica" (CFP) in Italian. It could be translated as "Attestation of professional formation". Apprenticeship with a length of 3 or 4 years are the most common ones. The certificate awarded after successfully completing a 3 or 4-year apprenticeship is called "Certificat Fédéral de Capacité" (CFC) in French, "Eidgenössisches Fähigkeitszeugnis" (EFZ) in German and "Attestato federale di capacità" (AFC) in Italian. It could be translated as "Federal Certificate of Proficiency". Some crafts, such as electrician, are educated in lengths of 3 and 4 years. In this case, an Electrician with 4 years apprenticeship gets more theoretical background than one with 3 years apprenticeship. Some languages have different names for a craft depending on the length of the apprenticeship; this can be lost in translation. Each of the over 300 nationwide defined vocational profiles has defined framework – conditions as length of education, theoretical and practical learning goals and certification conditions. Age of the apprentices Typically an apprenticeship can commence for individuals once they are aged 15 or 18 after finishing general education. Some apprenticeships have a recommend or required age of 18.
Federal Aviation Administration
Q335357 EXACT TITLE 1.000
QID OVERLAP: Q335357 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (23): "administration", "agency", "airports", "assets", "authority", "aviation", "certification", "civil", "commercial", "control", "created", "department", "faa", "federal", "government", "personnel", "regulates", "setting", "standards", "surrounding".... | EXACT TITLE in procurement_public_spending: "Federal Aviation Administration". | EXACT TITLE in transportation_infrastructure: "Federal Aviation Administration".
administrationagencyairportsassetsauthorityaviationcertificationcivilcommercialcontrolcreateddepartmentfaafederalgovernmentpersonnelregulatessettingstandardssurroundingtraffictransportationvehicles
The Federal Aviation Administration (FAA) is a U.S. federal government agency within the U.S. Department of Transportation that regulates civil aviation in the United States and surrounding international waters. Its powers include air traffic control, certification of personnel and aircraft, setting standards for airports, and protection of U.S. assets during the launch or re-entry of commercial space vehicles. Powers over neighboring international waters were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S.
s were delegated to the FAA by authority of the International Civil Aviation Organization. The FAA was created in August 1958 (1958-08) as the Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Federal Aviation Agency, replacing the Civil Aeronautics Administration (CAA). In 1967, the FAA became part of the newly formed U.S. Department of Transportation and was renamed the Federal Aviation Administration. Major functions The FAA's roles include: Regulating U.S. commercial space transportation Regulating air navigation facilities' geometric and flight inspection standards Encouraging and developing civil aeronautics, including new aviation technology Issuing, suspending, or revoking pilot certificates Regulating civil aviation to promote transportation safety in the United States, especially through local offices called Flight Standards District Offices Developing and operating a system of air traffic control and navigation for both civil and military aircraft Researching and developing the National Airspace System and civil aeronautics Developing and carrying out programs to control aircraft noise and other environmental effects of civil aviation As part of its Next Generation Air Transportation System (NextGen) initiative, the FAA is also modernizing navigation and procedures for both fixed-wing and rotorcraft operations.
Logistics
Q177777 EXACT TITLE 1.000
QID OVERLAP: Q177777 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (32): "according", "another", "chain", "civil", "costs", "dedicated", "equipment", "facility", "field", "food", "information", "logistics", "management", "material", "materials", "model", "movement", "needs", "operational", "physical".... | EXACT TITLE in procurement_public_spending: "Logistics". | EXACT TITLE in transportation_infrastructure: "Logistics".
accordinganotherchaincivilcostsdedicatedequipmentfacilityfieldfoodinformationlogisticsmanagementmaterialmaterialsmodelmovementneedsoperationalphysicalplanningproblemsproductsprofessionalprovidepublicresourceresourcessignificantsupply+2
ogistics is the part of supply chain management that deals with the efficient forward and reverse flow of goods, services, and related information from the point of origin to the point of consumption according to the needs of customers, and a logistician is a professional working in the field of logistics management. Logistics management is a component that holds the supply chain together. The resources managed in logistics include physical goods such as materials, equipment, and foodstuffs, and also intangible items such as time and information. Military logistics is concerned with maintaining army supply lines with food, armaments, ammunition, and spare parts, apart from the transportation of troops themselves. Civil logistics deals with acquiring, moving, and storing raw materials, semi-finished goods, and finished goods. For organisations that provide garbage collection, mail deliveries, public utilities, and after-sales services, logistical problems must be addressed. Logistics deals with the movement of materials or products from one facility to another; it does not include material flow within production or assembly plants, such as production planning or single-machine scheduling. Logistics accounts for a significant amount of the operational costs of an organisation or country. Dedicated simulation software can model, analyse, visualise, and optimize logistic complexities.
The Oxford English Dictionary defines logistics as "the branch of military science relating to procuring, maintaining and transporting material, personnel and facilities". However, the New Oxford American Dictionary defines logistics as "the detailed coordination of a complex operation involving many people, facilities, or supplies", and the Oxford Dictionary on-line defines it as "the detailed organization and implementation of a complex operation". As such, logistics is commonly seen as a branch of engineering that creates "people systems" rather than "machine systems". According to the Council of Supply Chain Management Professionals (previously the Council of Logistics Management), logistics is the process of planning, implementing and controlling procedures for the efficient and effective transportation and storage of goods including services and related information from the point of origin to the point of consumption for the purpose of conforming to customer requirements and includes inbound, outbound, internal and external movements. Academics and practitioners traditionally refer to the terms operations or production management when referring to physical transformations taking place in a single business location (factory, restaurant or even bank clerking) and reserve the term logistics for activities related to distribution, that is, moving products on the territory. Managing a distribution center is seen, therefore, as pertaining to the realm of logistics since, while in theory, the products made by a factory are ready for consumption they still need to be moved along the distribution network according to some logic, and the distribution center aggregates and processes orders coming from different areas of the territory. That being said, from a modeling perspective, there are similarities between operations management and logistics, and companies sometimes use hybrid professionals, with for example a "Director of Operations" or a "Logistics Officer" working on similar problems.
Procurement logistics, which consists of market research, requirements planning, make-or-buy decisions, supplier management, ordering, and order control. The targets in procurement logistics might be contradictory: maximizing efficiency by concentrating on core competencies, outsourcing while maintaining the company's autonomy, or minimizing procurement costs while maximizing security within the supply process. Advance logistics involves the activities required to set up or establish a supply base in advance of other resources arriving. The term is used, for example, in military logistics for the assembly of resources ahead of troop arrival or the delivery of infrastructure components. Global logistics is technically the process of managing the "flow" of goods through a supply chain from its place of production to other parts of the world. This often requires an intermodal transport system via ocean, air, rail, and truck. The effectiveness of global logistics is measured in the Logistics Performance Index. Distribution logistics has, as its main task, the delivery of the finished products to the customer. It consists of order processing, warehousing, and transportation. Modern distribution often includes the use of a vehicle tracking system to monitor shipments by collecting real-time vehicle location data. Distribution logistics is necessary because production time, place, and quantity differ with the time, place, and quantity of consumption. Disposal logistics has the function of reducing logistics cost(s) and enhancing service(s) related to the disposal of waste produced during a business's operation. Reverse logistics denotes all operations related to the reuse of products and materials. The reverse logistics process includes the management and the sale of surpluses, as well as products being returned to vendors from buyers. It is "the process of planning, implementing, and controlling the efficient, cost-effective flow of raw materials, in-process inventory, finished goods, and related information from the point of consumption to the point of origin to recapture value or proper disposal". More precisely, reverse logistics is the process of moving goods from their typical final destination for the purpose of capturing value, or proper disposal. The opposite of reverse logistics is forward logistics. Green logistics describes all attempts to measure and minimize the ecological impact of logistics activities, including all activities of the forward and reverse flows. This can be supported by fleet digitalization initiatives aimed at optimizing routes and reducing fuel consumption. RAM logistics (see also Logistic engineering) combines both business logistics and military logistics since it concerns highly complicated technological systems for which reliability, availability and maintainability are essential, e.g., weapon system and military supercomputers. Asset control logistics: companies in the retail channels, both organized retailers and suppliers, often deploy assets required for the display, preservation, and promotion of their products. This can involve using a tracking system to monitor the location and status of these assets. Humanitarian logistics or emergency logistics: these terms are used by the logistics, supply chain, and manufacturing industries to denote specific time-critical modes of transport used to move goods rapidly in the event of an emergency. The reason for enlisting emergency logistics services could be a production delay or anticipated production delay, or an urgent need for specialized equipment to prevent events such as aircraft being grounded (also known as "aircraft on ground"—AOG), ships being delayed, or telecommunications failure. Humanitarian logistics involves governments, the military, aid agencies, donors, non-governmental organizations, and emergency logistics services are typically sourced from a specialist provider. In addition, the term production logistics describes logistic processes within a value-adding system (e.g., a factory or a mine). Production logistics aims to ensure that each machine and workstation receives the right product in the correct quantity and quality at the right time. The concern is with production, testing, transportation, storage, and supply. Production logistics can operate in existing as well as new plants. Since manufacturing in an existing plant is a constantly changing process, machines are exchanged and new ones added, which allows for improving the production logistics system accordingly. Production logistics provides the means to achieve customer response and capital efficiency. Track and trace solutions, which provide visibility of products through the production line, are an important part of modern production logistics, especially in the automotive and medical industries. The term construction logistics has also been employed by civilizations for thousands of years. Now, construction logistics is an important part of the sector. In recent years, it has emerged as a distinct field of study within supply chain management and logistics.
Public works
Q627364 EXACT TITLE 1.000
QID OVERLAP: Q627364 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (32): "airports", "assets", "bridges", "broader", "buildings", "capital", "category", "construction", "directly", "economic", "employment", "environmental", "facilities", "government", "health", "hospitals", "infrastructure", "municipal", "parks", "physical".... | EXACT TITLE in procurement_public_spending: "Public works". | EXACT TITLE in transportation_infrastructure: "Public works".
airportsassetsbridgesbroaderbuildingscapitalcategoryconstructiondirectlyeconomicemploymentenvironmentalfacilitiesgovernmenthealthhospitalsinfrastructuremunicipalparksphysicalpreservationprivateprojectspublicroadssafetyschoolssupplytreatmentuses+2
cipal buildings, and schools), public services (dams, electrical grid, sewage treatment, and water supply and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
and treatment), public spaces (beaches, parks, and public squares), transport infrastructure (airports, bridges, canals, pipelines, ports, railroads, and roads) and other, usually long-term, physical assets and facilities. Though often interchangeable with public capital and public infrastructure, public works does not necessarily carry an economic component, thereby being a broader term. Construction may be undertaken either by directly employed labour or by a private operator. Public works has been encouraged since antiquity.
Overview Public works is a multi-dimensional concept in economics and politics, touching on multiple arenas including: recreation (parks, beaches, trails), aesthetics (trees, green space), economy (goods and people movement, energy), law (police and courts), and neighborhood (community centers, social services buildings). It represents any constructed object that augments a nation's physical infrastructure. Municipal infrastructure, urban infrastructure, and rural development usually represent the same concept but imply either large cities or developing nations' concerns respectively. The terms public infrastructure or critical infrastructure are at times used interchangeably.
Public transport
Q178512 EXACT TITLE 1.000
QID OVERLAP: Q178512 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (54): "access", "airlines", "allowing", "association", "authorities", "competing", "competitive", "contracting", "coordination", "costs", "designated", "development", "economic", "efficiency", "financial", "fixed", "fixed-route", "funding", "general", "government".... | EXACT TITLE in procurement_public_spending: "Public transport". | EXACT TITLE in transportation_infrastructure: "Public transport".
accessairlinesallowingassociationauthoritiescompetingcompetitivecontractingcoordinationcostsdesignateddevelopmenteconomicefficiencyfinancialfixedfixed-routefundinggeneralgovernmenthistoricalinfrastructureintegratedintendedlocalmodelmunicipalnetworkoperateoperated+24
t use of infrastructure. High-frequency services often prioritize regular headways over exact departure times. However, many trips involve multimodal travel, such as walking or feeder bus services to access rail stations, highlighting the importance of network coordination and cost-effective planning. In some regions, share taxis and other demand-responsive services provide flexible alternatives to fixed-route transit, either competing with or complementing traditional systems. Paratransit services are typically reserved for low-demand areas or passengers requiring door-to-door transportation, often at higher per-trip costs. Public transport systems vary significantly by region due to historical, geographic, and economic factors. In Japan, many urban transit networks are operated by profit-oriented private companies, often integrated with real estate development, a model frequently cited for its financial sustainability and operational efficiency. In North America, mass transit is most commonly operated by municipal or regional transit authorities, typically funded through a combination of fares, local taxes, and government subsidies. In Europe, both state-owned enterprises and private operators participate in transit provision, often under competitive contracting arrangements. For geographic and economic reasons, levels of public transport use and investment differ widely across countries.
Light rail transit Light rail transit (LRT) is a term coined in 1972 and uses mainly tram technology. Light rail has mostly dedicated right-of-ways and less sections shared with other traffic and usually step-free access. A light rail line is generally traversed with increased speed compared to a tram line. Light rail lines are, thus, essentially modernized interurbans. Unlike trams, light rail trains are often longer and have one to four cars per train.
Personal rapid transit (PRT) is an automated cab service that runs on rails or a guideway. This is an uncommon mode of transportation (excluding elevators) due to the complexity of automation. A fully implemented system might provide most of the convenience of individual automobiles with the efficiency of public transit. The crucial innovation is that the automated vehicles carry just a few passengers, turn off the guideway to pick up passengers (permitting other PRT vehicles to continue at full speed), and drop them off to the location of their choice (rather than at a stop). Conventional transit simulations show that PRT might attract many auto users in problematic medium-density urban areas. A number of experimental systems are in progress. One might compare personal rapid transit to the more labor-intensive taxi or paratransit modes of transportation, or to the (by now automated) elevators common in many publicly accessible areas. Automated people mover (APM) are a special term for grade-separated rail which uses vehicles that are smaller and shorter in size.
Surveying
Q816425 EXACT TITLE 1.000
QID OVERLAP: Q816425 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (28): "analysis", "civil", "construction", "designated", "development", "digital", "engineering", "environment", "equipment", "establish", "government", "history", "land", "law", "legal", "maps", "ownership", "planning", "points", "professional".... | EXACT TITLE in procurement_public_spending: "Surveying". | EXACT TITLE in transportation_infrastructure: "Surveying".
analysiscivilconstructiondesignateddevelopmentdigitalengineeringenvironmentequipmentestablishgovernmenthistorylandlawlegalmapsownershipplanningpointsprofessionalpropertyresearchstructuralsurveyingsurveyorsthemtransportationwork
es required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
daries for ownership, locations, such as the designated positions of structural components for construction or the surface location of subsurface features, or other purposes required by government or civil law, such as property sales. A professional in land surveying is called a land surveyor. Surveyors work with elements of geodesy, geometry, trigonometry, regression analysis, physics, engineering, metrology, programming languages, and the law. They use equipment, such as total stations, robotic total stations, theodolites, GNSS receivers, retroreflectors, 3D scanners, lidar sensors, radios, inclinometer, handheld tablets, optical and digital levels, subsurface locators, drones, GIS, and surveying software. Surveying has been an element in the development of the human environment since the beginning of recorded history. It is used in the planning and execution of most forms of construction. It is also used in transportation, communications, mapping, and the definition of legal boundaries for land ownership.
The main surveying instruments in use around the world are the theodolite, measuring tape, total station, 3D scanners, GPS/GNSS, level and rod. Most instruments screw onto a tripod when in use. Tape measures are often used for measurement of smaller distances. 3D scanners and various forms of aerial imagery are also used. The theodolite is an instrument for the measurement of angles. It uses two separate circles, protractors or alidades to measure angles in the horizontal and the vertical plane. A telescope mounted on trunnions is aligned vertically with the target object. The whole upper section rotates for horizontal alignment. The vertical circle measures the angle that the telescope makes against the vertical, known as the zenith angle. The horizontal circle uses an upper and lower plate. When beginning the survey, the surveyor points the instrument in a known direction (bearing), and clamps the lower plate in place. The instrument can then rotate to measure the bearing to other objects. If no bearing is known or direct angle measurement is wanted, the instrument can be set to zero during the initial sight. It will then read the angle between the initial object, the theodolite itself, and the item that the telescope aligns with. The gyrotheodolite is a form of theodolite that uses a gyroscope to orient itself in the absence of reference marks. It is used in underground applications. The total station is a development of the theodolite with an electronic distance measurement device (EDM). A total station can be used for leveling when set to the horizontal plane. Since their introduction, total stations have shifted from optical-mechanical to fully electronic devices. Modern top-of-the-line total stations no longer need a reflector or prism to return the light pulses used for distance measurements. They are fully robotic, and can even e-mail point data to a remote computer and connect to satellite positioning systems, such as Global Positioning System. Real Time Kinematic GPS systems have significantly increased the speed of surveying, and they are now horizontally accurate to within 1 cm ± 1 ppm in real-time, while vertically it is currently about half of that to within 2 cm ± 2 ppm. GPS surveying differs from other GPS uses in the equipment and methods used. Static GPS uses two receivers placed in position for a considerable length of time. The long span of time lets the receiver compare measurements as the satellites orbit. The changes as the satellites orbit also provide the measurement network with well-conditioned geometry. This produces an accurate baseline that can be over 20 km long. RTK surveying uses one static antenna and one roving antenna. The static antenna tracks changes in the satellite positions and atmospheric conditions. The surveyor uses the roving antenna to measure the points needed for the survey. The two antennas use a radio link that allows the static antenna to send corrections to the roving antenna. The roving antenna then applies those corrections to the GPS signals it is receiving to calculate its own position. RTK surveying covers smaller distances than static methods. This is because divergent conditions further away from the base reduce accuracy. Surveying instruments have characteristics that make them suitable for certain uses. Theodolites and levels are often used by constructors rather than surveyors in first-world countries. The constructor can perform simple survey tasks using a relatively cheap instrument. Total stations are workhorses for many professional surveyors because they are versatile and reliable in all conditions. The productivity improvements from a GPS on large-scale surveys make them popular for major infrastructure or data-gathering projects. One-person robotic-guided total stations allow surveyors to measure without extra workers to aim the telescope or record data. A fast but expensive way to measure large areas is with a helicopter, using a GPS to record the location of the helicopter and a laser scanner to measure the ground. To increase precision, surveyors place beacons on the ground (about 20 km (12 mi) apart). This method reaches precisions between 5–40 cm (depending on flight height). Surveyors use ancillary equipment such as tripods and instrument stands; staves and beacons used for sighting purposes; PPE; vegetation clearing equipment; digging implements for finding survey markers buried over time; hammers for placements of markers in various surfaces and structures; and portable radios for communication over long lines of sight. Software Land surveyors, construction professionals, geomatics engineers and civil engineers using total station, GPS, 3D scanners, and other data collectors use land surveying software to increase efficiency, accuracy, and productivity. Land Surveying Software is a staple of contemporary land surveying. Typically, much if not all of the drafting and some of the designing for plans and plats of the surveyed property is done by the surveyor, and nearly everyone working in the area of drafting today (2021) utilizes CAD software and hardware both on PC, and more and more in newer generation data collectors in the field as well. Other computer platforms and tools commonly used today by surveyors are offered online by the U.S.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (24): "activity", "among", "boise", "business", "college", "compete", "division", "education", "engineering", "fiscal", "health", "high", "idaho", "independent", "master", "million", "program", "programs", "public", "reported".... | EXACT TITLE in procurement_public_spending: "Boise State University". | EXACT TITLE in transportation_infrastructure: "Boise State University".
activityamongboisebusinesscollegecompetedivisioneducationengineeringfiscalhealthhighidahoindependentmastermillionprogramprogramspublicreportedresearchschooluniversitywest
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
Boise State University (BSU) is a public research university in Boise, Idaho, United States. Founded in 1932 by the Episcopal Church, it became an independent junior college in 1934 and has been awarding baccalaureate and master's degrees since 1965. It became a public institution in 1969. Boise State offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Boise Airport
Q1430971 EXACT TITLE 1.000
QID OVERLAP: Q1430971 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (29): "ada", "airport", "airports", "aviation", "boise", "center", "combined", "commercial", "department", "faa", "facility", "field", "functions", "general", "idaho", "increase", "interagency", "miles", "million", "national".... | EXACT TITLE in procurement_public_spending: "Boise Airport". | EXACT TITLE in transportation_infrastructure: "Boise Airport".
adaairportairportsaviationboisecentercombinedcommercialdepartmentfaafacilityfieldfunctionsgeneralidahoincreaseinteragencymilesmillionnationaloperatedoperatesreceiverequiringrightssupportterminaluseswestern
irport (IATA: BOI, ICAO: KBOI, FAA LID: BOI) (Boise Air Terminal or Gowen Field) is a joint civil-military airport in the western United States in Idaho, three miles (5 km) south of downtown Boise in Ada County. The airport is operated by the city of Boise Department of Aviation, overseen by an airport commission. Boise Airport is the busiest airport in the state with more than 5.2 million passengers serviced in 2025. Boise Airport services roughly ten times as many passengers as the next busiest airport at Idaho Falls. In 2020 it serviced more passenger flights than all other Idaho airports combined. Boise is a landing rights airfield requiring international general aviation flights to receive permission from a Customs and Border Protection officer before landing. In addition to being a commercial and general aviation airport, Boise also functions concurrently as a USAF military facility as used by the 124th Fighter Wing (124 FW) of the Idaho Air National Guard on the Gowen Field Air National Guard Base portion of the airport. The 124 FW operates the A-10 Thunderbolt II aircraft. The National Interagency Fire Center is based in the city of Boise and the Boise Airport is used for logistical support. The United States Forest Service (USFS) also uses Boise Airport as a base for aerial firefighting air tankers during the wildfire season. Boise Airport enplaned 2,248,435 passengers in 2022, an increase of 24% vs.
The Boise Airport Passenger Terminal designed by CSHQA is a three-story, steel-framed 378,000-square-foot (35,100 m2) state-of-the-art aviation facility. Curvilinear, steel trusses create the undulating ceiling plane of the ticket lobby and define the signature profile of the building. The terminal has garnered national attention for the beauty of its design and is considered a prototypical post-9/11 facility. The Boise Airport was fourth in passenger satisfaction in the J.D. Power and Associates 2004 Global Airport Satisfaction Index Study. Power no longer publishes a global listing, and the airport was not listed in the 2017 North American ranking. The Boise Airport was a hub for Horizon Air from the late 1980s to the early 2000s. Horizon Air was acquired by the Alaska Air Group, the parent company of Alaska Airlines, in 1986 and began code sharing flights for Alaska Airlines at that time. During the summer of 1990, Horizon Air was operating up to 36 departures a day from the airport to destinations in Idaho, Oregon, and Washington, as well as direct one stop service to Salt Lake City. By 1999, Horizon Air was operating up to 22 departures a day from Boise with Fokker F28 Fellowship jets with additional flights being operated with de Havilland Canada DHC-8 Dash 8 turboprops. The regional airline also previously operated Dornier 328, Fairchild F-27, and Swearingen Metroliner propjets. Boise is currently a focus city for Alaska Airlines service operated by both Horizon Air and code sharing partner SkyWest Airlines. Boise was also one of the primary destinations served by Cascade Airways which competed with Horizon Air.
In 2008, city officials broke ground for Boise Air Terminal's new airport traffic control tower, the latest facilities improvement. The tower's height at 295 feet (90 m) made it the tallest building in the state of Idaho (surpassed in 2013 by the 323-foot (98 m) Zions Bank Idaho Headquarters Building in downtown Boise), and the Northwest's tallest control tower. It was relocated to the south side of the airport in order to control an existing 5,000-foot (1,525 m) Guard assault strip, runway 09/27, south of Gowen Road. The tower was planned and constructed when it was believed that the radar functions would be moved to Salt Lake City in Utah. After it was decided to leave the radar positions in Boise, the facility at the base of the tower was redesigned and partially remodeled to house the Terminal Radar Approach Control (TRACON). The tower and TRACON opened on September 16, 2013, with updated electronics and equipment, including the STARS radar system; improving services and safety for pilots and the flying public. With the expanded facilities and new equipment, the TRACON operates the approach control for Boise Airport, and also remotely operates the approach control for the Bozeman Airport in Montana. The TRACON was then renamed Big Sky Approach to reflect the broader geographical coverage. The consolidation of Boise and Bozeman approach control facilities into Big Sky Approach is part of the FAA's continuing plan to consolidate approach control services across the nation.
Bridge
Q12280 EXACT TITLE 1.000
QID OVERLAP: Q12280 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (35): "allowing", "bridge", "bridges", "complex", "connecting", "connection", "construction", "contributions", "create", "design", "engineering", "engineers", "environment", "industrial", "intended", "local", "major", "maximum", "method", "miles".... | EXACT TITLE in procurement_public_spending: "Bridge". | EXACT TITLE in transportation_infrastructure: "Bridge".
allowingbridgebridgescomplexconnectingconnectionconstructioncontributionscreatedesignengineeringengineersenvironmentindustrialintendedlocalmajormaximummethodmilesnetworkphysicalproviderequirementsspanstructurestructuressupportsupportedtraffic+5
A bridge is a structure designed to span an obstacle, such as a river or railway, allowing vehicles, pedestrians, and other loads to pass across. Most bridges consist of a flat deck, supported by beams, arches, or cables. These structures rest on a foundation that is carefully designed to transfer the weight of the bridge to the subsoil without settling. Bridges can be constructed in a wide variety of forms, determined by the location, intended purpose, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
ght of the bridge to the subsoil without settling. Bridges can be constructed in a wide variety of forms, determined by the location, intended purpose, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
, and available construction technologies. Simple bridge structures include beam bridges made from logs, and suspension bridges made of ropes or vines. The Romans and ancient Chinese built major arch bridges of timber, stone, and brick. During the Renaissance, advances in science and engineering led to wider bridge spans and more elegant designs. Concrete was perfected in the early 19th century, and arch bridges are now built primarily of concrete or steel. With the Industrial Revolution came mass-produced steel, which enabled the creation of more complex forms – including truss and cantilever bridges – that permitted bridges to cross wide rivers or deep valleys. The longest spans use suspension or cable-stayed designs, both of which rely on high-strength steel cables to support the deck. Over time, the maximum achievable span of bridges has steadily increased, reaching 2 kilometers (1.2 miles) in 2022. Other bridge forms include multi-span viaducts, which can cross wide valleys; trestles, a common design for carrying heavy trains; and movable bridges including drawbridges and swing bridges. The design of a bridge must satisfy many requirements, namely connecting to a transportation network, providing adequate clearances, and safely transporting its users. A bridge must be strong enough to support its own weight as well as the weight of the traffic passing over it. It must also tolerate violent, hard-to-predict stresses imposed by the environment, including winds, floods, and earthquakes. To meet all these goals, bridge engineers typically use limit state design processes and the finite element method. Many bridges are admired for their beauty, and some spectacular bridges serve as iconic landmarks that provide a sense of pride and identity for the local community. In art and literature, bridges are frequently used as metaphors to represent connection or transition.
Civil engineering
Q77590 EXACT TITLE 1.000
QID OVERLAP: Q77590 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (26): "agencies", "airports", "bridges", "buildings", "civil", "construction", "departments", "design", "distinguish", "engineering", "environment", "firms", "government", "infrastructure", "locally", "maintenance", "municipal", "national", "physical", "private".... | EXACT TITLE in transportation_infrastructure: "Civil engineering".
agenciesairportsbridgesbuildingscivilconstructiondepartmentsdesigndistinguishengineeringenvironmentfirmsgovernmentinfrastructurelocallymaintenancemunicipalnationalphysicalprivateprofessionalpublicroadsstructuralsystemsworks
defined to distinguish non-military engineering from military engineering. Civil engineering can take place in the public sector from municipal public works departments through to national government agencies, and in the private sector from locally based firms to Fortune Global 500 companies. History As a discipline Civil engineering is the application of physical and scientific principles for solving the problems of society, and its history is intricately linked to advances in the understanding of physics and mathematics throughout history. Because civil engineering is a broad profession, including several specialized sub-disciplines, its history is linked to knowledge of structures, materials science, geography, geology, soils, hydrology, environmental science, mechanics, project management, and other fields. Throughout ancient and medieval history most architectural design and construction was carried out by artisans, such as stonemasons and carpenters, rising to the role of master builder. Knowledge was retained in craft guilds and seldom supplanted by advances. Structures, roads, and infrastructure that existed were repetitive, and increases in scale were incremental. One of the earliest examples of a scientific approach to physical and mathematical problems applicable to civil engineering is the work of Archimedes in the 3rd century BC, including Archimedes' principle, which underpins our understanding of buoyancy, and practical solutions such as Archimedes' screw.
essional engineering discipline that deals with the design, construction, and maintenance of the physical and naturally built environment, including public works such as roads, bridges, canals, dams, airports, sewage systems, pipelines, structural components of buildings, and railways. Civil engineering is traditionally broken into a number of sub-disciplines. It is considered the second-oldest engineering discipline after military engineering, and it is defined to distinguish non-military engineering from military engineering.
Transportation engineering is concerned with moving people and goods efficiently, safely, and in a manner conducive to a vibrant community. This involves specifying, designing, constructing, and maintaining transportation infrastructure which includes streets, canals, highways, rail systems, airports, ports, and mass transit.
College of Western Idaho
Q5146875 EXACT TITLE 1.000
QID OVERLAP: Q5146875 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (30): "academic", "ada", "board", "boise", "canyon", "classes", "college", "comprehensive", "counties", "cwi", "development", "education", "governed", "idaho", "large", "nampa", "population", "programs", "public", "reported".... | EXACT TITLE in procurement_public_spending: "College of Western Idaho". | EXACT TITLE in transportation_infrastructure: "College of Western Idaho".
academicadaboardboisecanyonclassescollegecomprehensivecountiescwidevelopmenteducationgovernedidaholargenampapopulationprogramspublicreportedresidentssouthweststudentstechnicalthroughouttransfertreasurevalleywesternworkforce
Southern Idaho and North Idaho College, in Idaho and is governed by a five-member board of trustees elected at large by voters in Ada and Canyon counties. CWI offers over 120 programs in the areas of Academic Transfer, Dual Credit, Career and Technical Education, Workforce Development, and Adult Education. In fall of 2023, CWI served 21,359 credit students and 14,951 noncredit students. CWI reported the gender of their students to be 55% female and 45% male.
History Prior to the creation of CWI, Boise was one of the largest metropolitan statistical areas in the United States without a community college. CWI was created on May 22, 2007, when voters of Canyon and Ada counties passed a measure to allow the formation of the new community college district. In June 2007, the Albertson Foundation announced it was donating $10 million to help found the college. In July 2007, the Idaho State Board of Education selected an initial five-member board of trustees. The following month Boise State University faculty member Dennis Griffin was named to a two-year term as the college's first president and CWI began offering academic classes on January 20, 2009, with an enrollment of over 1,100 students. In the summer of 2009 the professional-technical programs from Boise State University's Selland College of Applied Technology transitioned to CWI. By the fall 2009 semester, CWI enrollment had expanded to over 3,600 students. In January 2010, CWI applied for accreditation from the Northwest Commission on Colleges and Universities (NWCCU). NWCCU granted candidacy status at the associate degree level in 2012 and initial accreditation in 2016. President Griffin retired in August 2009 and was succeeded by Bert Glandon. After serving as president for 12 years, Glandon retired from CWI on May 15, 2021. The college's board of trustees named Denise Aberle-Cannata the interim president. CWI Board of Trustees extended an offer to Gordon Jones on Dec. 9, 2021 to be the next president at College of Western Idaho. Gordon Jones accepted the position of President at CWI and began his tenure as the third president in CWI's history on Jan.
Catchment area The college's catchment area includes all of the following counties: Ada, Adams, Boise, Canyon, Gem, Payette, Valley, and Washington. It also includes portions of Elmore and Owyhee counties. Ada and Canyon counties are the taxation zone for the college. Student life CWI has over 30 student clubs and organizations. Student clubs have been created with academic focus as well as special interests. Student groups range from art to physics, horticulture, psychology, Glee, Birdies and Bogies, a Veterans Association, and more. The Associated Students of the College of Western Idaho (ASCWI) serve as the voice of the student body. ASCWI is governed by five officers and eight senators elected by the student body each spring. CWI students participate in competitive, skills-based organizations like Business Professionals of America, SkillsUSA, and Speech and Debate. CWI students have found success at state, regional, and national levels in all three organizations. CWI Speech and Debate captured seven Pi Kappa Delta Community College National Championships in 2011, 2012, 2013, 2015, 2016, 2017, and 2018. Students have earned individual medals at national skills competitions as well. Students have the opportunity to engage on campus through the CWI Presidential Ambassador Program, which promotes leadership and connects students to campus and community events.
Federal Highway Administration
Q800112 EXACT TITLE 1.000
QID OVERLAP: Q800112 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (16): "administration", "agency", "department", "division", "federal", "federal-aid", "highway", "major", "office", "program", "programs", "public", "road", "roads", "role", "transportation". | EXACT TITLE in procurement_public_spending: "Federal Highway Administration". | EXACT TITLE in transportation_infrastructure: "Federal Highway Administration".
administrationagencydepartmentdivisionfederalfederal-aidhighwaymajorofficeprogramprogramspublicroadroadsroletransportation
The Federal Highway Administration (FHWA) is a division of the United States Department of Transportation that specializes in highway transportation. The agency's major activities are grouped into two programs, the Federal-aid Highway Program and the Federal Lands Highway Program.
Background With the coming of the bicycle in the 1890s, interest grew regarding the improvement of streets and roads in America. The traditional method of putting the burden on maintaining roads on local landowners was increasingly inadequate. In 1893, the federal Office of Road Inquiry (ORI) was founded; in 1905, it was renamed the Office of Public Roads (OPR) and made a division of the United States Department of Agriculture. Demands grew for local and state government to take charge. With the coming of the automobile, urgent efforts were made to upgrade and modernize dirt roads designed for horse-drawn wagon traffic. In 1910, the American Association for Highway Improvement was organized. Funding came from automobile registration, and taxes on motor fuels, as well as state aid. By 1914, there were 2.4 million miles of rural dirt rural roads; 100,000 miles had been improved with grading and gravel, and 3,000 miles were given high-quality surfacing. The rapidly increasing speed of automobiles, and especially trucks, made maintenance and repair high-priority items. In 1915, OPR's name was changed to the Bureau of Public Roads. The following year, federal aid was first made available to improve post roads and promote general commerce: $75 million over five years, issued through the BPR in cooperation with the state highway departments. In 1939, BPR was renamed to the Public Roads Administration (PRA) and shifted to the Federal Works Agency.
Creation The Federal Highway Administration was created on October 15, 1966, along with the Bureau of Motor Carrier Safety and the National Highway Safety Bureau (now known as National Highway Traffic Safety Administration), as part of the new U.S. Department of Transportation. The FHWA took over the functions of the Bureau of Public Roads the following year. Functions The FHWA's role in the Federal-aid Highway Program is to oversee federal funds to build and maintain the National Highway System (primarily Interstate highways, U.S. highways and most state highways). This funding mostly comes from the federal gasoline tax and mostly goes to state departments of transportation. The FHWA oversees projects using these funds to ensure that federal requirements for project eligibility, contract administration and construction standards are adhered to. Under the Federal Lands Highway Program (sometimes called "direct fed"), the FHWA provides highway design and construction services for various federal land-management agencies, such as the Forest Service and the National Park Service. The FLHP also jointly administers the Indian Reservation Roads Program. In addition to these programs, the FHWA performs and sponsors research in the areas of roadway safety, congestion, highway materials and construction methods, and provides funding to local technical assistance program centers to disseminate research results to local highway agencies. The FHWA also publishes the Manual on Uniform Traffic Control Devices (MUTCD), which is used by most highway agencies in the United States.
Transportation planning
Q1034047 EXACT TITLE 1.000
QID OVERLAP: Q1034047 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (19): "agencies", "apply", "businesses", "comprehensive", "design", "destinations", "facilities", "government", "influence", "move", "movement", "needs", "planning", "policies", "private", "process", "public", "system", "transportation". | EXACT TITLE in transportation_infrastructure: "Transportation planning".
agenciesapplybusinessescomprehensivedesigndestinationsfacilitiesgovernmentinfluencemovemovementneedsplanningpoliciesprivateprocesspublicsystemtransportation
s to prepare for future needs to move people and goods to destinations. As practiced today, it is a collaborative process that incorporates the input of many stakeholders including various government agencies, the public and private businesses.
take account of the social, economic and environmental context of their work understand the legal, regulatory policy and resource framework within which they work understand and create transport policies, strategies and plans that contribute to meeting social, economic and environmental needs design the necessary transport projects, systems and services understand the commercial aspects of operating transport systems and services know about and apply the relevant tools and techniques must be competent in all aspects of management, in particular communications, personal skills and project management. The UK Treasury recognises and has published guidance on the systematic tendency for project appraisers to be overly optimistic in their initial estimates.
s a collaborative process that incorporates the input of many stakeholders including various government agencies, the public and private businesses.
Paratransit
Q2564783 EXACT TITLE 1.000
QID OVERLAP: Q2564783 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (32): "access", "agencies", "beyond", "cities", "daily", "developing", "economic", "fixed", "fixed-route", "form", "formal", "government", "local", "mobility", "operate", "operated", "operates", "operators", "organizations", "paratransit".... | EXACT TITLE in procurement_public_spending: "Paratransit". | EXACT TITLE in transportation_infrastructure: "Paratransit".
accessagenciesbeyondcitiesdailydevelopingeconomicfixedfixed-routeformformalgovernmentlocalmobilityoperateoperatedoperatesoperatorsorganizationsparatransitprivateprovidepublicservingsmallsubjectsubstantialsupportssystemstransit+2
ily income, which supports their livelihoods. Typically, minibuses are used to provide paratransit service in USA. Most paratransit vehicles are equipped with wheelchair lifts or ramps to facilitate access. In the United States, private transportation companies often provide paratransit service in cities and metropolitan areas under contract to local public transportation agencies. Terminology The use of "paratransit" ("para transit", "para-transit") has evolved and taken on two somewhat separate broad sets of meaning and application in North America; the term is rarely used in the rest of the world. The more general meaning includes any transit service operating alongside conventional fixed-route services, including airport limousines and carpools. Since the early 1980s, particularly in North America, the term began to be used increasingly to describe the second meaning: special transport services for people with disabilities. In this respect, paratransit has become a subsector and business in its own right. The term paratransit is rarely used outside of North America. Projects in the broader sense were documented by the Urban Institute in the 1974 book Para-transit: Neglected options for urban mobility, followed a year later by the first international overview, Paratransit: Survey of International Experience and Prospects. Robert Cervero's 1997 book, Paratransit in America: Redefining Mass Transportation, embraced this wider definition of paratransit, arguing that America's mass transit sector should enlarge to include micro-vehicles, minibuses, and shared-taxi services found in many developing cities.
Diversion to taxis and ride-hailing services Some paratransit systems have begun subsidizing private taxi or ride-hailing trips as an alternative to the government-run or government-contracted system. For example, in 2010, Solano County, California dissolved Solano Paratransit and allowed paratransit-eligible passengers to buy $100 worth of taxi scrip for $15. This eliminated the need for passengers to book a week in advance, and reduced the cost to the county from $81 to about $30. In 2016, the Massachusetts Bay Transportation Authority began a pilot program which has subsidized paratransit passengers on Uber, Lyft, and Curb, up to a cap of $42 per ride. This retained the ability to book by phone, lowered the fare for riders, eliminated the need to book the trip a day in advance, eliminated shared trips, reduced in-transit time, and reduced the pickup wait time from 30 minutes to as low as 5 minutes in the urban core. With the subsidy cap initially set at $13, the MBTA reduced the average cost of a paratransit trip from $35 to $9. Pilot participants on average substantially increased the number of trips they took, but still at a lower overall cost to the agency. Availability of wheelchair-accessible vehicles remained an occasional problem, but these were only needed by about 20% of paratransit riders. In the United States Rehabilitation Act of 1973 Before passage of the Americans with Disabilities Act of 1990 (ADA), paratransit was provided by not-for-profit human service agencies and public transit agencies in response to the requirements in Section 504 of the Rehabilitation Act of 1973. Section 504 prohibited the exclusion of disabled people from "any program or activity receiving federal financial assistance". In Title 49 Part 37 (49 CFR 37) of the Code of Federal Regulations, the Federal Transit Administration defined requirements for making buses accessible or providing complementary paratransit services within public transit service areas. Most transit agencies did not see fixed route accessibility as desirable and opted for a flexible system of small paratransit vehicles operating parallel to a system of larger, fixed-route buses. The expectation was that the paratransit services would not be heavily used, making a flexible system of small vehicles a less expensive alternative for accessibility than options with larger, fixed-route vehicles. This however ended up not being the case. Often paratransit services were being filled up to their capacity.
Rehabilitation Act of 1973 Before passage of the Americans with Disabilities Act of 1990 (ADA), paratransit was provided by not-for-profit human service agencies and public transit agencies in response to the requirements in Section 504 of the Rehabilitation Act of 1973. Section 504 prohibited the exclusion of disabled people from "any program or activity receiving federal financial assistance". In Title 49 Part 37 (49 CFR 37) of the Code of Federal Regulations, the Federal Transit Administration defined requirements for making buses accessible or providing complementary paratransit services within public transit service areas. Most transit agencies did not see fixed route accessibility as desirable and opted for a flexible system of small paratransit vehicles operating parallel to a system of larger, fixed-route buses. The expectation was that the paratransit services would not be heavily used, making a flexible system of small vehicles a less expensive alternative for accessibility than options with larger, fixed-route vehicles. This however ended up not being the case. Often paratransit services were being filled up to their capacity.
Nampa, Idaho
Q622633 QID OVERLAP 0.800
QID OVERLAP: Q622633 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (15): "according", "boise", "canyon", "college", "home", "idaho", "meaning", "meridian", "miles", "nampa", "population", "principal", "university", "west", "western".
accordingboisecanyoncollegehomeidahomeaningmeridianmilesnampapopulationprincipaluniversitywestwestern
state 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
W. J. McClelland, c.1901–1903 Frank H. Sutherland, c.1903–1904 H. A. Partridge, c.1904–1905, 1907–1908, 1913–1914 Rudolphus W. Purdum, c.1905–1906 E. H. Dewey, c.1909–1911 T. E. Munhall, c.1915–1917 Robert A. Davis, c.1917–1919 H. H. Keim, c.1919–1920 J. Fremont Bow, 1921–1923 Eugene Emerson, c.1923–1925 George Meffan, 1925–1929 Eustace Smallwood, c.1929–1930 E. W. Rising, c.1933–1935 George I. Van Name, 1935–1937 R. Lewis Ord, 1937–1939 Ben H. Waigand, 1939–1943 A. E. Lindsey, c.1943–1945 Sevren G. Honstead, 1945–1947 Peter Johnson, 1947–1951 Preston Capell, c.1951–1957 Thomas Leupp, 1957–1961 Ernest Starr, 1961–1981 Winston K.
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
Traffic light
Q8004 QID OVERLAP 0.800
QID OVERLAP: Q8004 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (18): "capacity", "competing", "control", "information", "lane", "laws", "local", "national", "need", "reduce", "road", "signal", "signals", "system", "systems", "technology", "traffic", "users".
capacitycompetingcontrolinformationlanelawslocalnationalneedreduceroadsignalsignalssystemsystemstechnologytrafficusers
rliament Square in London to reduce the need for police officers to control traffic. Since then, electricity and computerised control have advanced traffic light technology and increased intersection capacity.
Signals can either be placed nearside – between the stop line and the curb line of the intersecting road – or farside – on the opposite side of the junction. In European countries, signals are often placed on the nearside. In the UK, at least two signal heads are required, known as the primary and secondary heads, one of which is normally nearside and the other of which could be nearside or farside. In the US, signals are normally located farside, though in some states, nearside signals are also used. Nearside signals can be beneficial to road safety, as drivers have more time to see a red light and are less likely to encroach on pedestrian crossings. Effects Drivers spend on average around 2% of journey time passing through signalised junctions. Traffic lights can increase the traffic capacity at intersections and reduce delay for side road traffic, but can also result in increased delay for main road traffic. Hans Monderman, the innovative Dutch traffic engineer, and pioneer of shared space schemes, was sceptical of their role, and is quoted as having said of them: "We only want traffic lights where they are useful and I haven't found anywhere where they are useful yet." A World Economic Forum study found that signalised junctions are associated with higher levels of localised air pollution. Drivers accelerate and stop frequently at lights, and as such, peak particle concentration can be around 29 times higher than during free-flow conditions. The WEF recommends that traffic authorities synchronise traffic signals, consider alternative traffic management systems, and consider placing traffic lights away from residential areas, schools, and hospitals. Separating conflicting streams of traffic in time can reduce the likelihood of right-angle collisions by turning traffic and cross traffic, but it can increase the frequency of rear-end crashes by up to 50%. Since right-angled and turn-against-traffic collisions are more likely to result in injuries, this is often an acceptable trade-off. They can also adversely affect the safety of bicycle and pedestrian traffic. Between 1979 and 1988, the city of Philadelphia, Pennsylvania, removed signals at 199 intersections that were not warranted. On average, the intersections had 24% fewer crashes after the unwarranted signals were removed. The traffic lights had been erected in the 1960s because of since-resolved protests over traffic.
hts, traffic signals, or stoplights – also known as robots in South Africa, Zambia, and Namibia – are signalling devices positioned at road intersections, pedestrian crossings, and other locations to control the flow of traffic. Traffic lights usually consist of three signals, conveying meaningful information to road users through colours and symbols, including arrows and bicycle symbols. The usual traffic light colours are red to stop traffic, amber to signal a change, and green to allow traffic to proceed. These are arranged vertically or horizontally in that order. Although this is internationally standardised, variations in traffic light sequences and laws exist on national and local scales. Traffic lights were first introduced in December 1868 on Parliament Square in London to reduce the need for police officers to control traffic. Since then, electricity and computerised control have advanced traffic light technology and increased intersection capacity.
Boise, Idaho
Q35775 QID OVERLAP 0.800
QID OVERLAP: Q35775 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (16): "ada", "annual", "boise", "capital", "counties", "estimated", "home", "idaho", "locally", "major", "miles", "oregon", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountiesestimatedhomeidaholocallymajormilesoregonpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
R
Q1185073 QID OVERLAP 0.800
QID OVERLAP: Q1185073 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (39): "according", "activity", "analysis", "becomes", "design", "documentation", "engineer", "engineering", "engineers", "environment", "established", "general", "government", "jurisdictions", "legal", "license", "licensed", "licensure", "local", "maintenance"....
accordingactivityanalysisbecomesdesigndocumentationengineerengineeringengineersenvironmentestablishedgeneralgovernmentjurisdictionslegallicenselicensedlicensurelocalmaintenanceplanspractitionersprocessproductsprofessionalprojectprojectspropertyprovidepublic+9
ering and to provide professional services and products to the public. As with many other professions and activities, engineering is often a restricted activity. Relatedly, jurisdictions that license according to particular engineering discipline define the boundaries of each discipline carefully so that practitioners understand what they are competent to do. A licensed engineer takes legal responsibility for engineering work, product or projects (typically via a seal or stamp on the relevant design documentation) as far as the local engineering legislation is concerned. Regulations require that only a licensed engineer can sign, seal or stamp technical documentation such as reports, plans, engineering drawings and calculations for study estimate or valuation or carry out design analysis, repair, servicing, maintenance or supervision of engineering work, process or project. In cases where public safety, property or welfare is concerned, licensed engineers are trusted by the government and the public to perform the task in a competent manner.
South Korea In South Korea, engineering credentials are primarily structured through the national technical qualification system under the National Technical Qualifications Act, which classifies technical qualifications into five grades: professional engineer, master craftsman, engineer, industrial engineer, and craftsman. Within this hierarchy, the professional engineer (기술사, gisulsa) is the grade most analogous to a professional engineering licence in other jurisdictions, because it is separately governed by the Professional Engineers Act, which defines professional engineers' duties, permits the establishment of registered professional engineer offices, and requires registered practitioners to sign and seal designs and reports prepared in the course of practice. Unlike jurisdictions that rely on a single broad P.E. title, South Korea divides the professional engineer grade into a large number of field-specific categories. Q-Net lists 84 professional engineer categories overall, including information-technology fields such as Professional Engineer Information Management and Professional Engineer Computer System Application. Eligibility is experience-based and examination-centered. According to Q-Net, candidates typically qualify for the professional engineer examination through combinations of lower-tier qualifications, academic credentials, and substantial work experience; the examination process itself consists of a written examination followed by an interview. This differs from some U.S. licensure models, in which state boards or NCEES records may require professional references as part of the licensing process. The examinations are also selective.
Europe EUR ING (European Engineer) in Europe, used as a pre-nominal (similar to Dr or Prof.) after being suitably registered in their own country and then accepted by Engineers Europe. Ing. (ingeniero) in Spain, used as a pre-nominal, for the engineers who have the equivalent to a master's degree as they studied five or six courses in an engineering superior school. There also exists an ingeniero técnico (I.T.), who is a professional that holds a degree and has taken a minimum of three courses in an official engineering college. Both types of engineers have full competency in their respective professional field of engineering, the difference being that the three-year engineers have competence only in their specialty (mechanical, electrical, chemical, etc.) and the "engineering superior school" engineers have wider competences. The Bologna process changes this structure. The degree will require four courses and the superior engineering school engineers will equal the ones that hold a master's in engineering. Eng. (Engenheiro) in Portugal, used as a pre-nominal. An engenheiro is a full chartered professional in engineering who was awarded a master's degree (second study cycle according to the Bologna process system) by an accredited engineering school. In Portugal there is also the engenheiro técnico who is a professional with a bachelor's degree (first study cycle) in engineering or engineering sciences. Accredited master's degrees in engineering are regulated and certified by the Ordem dos Engenheiros (Order of Engineers) and every professional full chartered engineer is registered at the Ordem. In Finland, regulation affects only academic degrees. In academic education, the degree of diplomi-insinööri (dipl. ins. or DI), officially translated "Master of Science (Technology)", is awarded by universities and universities of technology and is preceded by an intermediate bachelor's degree (tekniikan kandidaatti) or equivalent studies. In vocational education, the degrees insinööri and ylempi insinööri (amk) are awarded by polytechnics. In Germany the Dipl.-Ing. pre-nominal (from Diplom-Ingenieur, engineer diploma) is awarded by the educational ministries of the federal states after completing an academic engineering education according to the German engineer's law. The pre-nominals Ing. grad. (graduierter Ingenieur, graduate engineer) and Obering. (Oberingenieur, supervisor engineer) are no longer awarded. State-certified Engineer BVT is the authorized translation (by the German Federal Government) of staatlich geprüfter Techniker. Ir. is used as a pre-nominal in the Netherlands (for engineers holding a master's degree from a university) or Ing. (for engineers holding a bachelor's degree from a professional school). Ir. is used as a pre-nominal in Belgium (for civil engineers holding a master's degree in engineering/bio-engineering sciences from a university) or Ing. (for industrial engineers holding a master's degree in applied engineering, formerly from university colleges; from 2013 these formations are integrated in the universities). Ing. in Italy used as a pre-nominal (for engineers holding a master's degree ) or Ing.jr. (for engineers holding a bachelor's degree). A state exam is required. Registration is with the Consiglio Nazionale degli Ingegneri. Siv. Ing. (sivilingeniør, Master of Science) and ing. (høyskoleingeniør, Bachelor of Science) in Norway. The title is used by persons holding degrees from accredited engineering colleges and universities. CEng (chartered engineer) and IEng (incorporated engineer) post-nominals are used in the UK and Ireland. UK and Irish engineers may also carry post-nominal letters specific to their specialist engineering institute, such as MIET (Member of the Institution of Engineering and Technology). In the UK these are recognized as regulated qualifications and titles. Civ. Ing. in Sweden (for engineers holding a master's degree in engineering, Master of Engineering, Master of Science in Engineering) and högskoleingenjör in Sweden (for engineers holding a Bachelor of Science degree). Cand.polyt. in Denmark (for engineers holding a master's degree in engineering, Master of Engineering, Master of Science in engineering). Ing. in Romania, used as a pre-nominal (similar to Dr. or Prof.). Ing. for engineers holding a master's degree in Czech Republic and Slovak republic, used as a pre-nominal. inż. and mgr. inż. in Poland for engineers with a bachelor's degree (inżynier, engineer) and a master's degree (magister inżynier, master engineer) respectively. The master's degree can be obtained in two years post-graduate education or formerly (until full adaptation of the Bologna process by universities) or through an integrated five-year Bachelor of Science/Master of Science program. Some (particularly in the US) mistakenly believe that mgr. inż. is some kind of separate degree, while in fact these are two degrees, regardless of how they were obtained. The degree in general includes license to practice, although some regulation may require additional registration to perform specific tasks. маг. инж. (master engineer) is as a pre-nominal in Bulgaria for engineers holding a master's degree) or инж. for engineers holding a bachelor's degree. Inġ. in Malta for engineers holding a university degree and at least three years of experience. BVT in Germany (for engineers holding three-and-a-half years of certified apprenticeship, followed by a minimum of a 2,400-hour degree and a minimum of two years of approved relevant experience, members of the federal Association of Higher Professionals for Technology, Economy and Design). Müh. or 'Mühendis is the title used in Turkey by someone holding a four-year degree from an accredited engineering university. Διπλωματούχος Μηχανικός (diploma owner in engineering) or Διπλ. Μηχ. is used in Greece as the title of someone holding a five-year degree from a public engineering university.
Community college
Q1336920 QID OVERLAP 0.800
QID OVERLAP: Q1336920 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (15): "academic", "college", "different", "education", "form", "high", "institutions", "open", "policy", "programs", "school", "students", "transfer", "university", "workforce".
academiccollegedifferenteducationformhighinstitutionsopenpolicyprogramsschoolstudentstransferuniversityworkforce
d from high school, also known as senior secondary school or upper secondary school. The term usually refers to a higher educational institution that provides workforce education and college transfer academic programs. Some institutions maintain athletic teams and dormitories similar to their university counterparts. Australia In Australia, the term "community college" refers to small private businesses running short (e.g. six weeks) courses generally of a self-improvement or hobbyist nature. Equivalent to the American notion of community colleges are Technical and Further Education colleges or TAFEs; these are institutions regulated mostly at state and territory level. There are also an increasing number of private providers colloquially called "colleges". TAFEs and other providers carry on the tradition of adult education, which was established in Australia around the mid-19th century, when evening classes were held to help adults enhance their numeracy and literacy skills. Most Australian universities can also be traced back to such forerunners, although obtaining a university charter has always changed their nature. In TAFEs and colleges today, courses are designed for personal development of an individual or for employment outcomes. Educational programs cover a variety of topics such as arts, languages, business and lifestyle. They usually are scheduled to run two, three or four days of the week, depending on the level of the course undertaken. A Certificate I may only run for 4 hours twice a week for a term of 9 weeks. A full-time Diploma course might have classes 4 days per week for a year (36 weeks). Some courses may be offered in the evenings or weekends to accommodate people working full-time. Funding for colleges may come from government grants and course fees. Many are not-for-profit organizations. Such TAFES are located in metropolitan, regional and rural locations of Australia. Education offered by TAFEs and colleges has changed over the years. By the 1980s, many colleges had recognized a community need for computer training. Since then thousands of people have increased skills through IT courses. The majority of colleges by the late 20th century had also become Registered Training Organisations. They offer individuals a nurturing, non-traditional education venue to gain skills that better prepare them for the workplace and potential job openings. TAFEs and colleges have not traditionally offered bachelor's degrees, instead providing pathway arrangements with universities to continue towards degrees. The American innovation of the associate degree is being developed at some institutions. Certificate courses I to IV, diplomas and advanced diplomas are typically offered, the latter deemed equivalent to an undergraduate qualification, albeit typically in more vocational areas.
In Canada, colleges are adult educational institutions that provide higher education and tertiary education, and grant certificates and diplomas. Alternatively, Canadian colleges are often called "institutes" or "polytechnic institutes". As well, in Ontario, the 24 colleges of applied arts and technology have been mandated to offer their own stand-alone degrees as well as to offer joint degrees with universities through "articulation agreements" that often result in students emerging with both a diploma and a degree. Thus, for example, the University of Guelph "twins" with Humber College and York University does the same with Seneca College. More recently, however, colleges have been offering a variety of their own degrees, often in business, technology, science, and other technical fields. Each province has its own educational system, as prescribed by the Canadian federalism model of governance. In the mid-1960s and early 1970s, most Canadian colleges began to provide practical education and training for the emerging and booming generation, and for immigrants from around the world who were entering Canada in increasing numbers at that time. A formative trend was the merging of the then separate vocational training and adult education (night school) institutions. Canadian colleges are either publicly funded or private post-secondary institutions (run for profit). In terms of academic pathways, Canadian colleges and universities collaborate with each other with the purpose of providing college students the opportunity to academically upgrade their education. Students can transfer their diplomas and earn transfer credits through their completed college credits towards undergraduate university degrees. The term associate degree is used in Western Canada to refer to a two-year college arts or science degree, similar to how the term is used in the United States. In other parts of Canada, the term advanced degree is used to indicate a three- or four-year college program. In Quebec, three years is the norm for a university degree because a year of credit is earned in the CÉGEP (college) system. Even when speaking in English, people often refer to all colleges as Cégeps; however, the term is an acronym more correctly applied specifically to the French-language public system: Collège d'enseignement général et professionnel (CEGEP); in English: College of General and Vocational Education.
A community college is a type of undergraduate higher education institution, generally leading to an associate degree, certificate, or diploma. The term can have different meanings in different countries: many community colleges have an open enrollment policy for students who have graduated from high school, also known as senior secondary school or upper secondary school. The term usually refers to a higher educational institution that provides workforce education and college transfer academic programs.
Ada County, Idaho
Q109820 QID OVERLAP 0.760
QID OVERLAP: Q109820 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "capital", "district", "estimated", "highway", "home", "idaho", "jurisdiction", "local", "population", "private", "roads".
adaboisecapitaldistrictestimatedhighwayhomeidahojurisdictionlocalpopulationprivateroads
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Caldwell, Idaho
Q849592 QID OVERLAP 0.720
QID OVERLAP: Q849592 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (11): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "miles", "oregon", "population", "west".
approximatelyboisecaldwellcanyoncollegeidaholocallymilesoregonpopulationwest
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Garden City, Idaho
QID OVERLAP 0.680
QID OVERLAP: Q1516892 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:evergreen). | SHARED TOKENS (9): "ada", "boise", "garden", "government", "idaho", "municipal", "nearly", "population", "separate".
adaboisegardengovernmentidahomunicipalnearlypopulationseparate
Garden City is a city in Ada County, Idaho. The population was 12,316 at the time of the 2020 census. Garden City is nearly surrounded by Boise but retains a separate municipal government. Garden City was named for gardens raised by Chinese immigrants who lived in the area.
Geography According to the United States Census Bureau, the city has a total area of 4.17 square miles (10.80 km2), of which 4.04 square miles (10.46 km2) is land and 0.13 square miles (0.34 km2) is water. Expo Idaho, which hosts the Western Idaho Fair, is part of unincorporated Ada County but the city limits completely surround the complex. In 2017, Mayor John Evans proposed that Garden City annex the enclave in order to develop a downtown area. Demographics 2020 census As of the 2020 census, Garden City had a population of 12,316. The median age was 47.0 years. 16.9% of residents were under the age of 18 and 26.4% of residents were 65 years of age or older. For every 100 females there were 92.1 males, and for every 100 females age 18 and over there were 90.5 males age 18 and over. 100.0% of residents lived in urban areas, while 0.0% lived in rural areas. There were 5,585 households in Garden City, of which 21.4% had children under the age of 18 living in them. Of all households, 40.2% were married-couple households, 21.5% were households with a male householder and no spouse or partner present, and 30.1% were households with a female householder and no spouse or partner present. About 33.1% of all households were made up of individuals and 16.8% had someone living alone who was 65 years of age or older. There were 5,927 housing units, of which 5.8% were vacant.
2000 census At the 2000 census there were 10,624 people, 4,331 households, and 2,784 families living in the city. The population density was 2,559.9 per square mile. There were 4,590 housing units at an average density of 1,106.0 per square mile. The racial makeup of the city was 89.3% White, 0.5% African American, 0.9% Native American, 1.4% Asian, 0.1% Pacific Islander, 4.9% from other races, and 2.9% from two or more races. Hispanic or Latino of any race were 9.6%. Of the 4,331 households 29.8% had children under the age of 18 living with them, 47.7% were married couples living together, 10.9% had a female householder with no husband present, and 35.7% were non-families. 27% of households were one person and 8.3% were one person aged 65 or older. The average household size was 2.43 and the average family size was 2.91. The age distribution was 24.3% under the age of 18, 10.8% from 18 to 24, 29.9% from 25 to 44, 22.6% from 45 to 64, and 12.5% 65 or older. The median age was 35 years. For every 100 females, there were 103.1 males. For every 100 females age 18 and over, there were 101.3 males. The median household income was $38,520 and the median family income was $46,463. Males had a median income of $30,499 versus $28,315 for females. The per capita income for the city was $24,242. About 9.8% of families and 12.7% of the population were below the poverty line, including 16.6% of those under age 18 and 4.0% of those age 65 or over. Education Most of Garden City is in Boise School District.
Meridian, Idaho
Q1085274 QID OVERLAP 0.680
QID OVERLAP: Q1085274 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (9): "ada", "among", "boise", "capital", "cities", "idaho", "making", "meridian", "population".
adaamongboisecapitalcitiesidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Kuna, Idaho
Q1515177 QID OVERLAP 0.660
QID OVERLAP: Q1515177 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "ada", "additional", "boise", "idaho", "kuna", "nearly", "percent", "population".
adaadditionalboiseidahokunanearlypercentpopulation
Kuna ( KYOO-nə) is a city in Ada County, Idaho. It is part of the Boise metropolitan area. The population was 24,011 at the time of the 2020 census. Kuna is one of the fastest-growing areas in Idaho, having nearly tripled in population between 2000 and 2010 and a nearly additional 60 percent gain between 2010 and 2020.
History Kuna originated as a railroad stop with coach transport to Boise. It is popularly believed, as cited by the Kuna Chamber of Commerce, that the translation of the name "Kuna" means "the end of the trail", but Charles S. Walgamott cites the origin of the name as a Shoshone Indian word meaning "green leaf, good to smoke." The Western Heritage Historic Byway, designated as a national as well as a state scenic byway, travels around a number of historic sites in the area. Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam.
Geography Kuna's business center is approximately 18 miles (29 km) southwest of downtown Boise, the state capital. According to the United States Census Bureau, the city has a total area of 18.18 square miles (47.09 km2), of which 18.08 square miles (46.83 km2) is land and 0.10 square miles (0.26 km2) is water. South of Kuna is the Kuna Caves, a lava tube. A small seasonal creek, Indian Creek, runs through the city. It is now used as an irrigation canal, filled by the New York Canal from the Boise River Diversion Dam. One of the few small floatable waterways in the region, Indian Creek is a favorite swimming spot for local residents. Demographics 2020 census As of the 2020 census, Kuna had a population of 24,011. The median age was 30.9 years. 31.8% of residents were under the age of 18 and 8.1% of residents were 65 years of age or older. For every 100 females there were 97.8 males, and for every 100 females age 18 and over there were 96.2 males age 18 and over. 97.1% of residents lived in urban areas, while 2.9% lived in rural areas. There were 7,736 households in Kuna, of which 48.2% had children under the age of 18 living in them. Of all households, 62.3% were married-couple households, 11.6% were households with a male householder and no spouse or partner present, and 17.4% were households with a female householder and no spouse or partner present. About 13.9% of all households were made up of individuals and 4.6% had someone living alone who was 65 years of age or older. There were 7,948 housing units, of which 2.7% were vacant. The homeowner vacancy rate was 0.8% and the rental vacancy rate was 5.9%. As of the 2020 census, the median income for a household in the city was $68,017. Families had a median income of $75,296 versus $91,364 for married-couple families and $33,512 for nonfamily households.
Canyon County, Idaho
Q486078 QID OVERLAP 0.660
QID OVERLAP: Q486078 in procurement_public_spending (tier:evergreen) and transportation_infrastructure (tier:branch). | SHARED TOKENS (8): "boise", "caldwell", "canyon", "estimated", "idaho", "making", "nampa", "population".
boisecaldwellcanyonestimatedidahomakingnampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Eagle, Idaho
Q1516870 QID OVERLAP 0.620
QID OVERLAP: Q1516870 in procurement_public_spending (tier:branch) and transportation_infrastructure (tier:branch). | SHARED TOKENS (6): "ada", "boise", "eagle", "idaho", "miles", "population".
adaboiseeagleidahomilespopulation
Eagle is a city in Ada County, Idaho, ten miles (16 km) northwest of downtown Boise. The population was 30,346 at the 2020 census. History 19th century Eagle Island in Idaho was settled in 1863 by Truman Coe Catlin, who later shifted from crop farming to dairy farming, starting the island's dairy tradition. He also pioneered irrigation in the area by constructing a wide irrigation ditch. The most notable early community developer was Thomas Hugh Aiken, a Canadian surveyor, who helped establish the Eagle community in the 1870s.
Parks and recreation The city features numerous parks, including Arboretum Park, Friendship Park, Heritage Park, Orval Krasen Park, Reid W. Merrill Sr. Community Park, and Stephen C. Guerber Park, among others. The Parks and Recreation department offers youth sports leagues, camps, special events (such as Eagle Fun Days), and maintains extensive trails. Nearby Eagle Island State Park provides a swimming beach, trails, disc golf, and winter sports. Education Most of Eagle is in the West Ada School District, with a small portion in the Boise School District.
20th century The Eagle Fish Hatchery, established in the late 1940s in Idaho, was originally part of a trout program until the 1980s. In 1991, it was restructured to support the conservation of Snake River sockeye salmon, an endangered species listed that year. The hatchery's mission shifted to preserving the species and its genetic diversity through the development of eight broodstocks derived from smolts, anadromous adults, and residual populations.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
204 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP204 edges
🌲 EVERGREEN4 edges
0.650
acquisitionagencyboardconstructioncreatedeconomicfederalgovernmentindependentjurisdictionmattersraterelevantservessubjecttraffictransportationwater
SHARED TOKENS (18): "acquisition", "agency", "board", "construction", "created", "economic", "federal", "government", "independent", "jurisdiction", "matters", "rate", "relevant", "serves", "subject", "traffic", "transportation", "water". | URL->B (1): http://www.stb.gov/. | EXACT TITLE in transportation_infrastructure: "Surface Transportation Board".
0.650
adaagencyboisecanyonfixed-routeidahooperatesproviderpublicregionalschoolservingtransittreasurevalleyvrt
SHARED TOKENS (16): "ada", "agency", "boise", "canyon", "fixed-route", "idaho", "operates", "provider", "public", "regional", "school", "serving", "transit", "treasure", "valley", "vrt". | URL->B (1): https://valleyregionaltransit.org/routes/. | EXACT TITLE in procurement_public_spending: "Valley Regional Transit". | EXACT TITLE in transportation_infrastructure: "Valley Regional Transit".
0.650
acquisitionadministrationairportairportsamericanaviationcommercialcostsefficiencyfederalfiscalfundingfundsgeneralgrantgrantsimprovementlandpercentplanning
SHARED TOKENS (25): "acquisition", "administration", "airport", "airports", "american", "aviation", "commercial", "costs", "efficiency", "federal", "fiscal", "funding", "funds", "general", "grant", "grants", "improvement", "land", "percent", "planning".... | URL->B (1): https://www.faa.gov/airports/aip/. | EXACT TITLE in transportation_infrastructure: "Airport Improvement Program".
0.650
Vanpool ↗ Q17088425 EXACT TITLE
achdadaadditionalagenciesamonganotherauthoritiesauthoritybestboisecanyoncapacitycapitalcentercitiesconventionalcostcostsdemanddistrict
SHARED TOKENS (77): "achd", "ada", "additional", "agencies", "among", "another", "authorities", "authority", "best", "boise", "canyon", "capacity", "capital", "center", "cities", "conventional", "cost", "costs", "demand", "district".... | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in transportation_infrastructure: "Vanpool".
🌿 BRANCH155 edges
0.590
achdadaagencycountywidedistrictentityestablishedgardengovernmenthighwayidahoindependent
SHARED TOKENS (12): "achd", "ada", "agency", "countywide", "district", "entity", "established", "garden", "government", "highway", "idaho", "independent". | URL->B (1): http://www.commuteride.com/. | EXACT TITLE in procurement_public_spending: "Ada County Highway District". | EXACT TITLE in transportation_infrastructure: "Ada County Highway District".
0.530
agencycreatedcreatingdepartmentidaholawmunicipalpublicstatewide
SHARED TOKENS (9): "agency", "created", "creating", "department", "idaho", "law", "municipal", "public", "statewide". | URL->B (1): http://www.isp.idaho.gov/. | EXACT TITLE in transportation_infrastructure: "Idaho State Police".
0.500
Road ↗ Q34442 EXACT TITLE
accessanotherdesigndistinctionlandlocalmovementpathspavementprivatepublicroadroadstrafficurbanwhose
SHARED TOKENS (16): "access", "another", "design", "distinction", "land", "local", "movement", "paths", "pavement", "private", "public", "road", "roads", "traffic", "urban", "whose". | EXACT TITLE in procurement_public_spending: "Road". | EXACT TITLE in transportation_infrastructure: "Road".
0.500
assetassociatedbuildingbuildingsconstructiondesigndevelopmenteconomicexpenditureextendfacilitiesindustrialinfrastructuremaintenancepercentplanningprocessproductswork
SHARED TOKENS (19): "asset", "associated", "building", "buildings", "construction", "design", "development", "economic", "expenditure", "extend", "facilities", "industrial", "infrastructure", "maintenance", "percent", "planning", "process", "products", "work". | EXACT TITLE in procurement_public_spending: "Construction". | EXACT TITLE in transportation_infrastructure: "Construction".
0.500
Culvert ↗ Q4168092 EXACT TITLE
allowingdrainageembeddedhighwayitselfmaterialneedperformanceprocessrequirementsroadroadsroadwayselectionshapestructuretrafficvehiclewater
SHARED TOKENS (19): "allowing", "drainage", "embedded", "highway", "itself", "material", "need", "performance", "process", "requirements", "road", "roads", "roadway", "selection", "shape", "structure", "traffic", "vehicle", "water". | EXACT TITLE in transportation_infrastructure: "Culvert".
0.500
Inventory ↗ Q815410 EXACT TITLE
americanbusinessbusinessescompletiondifferentfacilitygoalinformationinventorymanagementmaterialsnetworkplannedprocessproductsprojectsshapesupplysystemsystems
SHARED TOKENS (21): "american", "business", "businesses", "completion", "different", "facility", "goal", "information", "inventory", "management", "materials", "network", "planned", "process", "products", "projects", "shape", "supply", "system", "systems".... | EXACT TITLE in procurement_public_spending: "Inventory". | EXACT TITLE in transportation_infrastructure: "Inventory".
0.500
associationcreatedenvironmentalespeciallyindustriallandlandscapemobilitymultipleparksrightsruralservesurbanusersutility
SHARED TOKENS (16): "association", "created", "environmental", "especially", "industrial", "land", "landscape", "mobility", "multiple", "parks", "rights", "rural", "serves", "urban", "users", "utility". | EXACT TITLE in transportation_infrastructure: "Greenway (landscape)".
0.500
airportairportsaviationcanyoncivilconstructionemergencyfaageneralhomeidahoindustrialintegratedmissionmunicipalnampanationalplanprivatepublic
SHARED TOKENS (22): "airport", "airports", "aviation", "canyon", "civil", "construction", "emergency", "faa", "general", "home", "idaho", "industrial", "integrated", "mission", "municipal", "nampa", "national", "plan", "private", "public".... | EXACT TITLE in transportation_infrastructure: "Nampa Municipal Airport".
0.500
americanbillionbuildingconstructioncontractordevelopersgeneralinformationlaborlargelegallylicensingmanagementprojectprojectsrequirementsresponsiblesmallthroughoutwork
SHARED TOKENS (20): "american", "billion", "building", "construction", "contractor", "developers", "general", "information", "labor", "large", "legally", "licensing", "management", "project", "projects", "requirements", "responsible", "small", "throughout", "work". | EXACT TITLE in procurement_public_spending: "General contractor". | EXACT TITLE in transportation_infrastructure: "General contractor".
0.500
accordingamonganotherapplycomprehensivecontroldatadecisionsdesigndevelopmentengineeringevaluatedevenfinancefinancialfixedhealthidentifyingimpactimprovement
SHARED TOKENS (48): "according", "among", "another", "apply", "comprehensive", "control", "data", "decisions", "design", "development", "engineering", "evaluated", "even", "finance", "financial", "fixed", "health", "identifying", "impact", "improvement".... | EXACT TITLE in procurement_public_spending: "Risk management".
0.500
activityagenciesassetsboardbodiesbusinesscomplianceconsultingcontrolcontrolsdatadepartmentsefficiencyestablishexecutivefederalfinancialgoalgovernancegoverning
SHARED TOKENS (46): "activity", "agencies", "assets", "board", "bodies", "business", "compliance", "consulting", "control", "controls", "data", "departments", "efficiency", "establish", "executive", "federal", "financial", "goal", "governance", "governing".... | EXACT TITLE in procurement_public_spending: "Internal audit".
0.500
alongsideanalysisappliesbuildingbusinesscapitalcommercialcompletionconstructioncontrolcostdesignfirmsgoalinfrastructureknowledgemanagementmanagersmethodobjectives
SHARED TOKENS (29): "alongside", "analysis", "applies", "building", "business", "capital", "commercial", "completion", "construction", "control", "cost", "design", "firms", "goal", "infrastructure", "knowledge", "management", "managers", "method", "objectives".... | EXACT TITLE in procurement_public_spending: "Construction management".
0.500
applicablebuildingcentercommercialdedicateddeliverydemanddestinationsdirectlydistributionequipmentfacilityfirmsinventorylaborlargelogisticsmarketnetworkoperate
SHARED TOKENS (33): "applicable", "building", "center", "commercial", "dedicated", "delivery", "demand", "destinations", "directly", "distribution", "equipment", "facility", "firms", "inventory", "labor", "large", "logistics", "market", "network", "operate".... | EXACT TITLE in transportation_infrastructure: "Distribution center".
0.500
Zoning ↗ Q702232 EXACT TITLE
allowingbuildingbuildingsdeterminedevelopmentdifferentdiffersformgoverngovernmentgovernmentsgrowthindustriallandland-uselocalmethodplanningpolicyproperty
SHARED TOKENS (26): "allowing", "building", "buildings", "determine", "development", "different", "differs", "form", "govern", "government", "governments", "growth", "industrial", "land", "land-use", "local", "method", "planning", "policy", "property".... | EXACT TITLE in transportation_infrastructure: "Zoning".
0.500
commercialconditionscontroldocumentformissueditselfplacedplanningpricesproductspurchasingresourcesupplierssystem
SHARED TOKENS (15): "commercial", "conditions", "control", "document", "form", "issued", "itself", "placed", "planning", "prices", "products", "purchasing", "resource", "suppliers", "system". | EXACT TITLE in procurement_public_spending: "Purchase order".
0.500
accessactauthoritiescomprehensivecontinuingcooperativecreatedexistingfederalfederal-aidfederallyfundingfundsgovernedgovernmenthighwaylawlocalparticipationplanning
SHARED TOKENS (30): "access", "act", "authorities", "comprehensive", "continuing", "cooperative", "created", "existing", "federal", "federal-aid", "federally", "funding", "funds", "governed", "government", "highway", "law", "local", "participation", "planning".... | EXACT TITLE in transportation_infrastructure: "Metropolitan planning organization".
0.500
Architect ↗ Q42973 EXACT TITLE
academicarchitecturebuildingsconnectionconstructiondecisionsdesigndevelopmenteducationformalinstitutionsjurisdictionlicensemeansplansprincipalprofessionalprovidepublicrequirements
SHARED TOKENS (25): "academic", "architecture", "buildings", "connection", "construction", "decisions", "design", "development", "education", "formal", "institutions", "jurisdiction", "license", "means", "plans", "principal", "professional", "provide", "public", "requirements".... | EXACT TITLE in procurement_public_spending: "Architect". | EXACT TITLE in transportation_infrastructure: "Architect".
0.500
Broadband ↗ Q194163 EXACT TITLE
accessdatadifferentdigitalhighimplementationintegratednetworkplannedproviderequirementssignalstechnologytelecommunicationstransferuses
SHARED TOKENS (16): "access", "data", "different", "digital", "high", "implementation", "integrated", "network", "planned", "provide", "requirements", "signals", "technology", "telecommunications", "transfer", "uses". | EXACT TITLE in transportation_infrastructure: "Broadband".
0.500
broadercitiescomprehensivecoveringdevelopmenteconomicenvironmentalgrowthindividualindustrialinfrastructurelandland-uselargerlawsmanagementnationalneedsnetworkplanning
SHARED TOKENS (34): "broader", "cities", "comprehensive", "covering", "development", "economic", "environmental", "growth", "individual", "industrial", "infrastructure", "land", "land-use", "larger", "laws", "management", "national", "needs", "network", "planning".... | EXACT TITLE in procurement_public_spending: "Regional planning". | EXACT TITLE in transportation_infrastructure: "Regional planning".
0.500
agriculturalalongsidebillionchoicesconcentrateddevelopmentdirectenvironmentenvironmentalfreegroupgrowthhighimpactincreaseindividuallimitedmedicalmillionpolicy
SHARED TOKENS (29): "agricultural", "alongside", "billion", "choices", "concentrated", "development", "direct", "environment", "environmental", "free", "group", "growth", "high", "impact", "increase", "individual", "limited", "medical", "million", "policy".... | EXACT TITLE in procurement_public_spending: "Population growth". | EXACT TITLE in transportation_infrastructure: "Population growth".
0.500
Tort ↗ Q158970 EXACT TITLE
actcivilcodecodesestablishedinfluencejurisdictionslawlegalliabilitymultipleobligationsprovisionsratherresultingrulesseparatesystems
SHARED TOKENS (18): "act", "civil", "code", "codes", "established", "influence", "jurisdictions", "law", "legal", "liability", "multiple", "obligations", "provisions", "rather", "resulting", "rules", "separate", "systems". | EXACT TITLE in procurement_public_spending: "Tort".
0.500
additionalapprovalbudgetcentralcorporationeconomiceducationentityexpenditurefeesfinancialfiscalfundsgovernmenthealthcareindividualinfrastructureinstitutionsitselflaw
SHARED TOKENS (27): "additional", "approval", "budget", "central", "corporation", "economic", "education", "entity", "expenditure", "fees", "financial", "fiscal", "funds", "government", "healthcare", "individual", "infrastructure", "institutions", "itself", "law".... | EXACT TITLE in procurement_public_spending: "Government budget".
0.500
abilityaccessamericanamongbestbusinessescapacitychangescitiescompetedevelopersdevelopmenteconomiceducationequityevaluatedformformalgovernmenthistorically
SHARED TOKENS (49): "ability", "access", "american", "among", "best", "businesses", "capacity", "changes", "cities", "compete", "developers", "development", "economic", "education", "equity", "evaluated", "form", "formal", "government", "historically".... | EXACT TITLE in transportation_infrastructure: "Workforce development".
0.500
accordingdescribesdevelopmenteconomicespeciallygrowthhistoricallyindividualinfrastructurelocalmarketobjectivespoliciespolicyprocessqualityregiontermswest
SHARED TOKENS (19): "according", "describes", "development", "economic", "especially", "growth", "historically", "individual", "infrastructure", "local", "market", "objectives", "policies", "policy", "process", "quality", "region", "terms", "west". | EXACT TITLE in transportation_infrastructure: "Economic development".
0.500
Accounting ↗ Q4116214 EXACT TITLE
analysisboardbodiesbusinessbusinessescostcouncileconomicentitiesfinancialfirmsfunctionshistoryinformationmajormanagementoperationsorganizationsplanspractitioners
SHARED TOKENS (33): "analysis", "board", "bodies", "business", "businesses", "cost", "council", "economic", "entities", "financial", "firms", "functions", "history", "information", "major", "management", "operations", "organizations", "plans", "practitioners".... | EXACT TITLE in procurement_public_spending: "Accounting".
0.500
chaincomplexcreatingdirectdirectlydistributionefficiencyfacilitiesindependentlogisticsmanagementmaterialsnetworkproductsstructuresupplierssupplysystemsystemsthem
SHARED TOKENS (21): "chain", "complex", "creating", "direct", "directly", "distribution", "efficiency", "facilities", "independent", "logistics", "management", "materials", "network", "products", "structure", "suppliers", "supply", "system", "systems", "them".... | EXACT TITLE in procurement_public_spending: "Supply chain". | EXACT TITLE in transportation_infrastructure: "Supply chain".
0.500
acquiredacquisitionsadditionalairlinesdestinationsformhistoryindependentlatermajornetworkoperatesoperatingprincipalregionalstarthroughout
SHARED TOKENS (17): "acquired", "acquisitions", "additional", "airlines", "destinations", "form", "history", "independent", "later", "major", "network", "operates", "operating", "principal", "regional", "star", "throughout". | EXACT TITLE in transportation_infrastructure: "United Airlines".
0.500
Airport ↗ Q1248784 EXACT TITLE
activeairportairportsaviationbridgesbuildingscommercialcomplexcontrolemergencyenvironmentalfacilitiesfacilitygeneralinfrastructurelandlargelargerlocalmajor
SHARED TOKENS (36): "active", "airport", "airports", "aviation", "bridges", "buildings", "commercial", "complex", "control", "emergency", "environmental", "facilities", "facility", "general", "infrastructure", "land", "large", "larger", "local", "major".... | EXACT TITLE in procurement_public_spending: "Airport". | EXACT TITLE in transportation_infrastructure: "Airport".
0.500
administrationagencyairportairportsapproximatelyauthoritybillionbudgetcombinedconnectingcreateddatadepartmentfacilitiesfederalfiscalgovernmentlawlocalmission
SHARED TOKENS (36): "administration", "agency", "airport", "airports", "approximately", "authority", "billion", "budget", "combined", "connecting", "created", "data", "department", "facilities", "federal", "fiscal", "government", "law", "local", "mission".... | EXACT TITLE in transportation_infrastructure: "Transportation Security Administration".
0.500
administrationagenciesagencyassistancedepartmentdistrictexistingfederalfinancialfunctionsgovernmentgrantslocalofficeoperateoperatorsprogramspublicregionalrequirements
SHARED TOKENS (27): "administration", "agencies", "agency", "assistance", "department", "district", "existing", "federal", "financial", "functions", "government", "grants", "local", "office", "operate", "operators", "programs", "public", "regional", "requirements".... | EXACT TITLE in transportation_infrastructure: "Federal Transit Administration".
0.500
Procurement ↗ Q829492 EXACT TITLE
acquisitionactivityadoptedagencybestbodiesbusinesscompetitiveconcerningdecisionsdeliveryexposuregovernmentintendedopenorganizationalpracticespricesprocessprocure
SHARED TOKENS (31): "acquisition", "activity", "adopted", "agency", "best", "bodies", "business", "competitive", "concerning", "decisions", "delivery", "exposure", "government", "intended", "open", "organizational", "practices", "prices", "process", "procure".... | EXACT TITLE in procurement_public_spending: "Procurement". | EXACT TITLE in transportation_infrastructure: "Procurement".
0.500
airportsanalyticalbridgesbudgetbuildingscivilconstructioncostsdesigneducationengineeringengineersfacilitiesinfrastructuremanagementmethodsoperationspersonnelplanningprocedures
SHARED TOKENS (30): "airports", "analytical", "bridges", "budget", "buildings", "civil", "construction", "costs", "design", "education", "engineering", "engineers", "facilities", "infrastructure", "management", "methods", "operations", "personnel", "planning", "procedures".... | EXACT TITLE in procurement_public_spending: "Construction engineering".
0.500
academicanalysisarchitectureassociatedbecomecapabilitycompletecreateengineeringenvironmentfieldformalfundinggeneralgenerategrowthhistoryintelligenceinterestknowledge
SHARED TOKENS (36): "academic", "analysis", "architecture", "associated", "become", "capability", "complete", "create", "engineering", "environment", "field", "formal", "funding", "general", "generate", "growth", "history", "intelligence", "interest", "knowledge".... | EXACT TITLE in procurement_public_spending: "Artificial intelligence".
0.500
constructioncontroldescribedengineerequipmentfunctionsindustrialinformationinvolvinglaborlargemobileoperationsotherwisepowersourcestructuresystemsusesvehicles
SHARED TOKENS (20): "construction", "control", "described", "engineer", "equipment", "functions", "industrial", "information", "involving", "labor", "large", "mobile", "operations", "otherwise", "power", "source", "structure", "systems", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Heavy equipment".
0.500
Pedestrian ↗ Q221488 EXACT TITLE
americanassociatedcitiescreatingdesignatedhistoricallymobilitynetworkpathspavementprofessionalrecordroadsruralsafetytrafficurbanvehicles
SHARED TOKENS (18): "american", "associated", "cities", "creating", "designated", "historically", "mobility", "network", "paths", "pavement", "professional", "record", "roads", "rural", "safety", "traffic", "urban", "vehicles". | EXACT TITLE in transportation_infrastructure: "Pedestrian".
0.500
associatedbeyonddatadevelopmententitiesgraphhistoricallyknowledgemodelopenoperateprojectsrelationshipsrepresentationresearchscopesystemsuses
SHARED TOKENS (18): "associated", "beyond", "data", "development", "entities", "graph", "historically", "knowledge", "model", "open", "operate", "projects", "relationships", "representation", "research", "scope", "systems", "uses". | EXACT TITLE in procurement_public_spending: "Knowledge graph". | EXACT TITLE in transportation_infrastructure: "Knowledge graph".
0.500
airportsdepartmentefficiencyfacilitiesfederalfundshighwayidentifiedimprovingindividuallocalmajornationalnetworkorganizationspipelineplanningroadssafetyserving
SHARED TOKENS (24): "airports", "department", "efficiency", "facilities", "federal", "funds", "highway", "identified", "improving", "individual", "local", "major", "national", "network", "organizations", "pipeline", "planning", "roads", "safety", "serving".... | EXACT TITLE in transportation_infrastructure: "National Highway System (United States)".
0.500
anotherbusinesscontractorcostsexistinggeneralitselflowerneedobligationsprimeprocurementprojectpublicreceivereducerulessmallspecificsupport
SHARED TOKENS (20): "another", "business", "contractor", "costs", "existing", "general", "itself", "lower", "need", "obligations", "prime", "procurement", "project", "public", "receive", "reduce", "rules", "small", "specific", "support". | EXACT TITLE in procurement_public_spending: "Subcontractor".
0.500
accordingamericanauthoritycitiescivilconcentratedconsolidatedcountiesdifferentdistrictdistrictsentitiesexistingformgovernmentgovernmentsindependentlawlegallylocal
SHARED TOKENS (30): "according", "american", "authority", "cities", "civil", "concentrated", "consolidated", "counties", "different", "district", "districts", "entities", "existing", "form", "government", "governments", "independent", "law", "legally", "local".... | EXACT TITLE in procurement_public_spending: "County (United States)". | EXACT TITLE in transportation_infrastructure: "County (United States)".
0.500
Contract ↗ Q93288 EXACT TITLE
adoptionagreementagreementsapplybusinesscategorycivilcodecommercialcontractingcontractsdifferentdistinctdistinctiondocumentestablishingeventfieldframeworkgeneral
SHARED TOKENS (41): "adoption", "agreement", "agreements", "apply", "business", "category", "civil", "code", "commercial", "contracting", "contracts", "different", "distinct", "distinction", "document", "establishing", "event", "field", "framework", "general".... | EXACT TITLE in procurement_public_spending: "Contract". | EXACT TITLE in transportation_infrastructure: "Contract".
0.500
actadministrationagenciesagencyassistancecivilcreateddepartmentdevelopmentfederalfinancialgovernmentmanagementnationaloperatespolicyprogramsprovidepublicresearch
SHARED TOKENS (24): "act", "administration", "agencies", "agency", "assistance", "civil", "created", "department", "development", "federal", "financial", "government", "management", "national", "operates", "policy", "programs", "provide", "public", "research".... | EXACT TITLE in transportation_infrastructure: "Federal Railroad Administration".
0.500
accordinganalysisarchitecturebuildingclassificationcodescomplianceconstructiondesignenvironmentalfieldhealthinventorylandlandscapemanagementplanplanningpolicyquality
SHARED TOKENS (22): "according", "analysis", "architecture", "building", "classification", "codes", "compliance", "construction", "design", "environmental", "field", "health", "inventory", "land", "landscape", "management", "plan", "planning", "policy", "quality".... | EXACT TITLE in procurement_public_spending: "Landscape architect". | EXACT TITLE in transportation_infrastructure: "Landscape architect".
0.500
actadministeredagencyassistancechangescontrolcoordinationdirectlyengineersenvironmentalfederalformfundinggoverninggovernmentsimplementingimprovementinvolvinglawlaws
SHARED TOKENS (32): "act", "administered", "agency", "assistance", "changes", "control", "coordination", "directly", "engineers", "environmental", "federal", "form", "funding", "governing", "governments", "implementing", "improvement", "involving", "law", "laws".... | EXACT TITLE in transportation_infrastructure: "Clean Water Act".
0.500
associatedcomplexdemandeconomicemergencyformalgovernmenthomehousingindexlocalmarketsmediannationalownershipresponsesupply
SHARED TOKENS (17): "associated", "complex", "demand", "economic", "emergency", "formal", "government", "home", "housing", "index", "local", "markets", "median", "national", "ownership", "response", "supply". | EXACT TITLE in procurement_public_spending: "Affordable housing".
0.500
approvalsbusinesscreateddatadepartmentdistinctdocumentsfinancialformallegalliabilityprocessprocessingrequirementsresponsibilityreviewseekingsupplierssupplysystem
SHARED TOKENS (20): "approvals", "business", "created", "data", "department", "distinct", "documents", "financial", "formal", "legal", "liability", "process", "processing", "requirements", "responsibility", "review", "seeking", "suppliers", "supply", "system". | EXACT TITLE in procurement_public_spending: "Accounts payable".
0.500
accordingactadministrationannualapplyassetsauthoritiesauthorizationbusinessbusinessescertificationconveniencecorporationfewergovernmenthomeinspectionlargelicensemedical
SHARED TOKENS (37): "according", "act", "administration", "annual", "apply", "assets", "authorities", "authorization", "business", "businesses", "certification", "convenience", "corporation", "fewer", "government", "home", "inspection", "large", "license", "medical".... | EXACT TITLE in procurement_public_spending: "Small business".
0.500
abilityagencyagreementapproximatelyauthoritybestbusinessescapableconstructioncontractsdirecteconomiceconomyestimatedgovernmentgovernmentsgroupgrowthlawslocal
SHARED TOKENS (38): "ability", "agency", "agreement", "approximately", "authority", "best", "businesses", "capable", "construction", "contracts", "direct", "economic", "economy", "estimated", "government", "governments", "group", "growth", "laws", "local".... | EXACT TITLE in procurement_public_spending: "Government procurement".
0.500
Irrigation ↗ Q11453 EXACT TITLE
agriculturalagricultureapplicationappliescentralchangesconditionsconsolidationcontrolcontrolleddirectlydistributeddistributiondownstreamdrainageenvironmentalfieldformgrowthhigh
SHARED TOKENS (40): "agricultural", "agriculture", "application", "applies", "central", "changes", "conditions", "consolidation", "control", "controlled", "directly", "distributed", "distribution", "downstream", "drainage", "environmental", "field", "form", "growth", "high".... | EXACT TITLE in transportation_infrastructure: "Irrigation".
0.500
accessallowingdatadevelopersdevelopmentdigitalformindependentindividualinformationmeansmediaphysicalpowersignalssingletechnologytelecommunicationsusers
SHARED TOKENS (19): "access", "allowing", "data", "developers", "development", "digital", "form", "independent", "individual", "information", "means", "media", "physical", "power", "signals", "single", "technology", "telecommunications", "users". | EXACT TITLE in procurement_public_spending: "Telecommunications". | EXACT TITLE in transportation_infrastructure: "Telecommunications".
0.500
activebusinesscapitalcategorychangescontroldescribeddevelopmentequityfinancefinancialfirmsfundsgenerallimitedmanagementoperationalotherwiseownershipprivate
SHARED TOKENS (28): "active", "business", "capital", "category", "changes", "control", "described", "development", "equity", "finance", "financial", "firms", "funds", "general", "limited", "management", "operational", "otherwise", "ownership", "private".... | EXACT TITLE in transportation_infrastructure: "Private equity".
0.500
americanapproximatelybackbillionboarddailygroupmajormediamovenationaloperatingoperationsprivatelyregionrevenueservingsouthwestsubsidiaries
SHARED TOKENS (19): "american", "approximately", "back", "billion", "board", "daily", "group", "major", "media", "move", "national", "operating", "operations", "privately", "region", "revenue", "serving", "southwest", "subsidiaries". | EXACT TITLE in procurement_public_spending: "Cox Enterprises".
0.500
Warehouse ↗ Q181623 EXACT TITLE
agricultureairportsassociatedbuildingbuildingsbusinessescitiesdirectlyfacilityindustriallargemanufacturersmaterialsparksplaced
SHARED TOKENS (15): "agriculture", "airports", "associated", "building", "buildings", "businesses", "cities", "directly", "facility", "industrial", "large", "manufacturers", "materials", "parks", "placed". | EXACT TITLE in transportation_infrastructure: "Warehouse".
0.500
Amtrak ↗ Q23239 EXACT TITLE
additionalamericanapproximatelybillionboardbusinesscorporationdailydirectlyexecutivefederalfiscallimitedmilesmillionnationalnearlynetworkoperateoperates
SHARED TOKENS (26): "additional", "american", "approximately", "billion", "board", "business", "corporation", "daily", "directly", "executive", "federal", "fiscal", "limited", "miles", "million", "national", "nearly", "network", "operate", "operates".... | EXACT TITLE in transportation_infrastructure: "Amtrak".
0.500
Highway ↗ Q269949 EXACT TITLE
accessaccordingamericancodedesignatedgovernmenthighhighwaylandlegalmaintainsmajorprivatepublicrightsroadroadsroadwaysystemterms
SHARED TOKENS (20): "access", "according", "american", "code", "designated", "government", "high", "highway", "land", "legal", "maintains", "major", "private", "public", "rights", "road", "roads", "roadway", "system", "terms". | EXACT TITLE in procurement_public_spending: "Highway". | EXACT TITLE in transportation_infrastructure: "Highway".
0.500
auctionbestbusinesscomplexcontractorscontractscustomerdocumentfinalforminformationneedspotentialprocessprocurementqualitysubmittedsuppliers
SHARED TOKENS (18): "auction", "best", "business", "complex", "contractors", "contracts", "customer", "document", "final", "form", "information", "needs", "potential", "process", "procurement", "quality", "submitted", "suppliers". | EXACT TITLE in procurement_public_spending: "Request for proposal".
0.500
auctionbusinesscompeteeventformgovernmentopenordinarypotentialpricesprivateprocessprocurementremainsspecific
SHARED TOKENS (15): "auction", "business", "compete", "event", "form", "government", "open", "ordinary", "potential", "prices", "private", "process", "procurement", "remains", "specific". | EXACT TITLE in procurement_public_spending: "Reverse auction".
0.480
Invoice ↗ Q190581 EXACT TITLE
capitalcommercialcostsdocumentissuedlargemaximumpaymentpricesproductsstatedtermstransactionview
SHARED TOKENS (14): "capital", "commercial", "costs", "document", "issued", "large", "maximum", "payment", "prices", "products", "stated", "terms", "transaction", "view". | EXACT TITLE in procurement_public_spending: "Invoice".
0.480
bridgescontrolsdesigndifferentjurisdictionslanemajorotherwiseroadroadsseparatetrafficusesvehicles
SHARED TOKENS (14): "bridges", "controls", "design", "different", "jurisdictions", "lane", "major", "otherwise", "road", "roads", "separate", "traffic", "uses", "vehicles". | EXACT TITLE in transportation_infrastructure: "Intersection (road)".
0.460
businesscertificationentityfederal-aidgovernmenthighwaypercentprogramprovideresearchtechnologytransittransportation
SHARED TOKENS (13): "business", "certification", "entity", "federal-aid", "government", "highway", "percent", "program", "provide", "research", "technology", "transit", "transportation". | EXACT TITLE in procurement_public_spending: "Disadvantaged business enterprise".
0.460
agriculturalanotherenvironmentfacilityimpactindustrialmunicipalprocessresultingtreatmentuseswastewater
SHARED TOKENS (13): "agricultural", "another", "environment", "facility", "impact", "industrial", "municipal", "process", "resulting", "treatment", "uses", "waste", "water". | EXACT TITLE in procurement_public_spending: "Wastewater treatment".
0.400
associateddatainformationplanningprocurementpurchasingresourcestrategicsuppliersystems
SHARED TOKENS (10): "associated", "data", "information", "planning", "procurement", "purchasing", "resource", "strategic", "supplier", "systems". | EXACT TITLE in procurement_public_spending: "E-procurement".
0.400
Carahsoft ↗ Q5037630 EXACT TITLE
americanconsultingfederalgovernmentsinformationinstitutionslocalprivatelyprovidertechnology
SHARED TOKENS (10): "american", "consulting", "federal", "governments", "information", "institutions", "local", "privately", "provider", "technology". | EXACT TITLE in procurement_public_spending: "Carahsoft".
0.400
americandiffersfieldhighwaymovementroadroadssystemtrafficuses
SHARED TOKENS (10): "american", "differs", "field", "highway", "movement", "road", "roads", "system", "traffic", "uses". | EXACT TITLE in transportation_infrastructure: "Interchange (road)".
0.400
Snowplow ↗ Q14976 EXACT TITLE
especiallyintendedlargereceiveservingspecificsurfacestransportationvehiclevehicles
SHARED TOKENS (10): "especially", "intended", "large", "receive", "serving", "specific", "surfaces", "transportation", "vehicle", "vehicles". | EXACT TITLE in transportation_infrastructure: "Snowplow".
0.400
Sidewalk ↗ Q177749 EXACT TITLE
americanbuildingslandmobilitypavementprivateroadroadwaysidevehicle
SHARED TOKENS (10): "american", "buildings", "land", "mobility", "pavement", "private", "road", "roadway", "side", "vehicle". | EXACT TITLE in transportation_infrastructure: "Sidewalk".
0.380
Utility ↗ Q466707 EXACT TITLE
amongdecisiondistinctfunctionsgoalobjectiverelationshipsourceutility
SHARED TOKENS (9): "among", "decision", "distinct", "functions", "goal", "objective", "relationship", "source", "utility". | EXACT TITLE in procurement_public_spending: "Utility". | EXACT TITLE in transportation_infrastructure: "Utility".
0.360
businessdistributionidahooperatesoregonpowerregulatedutility
SHARED TOKENS (8): "business", "distribution", "idaho", "operates", "oregon", "power", "regulated", "utility". | EXACT TITLE in procurement_public_spending: "Idaho Power".
0.360
agenciesdocumentsexpectationsgovernmentinformationjurisdictionpublicrecords
SHARED TOKENS (8): "agencies", "documents", "expectations", "government", "information", "jurisdiction", "public", "records". | EXACT TITLE in procurement_public_spending: "Public records".
0.360
civilengineeringfieldinvolvingnetworktelecommunicationstraffictransportation
SHARED TOKENS (8): "civil", "engineering", "field", "involving", "network", "telecommunications", "traffic", "transportation". | EXACT TITLE in transportation_infrastructure: "Traffic engineering".
0.340
Floodplain ↗ Q193110 EXACT TITLE
agriculturalcontrolhighlandurbanvalleywater
SHARED TOKENS (7): "agricultural", "control", "high", "land", "urban", "valley", "water". | EXACT TITLE in transportation_infrastructure: "Floodplain".
0.300
activeamericananothercollegecontinuingdemandeducationevenfinancialfirmsgrowthlaborlawslegallylicenselicensinglicensuremobilityotherwisepractitioners
SHARED TOKENS (26): "active", "american", "another", "college", "continuing", "demand", "education", "even", "financial", "firms", "growth", "labor", "laws", "legally", "license", "licensing", "licensure", "mobility", "otherwise", "practitioners"....
0.300
amongbuildingbusinessescapitalchaincompetitivecontrolcostscreatingdemanddepartmentdesigndistributionexistingfunctionsholdinginformationinfrastructureintegratedintegration
SHARED TOKENS (45): "among", "building", "businesses", "capital", "chain", "competitive", "control", "costs", "creating", "demand", "department", "design", "distribution", "existing", "functions", "holding", "information", "infrastructure", "integrated", "integration"....
0.300
analysisanalyticsbusinesscomplexcompliancecontrolscostsdatadevelopmentefficiencyexpenditureimprovinginventorymanagementmonitoringplanningprocessprocurementsupplier
SHARED TOKENS (19): "analysis", "analytics", "business", "complex", "compliance", "controls", "costs", "data", "development", "efficiency", "expenditure", "improving", "inventory", "management", "monitoring", "planning", "process", "procurement", "supplier".
0.300
accesschaincostsdirectespeciallygeneralgrouphighwayintendeditselflogisticslongmaterialmaximumoperatingpracticesregionspecializedtrainstransportation
SHARED TOKENS (20): "access", "chain", "costs", "direct", "especially", "general", "group", "highway", "intended", "itself", "logistics", "long", "material", "maximum", "operating", "practices", "region", "specialized", "trains", "transportation".
0.300
administrationbusinessdatadecisionseconomiceducationemploymenthealthintelligencelawlegalmediaprocessprocessingpublicrequiringsystemstechnical
SHARED TOKENS (18): "administration", "business", "data", "decisions", "economic", "education", "employment", "health", "intelligence", "law", "legal", "media", "process", "processing", "public", "requiring", "systems", "technical".
0.300
Open data ↗ Q309901 KW CROSS HIGH
accesscapablecreateddataeducationespeciallyestablishedformgovgovernmentgrowthinstitutionsitselfknowledgelicenselicensedlongmovementopenproperty
SHARED TOKENS (24): "access", "capable", "created", "data", "education", "especially", "established", "form", "gov", "government", "growth", "institutions", "itself", "knowledge", "license", "licensed", "long", "movement", "open", "property"....
0.300
Urban sprawl ↗ Q192042 KW CROSS HIGH
agencyassociatedbecomebuildingcitiescommercialcostsdescribeddevelopmentenvironmentenvironmentalexistingformgrowthhousingindustrialinfrastructurelandlargeplanning
SHARED TOKENS (30): "agency", "associated", "become", "building", "cities", "commercial", "costs", "described", "development", "environment", "environmental", "existing", "form", "growth", "housing", "industrial", "infrastructure", "land", "large", "planning"....
0.300
agenciesapplicationbusinesscapabilityclassificationconsolidateddistributionfinancialinstitutionslabormanagementmechanismpermanentprocureprogramsreportingsignificantsystemsystemstemporary
SHARED TOKENS (21): "agencies", "application", "business", "capability", "classification", "consolidated", "distribution", "financial", "institutions", "labor", "management", "mechanism", "permanent", "procure", "programs", "reporting", "significant", "system", "systems", "temporary"....
0.300
Temporary work ↗ Q667944 KW CROSS HIGH
agencyanotherconsultantscontractsdevelopmentdifferenteconomyemployeeemploymentengineeringfindinghealthindividualinsurancelaborlimitedmarketneedneedsorganizations
SHARED TOKENS (32): "agency", "another", "consultants", "contracts", "development", "different", "economy", "employee", "employment", "engineering", "finding", "health", "individual", "insurance", "labor", "limited", "market", "need", "needs", "organizations"....
0.300
Auto mechanic ↗ Q706835 KW CROSS HIGH
approvalconditionsdeterminedigitalindependentinspectionmaintenanceneedsproposedroleshowingspecifictechnicianvehiclework
SHARED TOKENS (15): "approval", "conditions", "determine", "digital", "independent", "inspection", "maintenance", "needs", "proposed", "role", "showing", "specific", "technician", "vehicle", "work".
0.300
Roundabout ↗ Q1525 KW CROSS HIGH
associatedbecomecentraldesignengineersenvironmentimprovementincreaseintegrationlowermakesneedreducerequireresearchresultingroadrulessafetysignals
SHARED TOKENS (26): "associated", "become", "central", "design", "engineers", "environment", "improvement", "increase", "integration", "lower", "makes", "need", "reduce", "require", "research", "resulting", "road", "rules", "safety", "signals"....
0.300
accordingcontractorsemploymentformindependentlaborlimitedmultiplenearlypaymentrelationshipsecuritysubstantialtemporaryworkworkersworkforce
SHARED TOKENS (17): "according", "contractors", "employment", "form", "independent", "labor", "limited", "multiple", "nearly", "payment", "relationship", "security", "substantial", "temporary", "work", "workers", "workforce".
0.300
accordingcreatingdemanddisabilityfixedformfunctionsmedicalmobilemovementneedsnetworknon-emergencyparatransitprivateprogramsprovidepublicratherrelevant
SHARED TOKENS (26): "according", "creating", "demand", "disability", "fixed", "form", "functions", "medical", "mobile", "movement", "needs", "network", "non-emergency", "paratransit", "private", "programs", "provide", "public", "rather", "relevant"....
0.300
abilitydifferentemergencyfederalgovernmentslocalmanagementneedsorganizationsprofessionalrecoveryreducerequiresrescueresponseterms
SHARED TOKENS (16): "ability", "different", "emergency", "federal", "governments", "local", "management", "needs", "organizations", "professional", "recovery", "reduce", "requires", "rescue", "response", "terms".
0.300
administrationagreementsamonganalysisbusinesschangescommercialcomplexcomplianceconditionsconstructionconsultantscontractsdocumentingexposurefinancialimplementationimprovementslargerlegal
SHARED TOKENS (41): "administration", "agreements", "among", "analysis", "business", "changes", "commercial", "complex", "compliance", "conditions", "construction", "consultants", "contracts", "documenting", "exposure", "financial", "implementation", "improvements", "larger", "legal"....
0.300
actbusinesscompliancecontrolcontrolsefficiencyentitiesfinancialimprovementslawsmanagementmeansobjectiveobjectivesoperationalorganizationalpaymentsphysicalpoliciespractices
SHARED TOKENS (32): "act", "business", "compliance", "control", "controls", "efficiency", "entities", "financial", "improvements", "laws", "management", "means", "objective", "objectives", "operational", "organizational", "payments", "physical", "policies", "practices"....
0.300
americanbusinessescentralchangescitiesdevelopmenteconomicenvironmentalgrowthmodelmovementpatternsplannedpopulationprocessresidentsruralurban
SHARED TOKENS (18): "american", "businesses", "central", "changes", "cities", "development", "economic", "environmental", "growth", "model", "movement", "patterns", "planned", "population", "process", "residents", "rural", "urban".
0.300
activeagenciesassociatedbusinessescapacitycompetitivedeterminedistributioneconomicemploymententryexistingfirmshighindustriallandlawmarketpowerprices
SHARED TOKENS (29): "active", "agencies", "associated", "businesses", "capacity", "competitive", "determine", "distribution", "economic", "employment", "entry", "existing", "firms", "high", "industrial", "land", "law", "market", "power", "prices"....
0.300
additionalapplicationavailabilitycategorycostdeliverydevelopmentdistinguisheconomyefficiencyenvironmentfeefeesforminfrastructurelicensemodeloperatingownershipphysical
SHARED TOKENS (29): "additional", "application", "availability", "category", "cost", "delivery", "development", "distinguish", "economy", "efficiency", "environment", "fee", "fees", "form", "infrastructure", "license", "model", "operating", "ownership", "physical"....
0.300
Road safety ↗ Q1147899 KW CROSS HIGH
bestclassescontroleventhealthidentifiedimpactimprovingmethodsoccupationalpracticesproducepublicrequiringroadroadsruralsafetysidespecific
SHARED TOKENS (28): "best", "classes", "control", "event", "health", "identified", "impact", "improving", "methods", "occupational", "practices", "produce", "public", "requiring", "road", "roads", "rural", "safety", "side", "specific"....
0.300
buildingbusinesscentercentraldedicateddevelopmentformgrowthincreaseintegratedlandnetworkplanningprivatepublicrelationshipservingtransiturban
SHARED TOKENS (19): "building", "business", "center", "central", "dedicated", "development", "form", "growth", "increase", "integrated", "land", "network", "planning", "private", "public", "relationship", "serving", "transit", "urban".
0.300
anotherbecomechaincomplexconsolidationcorporationdescribeddifferentdirectlyeconomyfinalfreeintegratedintegrationlargemakingmanagementmarketmethodneed
SHARED TOKENS (29): "another", "become", "chain", "complex", "consolidation", "corporation", "described", "different", "directly", "economy", "final", "free", "integrated", "integration", "large", "making", "management", "market", "method", "need"....
0.300
activityadministrationagenciesanotherbodieschangescivilcontrolcreateddecisionsdivisioneconomiceducationenvironmentenvironmentalexecutiveexpandedgoverninggovernmentincrease
SHARED TOKENS (32): "activity", "administration", "agencies", "another", "bodies", "changes", "civil", "control", "created", "decisions", "division", "economic", "education", "environment", "environmental", "executive", "expanded", "governing", "government", "increase"....
0.300
acquisitionbusinesscapitalchangescreatecurrentdirectlydistributioneconomyeducationemergencyemploymententryestablishesexpenditurefeesfinalfirmsfiscalgovernment
SHARED TOKENS (43): "acquisition", "business", "capital", "changes", "create", "current", "directly", "distribution", "economy", "education", "emergency", "employment", "entry", "establishes", "expenditure", "fees", "final", "firms", "fiscal", "government"....
0.300
abilityadditionalanalysisanotherassistancebecomebestconsultantsconsultingdescriptiondevelopmenteconomicexposurefirmsfunctionsgeneralimplementationimprovementjurisdictionslegal
SHARED TOKENS (43): "ability", "additional", "analysis", "another", "assistance", "become", "best", "consultants", "consulting", "description", "development", "economic", "exposure", "firms", "functions", "general", "implementation", "improvement", "jurisdictions", "legal"....
0.300
becomechangesdesignengineeringengineersespeciallyphysicalresponsibleroadroadsrulesafetytrafficurbanuses
SHARED TOKENS (15): "become", "changes", "design", "engineering", "engineers", "especially", "physical", "responsible", "road", "roads", "rule", "safety", "traffic", "urban", "uses".
0.300
administrationagencyairlinesamericananotherbuildingcommercialconstructiondepartmentdistributiondivisioneconomyeducationenvironmentalfederalgoverninggovernshealthhighwayhome
SHARED TOKENS (51): "administration", "agency", "airlines", "american", "another", "building", "commercial", "construction", "department", "distribution", "division", "economy", "education", "environmental", "federal", "governing", "governs", "health", "highway", "home"....
0.300
budgetbuildingconstructioncontractingcontractorcontractorscostsfinancialknowledgelawprofessionalprojectprojectsqualifiedresponsiblesidesurveyorstitlework
SHARED TOKENS (19): "budget", "building", "construction", "contracting", "contractor", "contractors", "costs", "financial", "knowledge", "law", "professional", "project", "projects", "qualified", "responsible", "side", "surveyors", "title", "work".
0.300
collegeeconomiceducationformalgeneralindividualknowledgemethodspreparesprovideschoolschoolsspecializedspecifictechnicaltechnologytraining
SHARED TOKENS (17): "college", "economic", "education", "formal", "general", "individual", "knowledge", "methods", "prepares", "provide", "school", "schools", "specialized", "specific", "technical", "technology", "training".
0.300
Right of way ↗ Q17128254 KW CROSS HIGH
authoritycapablecreateddifferentfacilitygovernmenthighwaylandlegallocaloperateotherwiseownershippathsphysicalprivaterightsroadroadssimply
SHARED TOKENS (26): "authority", "capable", "created", "different", "facility", "government", "highway", "land", "legal", "local", "operate", "otherwise", "ownership", "paths", "physical", "private", "rights", "road", "roads", "simply"....
0.300
actamericanapplicableassociationauthoritybestcentralchangescitiescomprehensiveconditionscostscreatingdependsdesigndevelopmentdistrictseconomicefficiencyenvironmental
SHARED TOKENS (46): "act", "american", "applicable", "association", "authority", "best", "central", "changes", "cities", "comprehensive", "conditions", "costs", "creating", "depends", "design", "development", "districts", "economic", "efficiency", "environmental"....
0.300
Urbanization ↗ Q161078 KW CROSS HIGH
approximatelyarchitecturebecomebillioncitiescompetitivecreatecreatescurrentdescribesdevelopingdevelopmenteconomiceducationenvironmentalgenerategeographygoalgrowthhealth
SHARED TOKENS (53): "approximately", "architecture", "become", "billion", "cities", "competitive", "create", "creates", "current", "describes", "developing", "development", "economic", "education", "environmental", "generate", "geography", "goal", "growth", "health"....
0.300
Data quality ↗ Q1757694 KW CROSS HIGH
becomesbusinessesdatadecisionevenformgovernancehighinformationintendedmakingoperationsplanningqualitysignificantstandardsuses
SHARED TOKENS (17): "becomes", "businesses", "data", "decision", "even", "form", "governance", "high", "information", "intended", "making", "operations", "planning", "quality", "significant", "standards", "uses".
0.300
anotherbecomecapacitydemanddepartmentsfixedhighlanemodeledplanningpublicresultingroadroadstraffictransportationurbanvehicles
SHARED TOKENS (18): "another", "become", "capacity", "demand", "departments", "fixed", "high", "lane", "modeled", "planning", "public", "resulting", "road", "roads", "traffic", "transportation", "urban", "vehicles".
0.300
accessanotherassociatedcostcostsdifferenteconomicfinancialmanagementproceduralproductsproviderresourcesstrategicsuppliersswitchingtermsvalue
SHARED TOKENS (18): "access", "another", "associated", "cost", "costs", "different", "economic", "financial", "management", "procedural", "products", "provider", "resources", "strategic", "suppliers", "switching", "terms", "value".
0.300
alongsideamericancapacitycapitalcitiesconnectingconventionalcostdailydedicateddesignlowermajoritymillionnetworkpublicqualityreducesinglesystem
SHARED TOKENS (24): "alongside", "american", "capacity", "capital", "cities", "connecting", "conventional", "cost", "daily", "dedicated", "design", "lower", "majority", "million", "network", "public", "quality", "reduce", "single", "system"....
0.300
adoptedapplicationcapacitychangesconditionsdifferentefficiencyemergencyfieldincreaseinformationinfrastructureinterfaceslawsmanagementmobilityprovidereduceroadroads
SHARED TOKENS (28): "adopted", "application", "capacity", "changes", "conditions", "different", "efficiency", "emergency", "field", "increase", "information", "infrastructure", "interfaces", "laws", "management", "mobility", "provide", "reduce", "road", "roads"....
0.300
accordingagencyamericanbusinessbusinessescentralcertificationcontrolleddailydevelopmentfederalfirmsmillionnearlyoperatedrevenuesreviewwest
SHARED TOKENS (18): "according", "agency", "american", "business", "businesses", "central", "certification", "controlled", "daily", "development", "federal", "firms", "million", "nearly", "operated", "revenues", "review", "west".
0.300
americanappearsassistancecombinedcreateddesignatedespeciallyevenfacilitiesgovernjurisdictionslargelawslowerotherwisepointsroadroadsrulessafety
SHARED TOKENS (28): "american", "appears", "assistance", "combined", "created", "designated", "especially", "even", "facilities", "govern", "jurisdictions", "large", "laws", "lower", "otherwise", "points", "road", "roads", "rules", "safety"....
0.300
appliesapprovalassociationdecisiondecisionsdefinesdevelopmentdocumentationenvironmentalgovernedidentifyingimpactmajormakingmanagementmoveparticipationplanplanspolicies
SHARED TOKENS (35): "applies", "approval", "association", "decision", "decisions", "defines", "development", "documentation", "environmental", "governed", "identifying", "impact", "major", "making", "management", "move", "participation", "plan", "plans", "policies"....
0.300
acquisitionacquisitionsactactivityanotherassetsbusinesscapitalcentralcombinedcompetitiveconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentitiesentity
SHARED TOKENS (44): "acquisition", "acquisitions", "act", "activity", "another", "assets", "business", "capital", "central", "combined", "competitive", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entities", "entity"....
0.300
accessamericancapacitycentralchangescitiesclassconnectconnectedconnectingevenfreehighwaylimitslongmediannetworkpathsplannedplans
SHARED TOKENS (39): "access", "american", "capacity", "central", "changes", "cities", "class", "connect", "connected", "connecting", "even", "free", "highway", "limits", "long", "median", "network", "paths", "planned", "plans"....
0.300
costcostscoveragecoveredcreateddedicatedespeciallyevenexpresslygeneralgroupindividualinsurancelegalliabilitylimitsotherwisepaymentpoliciespolicy
SHARED TOKENS (26): "cost", "costs", "coverage", "covered", "created", "dedicated", "especially", "even", "expressly", "general", "group", "individual", "insurance", "legal", "liability", "limits", "otherwise", "payment", "policies", "policy"....
0.300
U.S. Route 20 ↗ Q407881 KW CROSS HIGH
caldwellgeneralhighwayidahomajormilesnationalofficialoregonparallelplannedroadroadsrulesthroughoutwestwestern
SHARED TOKENS (17): "caldwell", "general", "highway", "idaho", "major", "miles", "national", "official", "oregon", "parallel", "planned", "road", "roads", "rules", "throughout", "west", "western".
0.300
Cost estimate ↗ Q795053 KW CROSS HIGH
americanassociationcostcostsdatadefinesengineeringestablishedgovernmentindividualmethodsofficepotentialprocessprogramprojectreliablescopesinglevalue
SHARED TOKENS (20): "american", "association", "cost", "costs", "data", "defines", "engineering", "established", "government", "individual", "methods", "office", "potential", "process", "program", "project", "reliable", "scope", "single", "value".
0.300
agencydepartmenteducationemployeeengineersenvironmentalestablishingexecutivefederalfederallyfinancialgovernmentgovernmentsindependentinformationlawslegallocalmattersmonitoring
SHARED TOKENS (31): "agency", "department", "education", "employee", "engineers", "environmental", "establishing", "executive", "federal", "federally", "financial", "government", "governments", "independent", "information", "laws", "legal", "local", "matters", "monitoring"....
0.300
accessbillionbusinesscapacitycategorycollectcommercialdatadepartmentsdevelopingdevelopmentdiffersefficiencyexistingfinancefunctionsgeneralimpactinformationintegrated
SHARED TOKENS (43): "access", "billion", "business", "capacity", "category", "collect", "commercial", "data", "departments", "developing", "development", "differs", "efficiency", "existing", "finance", "functions", "general", "impact", "information", "integrated"....
0.300
abilityauthoritydecisiondescribedexecutivegovernmentjurisdictionslawspowerprocessreviewscopestatutesubjectterms
SHARED TOKENS (15): "ability", "authority", "decision", "described", "executive", "government", "jurisdictions", "laws", "power", "process", "review", "scope", "statute", "subject", "terms".
0.300
agencyassistanceauthorizedcollectivelydirecteconomicentityfederalfinancialformfundinggeneralgovernmentgrantgrantsissuedlawlocalorganizationsprivate
SHARED TOKENS (27): "agency", "assistance", "authorized", "collectively", "direct", "economic", "entity", "federal", "financial", "form", "funding", "general", "government", "grant", "grants", "issued", "law", "local", "organizations", "private"....
0.300
Snake River ↗ Q272074 KW CROSS HIGH
agenciesamericancanyoncentralcommercialconstructioncontrolcoveredcreateddownstreamgovernmentshighhistoryidaholargelimitedlonglowermajormiles
SHARED TOKENS (37): "agencies", "american", "canyon", "central", "commercial", "construction", "control", "covered", "created", "downstream", "governments", "high", "history", "idaho", "large", "limited", "long", "lower", "major", "miles"....
0.300
agenciesamonganotherauctionavailabilitybestbusinessbusinessescomparecompetitivecontractorsdeliverydeterminedifferentdocumentationdocumentsentityenvironmentfilesform
SHARED TOKENS (53): "agencies", "among", "another", "auction", "availability", "best", "business", "businesses", "compare", "competitive", "contractors", "delivery", "determine", "different", "documentation", "documents", "entity", "environment", "files", "form"....
0.300
CARES Act ↗ Q88815228 KW CROSS HIGH
actadditionaladministrationapplyappropriationsbillionbudgetbusinessbusinessesclassconsolidateddevelopmentdirecteconomicfundinggovernmentshealthhistoryimpactindividual
SHARED TOKENS (37): "act", "additional", "administration", "apply", "appropriations", "billion", "budget", "business", "businesses", "class", "consolidated", "development", "direct", "economic", "funding", "governments", "health", "history", "impact", "individual"....
0.300
departmentdevelopmentdiffersfederalfundsgoalgovernmentsgrantgrantshousinginfrastructurelocalprogramprogramsspecificstatedsubjecturban
SHARED TOKENS (18): "department", "development", "differs", "federal", "funds", "goal", "governments", "grant", "grants", "housing", "infrastructure", "local", "program", "programs", "specific", "stated", "subject", "urban".
0.300
chaincostdevelopingdevelopmentdistinctenvironmentfirmsimprovementincreaseindividualinfrastructurelabormanagementmarketneedsoperationspaymentplacedplanningprocess
SHARED TOKENS (27): "chain", "cost", "developing", "development", "distinct", "environment", "firms", "improvement", "increase", "individual", "infrastructure", "labor", "management", "market", "needs", "operations", "payment", "placed", "planning", "process"....
0.300
americandepartmentdepartmentsdirectlyeconomyexecutivefederalfiscalgovernmentmissionmovementplanreportsservingstrategicsystemtransportation
SHARED TOKENS (17): "american", "department", "departments", "directly", "economy", "executive", "federal", "fiscal", "government", "mission", "movement", "plan", "reports", "serving", "strategic", "system", "transportation".
0.300
becomesdatadependencedigitaldisruptionembeddedexpandedfieldfinancefunctionsinformationinfrastructurenetworkphysicalpowerprovidesecuritystandardssystemstechnology
SHARED TOKENS (21): "becomes", "data", "dependence", "digital", "disruption", "embedded", "expanded", "field", "finance", "functions", "information", "infrastructure", "network", "physical", "power", "provide", "security", "standards", "systems", "technology"....
0.300
administersagencydepartmentdepartmentsdevelopmentdirectlyexecutivefederalgovernmenthomehousinglawspoliciesprogramreportsurban
SHARED TOKENS (16): "administers", "agency", "department", "departments", "development", "directly", "executive", "federal", "government", "home", "housing", "laws", "policies", "program", "reports", "urban".
0.300
accordingactalongsideamericananotherappropriationsassistancebillionbudgetbusinessbusinessesclassificationconsolidateddirectdistributioneconomiceducationeligibilityestimatedexpanded
SHARED TOKENS (45): "according", "act", "alongside", "american", "another", "appropriations", "assistance", "billion", "budget", "business", "businesses", "classification", "consolidated", "direct", "distribution", "economic", "education", "eligibility", "estimated", "expanded"....
0.300
Indemnity ↗ Q708399 KW CROSS HIGH
agencyanothercontractsdifferentexpresslyforminsuranceitselflawlimitedmaximummedicalprincipalrelationshiprelevantresponsibilities
SHARED TOKENS (16): "agency", "another", "contracts", "different", "expressly", "form", "insurance", "itself", "law", "limited", "maximum", "medical", "principal", "relationship", "relevant", "responsibilities".
0.300
combinedconnectscurrentdeliverydirectdirectlydistinctdistributionefficiencyevenformhistoricallyincreaselocallonglowermajormarketmovementnetwork
SHARED TOKENS (23): "combined", "connects", "current", "delivery", "direct", "directly", "distinct", "distribution", "efficiency", "even", "form", "historically", "increase", "local", "long", "lower", "major", "market", "movement", "network"....
0.300
accessibilityactadabusinesschangescivilcostscouncilcovereddisabilityfinallaterlawnationalprotectionsprovidepublicrequirementsrequiresrights
SHARED TOKENS (21): "accessibility", "act", "ada", "business", "changes", "civil", "costs", "council", "covered", "disability", "final", "later", "law", "national", "protections", "provide", "public", "requirements", "requires", "rights"....
0.300
buildingconditionscreatesenvironmentevenhealthmaterialsoriginatedpersonnelphysicalpropertypublicsafetyspecificsubjectsystemthemtrainedwaste
SHARED TOKENS (19): "building", "conditions", "creates", "environment", "even", "health", "materials", "originated", "personnel", "physical", "property", "public", "safety", "specific", "subject", "system", "them", "trained", "waste".
0.300
billioncenterclasscorporationcreateitselflatermilesnetworkoperatesoperatingplansprincipalprojectreachreportingroadsystemtransportationwest
SHARED TOKENS (21): "billion", "center", "class", "corporation", "create", "itself", "later", "miles", "network", "operates", "operating", "plans", "principal", "project", "reach", "reporting", "road", "system", "transportation", "west"....
0.300
accessactadditionaladministrationadoptedapproximatelybillioncompleteconstructioncontrolledcostcreatingdesignestablishedfederalfederal-aidfundinggeneralgovernmenthighway
SHARED TOKENS (43): "access", "act", "additional", "administration", "adopted", "approximately", "billion", "complete", "construction", "controlled", "cost", "creating", "design", "established", "federal", "federal-aid", "funding", "general", "government", "highway"....
0.300
agenciesavailabilitybuildingbusinesscollectdecisiondeliverydevelopingdocumentdocumentsfilesfinalformgovernmentinformationinterestlegalopenpdfpotential
SHARED TOKENS (31): "agencies", "availability", "building", "business", "collect", "decision", "delivery", "developing", "document", "documents", "files", "final", "form", "government", "information", "interest", "legal", "open", "pdf", "potential"....
0.300
actactivityauctionbestbeyondbusinesscompetingcontractorscontractscostsdailydecisionsdifferenteconomicformalgovernmentincreaseissuedlegallymajority
SHARED TOKENS (41): "act", "activity", "auction", "best", "beyond", "business", "competing", "contractors", "contracts", "costs", "daily", "decisions", "different", "economic", "formal", "government", "increase", "issued", "legally", "majority"....
0.300
Urban planning ↗ Q69883 KW CROSS HIGH
accessibilityadministrationadoptedanalysisanotherarchitecturebroaderbuildingsbusinesscapitalcategorycitiescivilcodescreatingdesigndevelopingdevelopmentdifferentdistribution
SHARED TOKENS (68): "accessibility", "administration", "adopted", "analysis", "another", "architecture", "broader", "buildings", "business", "capital", "category", "cities", "civil", "codes", "creating", "design", "developing", "development", "different", "distribution"....
0.300
boardbusinesscentraldedicatedentitiesfinancialfiscalframeworkgovernmentlegalmanagementorganizationsprocesspublicpubliclyreportingresourcesspecializedstandards
SHARED TOKENS (19): "board", "business", "central", "dedicated", "entities", "financial", "fiscal", "framework", "government", "legal", "management", "organizations", "process", "public", "publicly", "reporting", "resources", "specialized", "standards".
0.300
accessbestcannotcompetecompetingcontrolcostsdifferententityespeciallyfederalgovernmentinfrastructurelargelocalmaintainsmarketmultipleoperatesproduce
SHARED TOKENS (32): "access", "best", "cannot", "compete", "competing", "control", "costs", "different", "entity", "especially", "federal", "government", "infrastructure", "large", "local", "maintains", "market", "multiple", "operates", "produce"....
0.300
actactiveadministeredagenciesapproximatelyauthorityauthorizedbillionbridgesbudgetbuildingbusinesscapacitycivilcombinedconstructioncontroldepartmentdesigndirect
SHARED TOKENS (63): "act", "active", "administered", "agencies", "approximately", "authority", "authorized", "billion", "bridges", "budget", "building", "business", "capacity", "civil", "combined", "construction", "control", "department", "design", "direct"....
0.300
actadministeredadministrationagenciesamericanappearcurrentdebtdepartmentdepartmentsestablishedexecutivefederalfinancefinancialfiscalgovernmentinstitutionslicenseslimited
SHARED TOKENS (31): "act", "administered", "administration", "agencies", "american", "appear", "current", "debt", "department", "departments", "established", "executive", "federal", "finance", "financial", "fiscal", "government", "institutions", "licenses", "limited"....
0.300
Eminent domain ↗ Q166332 KW CROSS HIGH
acquisitionanotherapplicationauthorizedbuildingsconnectdevelopmentevenexpandedfeefinalfunctionsgovernmentimpactinterestjurisdictionslandlaterlegalowners
SHARED TOKENS (37): "acquisition", "another", "application", "authorized", "buildings", "connect", "development", "even", "expanded", "fee", "final", "functions", "government", "impact", "interest", "jurisdictions", "land", "later", "legal", "owners"....
0.300
bridgescivilconstructiondesignengineeringengineershighwaymaintenancematerialspavementplanningprofessionalroadsstandardsstructuraltraffictransportation
SHARED TOKENS (17): "bridges", "civil", "construction", "design", "engineering", "engineers", "highway", "maintenance", "materials", "pavement", "planning", "professional", "roads", "standards", "structural", "traffic", "transportation".
0.300
additionalagenciesauthoritiesbusinessescontactdepartmentdevelopingemergencyfacilitieshistoricallymedicalmodelnon-emergencyoperatepatientpersonnelprovidepublicqualificationqualified
SHARED TOKENS (33): "additional", "agencies", "authorities", "businesses", "contact", "department", "developing", "emergency", "facilities", "historically", "medical", "model", "non-emergency", "operate", "patient", "personnel", "provide", "public", "qualification", "qualified"....
0.300
administrationagenciesamongchangescompliancecontrolcurrentdefinesdepartmentdesigndiffersdocumentfederalhighwayissuedlawlocalnationalopenprivately
SHARED TOKENS (30): "administration", "agencies", "among", "changes", "compliance", "control", "current", "defines", "department", "design", "differs", "document", "federal", "highway", "issued", "law", "local", "national", "open", "privately"....
0.300
Storm drain ↗ Q1139766 KW CROSS HIGH
bodiesbuildingscannotcombinedconnectdesigndrainageevenhighwayinfrastructurelargemunicipalparkspropertypublicreceiverequireroadssewersmall
SHARED TOKENS (23): "bodies", "buildings", "cannot", "combined", "connect", "design", "drainage", "even", "highway", "infrastructure", "large", "municipal", "parks", "property", "public", "receive", "require", "roads", "sewer", "small"....
0.300
Light rail ↗ Q1268865 KW CROSS HIGH
broadercapabilitycapacityconditionsdifferentformindividuallonglowermeaningmultipleoperateoperatesoperatingoperationssectionsystemsystemstechnologytraffic
SHARED TOKENS (23): "broader", "capability", "capacity", "conditions", "different", "form", "individual", "long", "lower", "meaning", "multiple", "operate", "operates", "operating", "operations", "section", "system", "systems", "technology", "traffic"....
0.300
Law enforcement ↗ KW CROSS HIGH
actactivityassociatedauthoritybackcodescollectivelygoverninggovernmentinstitutionslawlegaloperateorganizationspowerpropertypublicrecordrulessystem
SHARED TOKENS (21): "act", "activity", "associated", "authority", "back", "codes", "collectively", "governing", "government", "institutions", "law", "legal", "operate", "organizations", "power", "property", "public", "record", "rules", "system"....
0.300
addressescodecompletedatadifferentdiffersentitiesentryexistingidentifyingincompleteinformationmeansprocessprocessingqualityratherrecordsroadsystem
SHARED TOKENS (21): "addresses", "code", "complete", "data", "different", "differs", "entities", "entry", "existing", "identifying", "incomplete", "information", "means", "process", "processing", "quality", "rather", "records", "road", "system"....
0.300
accesscompletedesigneconomicengineersenvironmentalhealthhighwayhomeoperatedplannedpolicypractitionerspublicrequiressafetytraffictransportationurbanusers
SHARED TOKENS (20): "access", "complete", "design", "economic", "engineers", "environmental", "health", "highway", "home", "operated", "planned", "policy", "practitioners", "public", "requires", "safety", "traffic", "transportation", "urban", "users".
0.300
Public finance ↗ Q274490 KW CROSS HIGH
academicallocationamericanamongauthoritiescentraldecisiondirectdistributioneconomiceconomyexpenditurefieldfinanceframeworkgovernmentgovernmentsmarketpolicypublic
SHARED TOKENS (26): "academic", "allocation", "american", "among", "authorities", "central", "decision", "direct", "distribution", "economic", "economy", "expenditure", "field", "finance", "framework", "government", "governments", "market", "policy", "public"....
0.300
approximatelychangescompleteconstructioncontactcontractingcontractorcontractscostsdeliverydesignentityhistoricallegallongmastermethodprocurementprojectprojects
SHARED TOKENS (34): "approximately", "changes", "complete", "construction", "contact", "contracting", "contractor", "contracts", "costs", "delivery", "design", "entity", "historical", "legal", "long", "master", "method", "procurement", "project", "projects"....
0.300
Water supply ↗ Q1061108 KW CROSS HIGH
agriculturecapitalcommercialcostcostsdifferentfixedinstitutionallargelargerpersonnelpolicypublicqualityresponsibilityruralseparatesmallsupplysurrounding
SHARED TOKENS (25): "agriculture", "capital", "commercial", "cost", "costs", "different", "fixed", "institutional", "large", "larger", "personnel", "policy", "public", "quality", "responsibility", "rural", "separate", "small", "supply", "surrounding"....
0.300
Commuter rail ↗ Q1412403 KW CROSS HIGH
businesscentralcitiesconnectingdifferentdistrictshourmultipleoperateoperatespricingregionalsystemstrainstransiturban
SHARED TOKENS (16): "business", "central", "cities", "connecting", "different", "districts", "hour", "multiple", "operate", "operates", "pricing", "regional", "systems", "trains", "transit", "urban".
0.300
compliancecontractscostefficiencyfinancialimplementingimprovementslawlegalliabilitymanagementobligationsoperationalorganizationalreducerequirementssignificantthroughout
SHARED TOKENS (18): "compliance", "contracts", "cost", "efficiency", "financial", "implementing", "improvements", "law", "legal", "liability", "management", "obligations", "operational", "organizational", "reduce", "requirements", "significant", "throughout".
🫐 BERRY45 edges
0.280
approximatelyboisedatadistrictdistrictsevengovernmentidaholimitslowerpopulationresidentssinglesplit
SHARED TOKENS (14): "approximately", "boise", "data", "district", "districts", "even", "government", "idaho", "limits", "lower", "population", "residents", "single", "split".
0.280
anticipatedcreatingdepartmentdesignateddifferentevenmovementpathspathwayprovidesharedurbanuserusers
SHARED TOKENS (14): "anticipated", "creating", "department", "designated", "different", "even", "movement", "paths", "pathway", "provide", "shared", "urban", "user", "users".
0.280
boiseidahooperatingoregon
SHARED TOKENS (4): "boise", "idaho", "operating", "oregon". | EXACT TITLE in transportation_infrastructure: "Pioneer (train)".
0.280
accessassociatedconstructiondevelopmentdocumentsgoalgoverninggovernmentinformationinstitutionsmaintainsopenpublicpublicly
SHARED TOKENS (14): "access", "associated", "construction", "development", "documents", "goal", "governing", "government", "information", "institutions", "maintains", "open", "public", "publicly".
0.260
createengineeruses
SHARED TOKENS (3): "create", "engineer", "uses". | EXACT TITLE in transportation_infrastructure: "Diesel engine".
0.260
OpenGov ↗ Q17084399 EXACT TITLE
governmentprivatetechnology
SHARED TOKENS (3): "government", "private", "technology". | EXACT TITLE in procurement_public_spending: "OpenGov".
0.260
allocationanalysisdatadecisiondecisionsdesignindividualitselflegalmeansrelevantresponsibilityresulting
SHARED TOKENS (13): "allocation", "analysis", "data", "decision", "decisions", "design", "individual", "itself", "legal", "means", "relevant", "responsibility", "resulting".
0.260
buildingscombinedcommercialdirectlyindustrialinfrastructureseparateservingsewersystemsystemstreatmenturban
SHARED TOKENS (13): "buildings", "combined", "commercial", "directly", "industrial", "infrastructure", "separate", "serving", "sewer", "system", "systems", "treatment", "urban".
0.260
chaindepartmentfinancialintegrationlinkingmanagementplanningprocessprocurementpurchasingspecificsupplysystems
SHARED TOKENS (13): "chain", "department", "financial", "integration", "linking", "management", "planning", "process", "procurement", "purchasing", "specific", "supply", "systems".
0.260
academicapplicationdesignengineeringfacilitiesfieldmanagementmovementoccupationalplanningprovidetechnologytransportation
SHARED TOKENS (13): "academic", "application", "design", "engineering", "facilities", "field", "management", "movement", "occupational", "planning", "provide", "technology", "transportation".
0.260
Linked data ↗ Q515701 KW CROSS HIGH
associatedbecomedatadescribeddesigninformationmakesmethodopenpagesprojectratherthem
SHARED TOKENS (13): "associated", "become", "data", "described", "design", "information", "makes", "method", "open", "pages", "project", "rather", "them".
0.260
Oversize load ↗ Q680421 KW CROSS HIGH
bridgeconstructionequipmenthighwayindustrialinfrastructurelargelegallimitsordinaryroadtransportationwater
SHARED TOKENS (13): "bridge", "construction", "equipment", "highway", "industrial", "infrastructure", "large", "legal", "limits", "ordinary", "road", "transportation", "water".
0.240
approvalcontrolledexpenditurefundsgeneralgovernmentlawprimeproposedspecificsupplysystem
SHARED TOKENS (12): "approval", "controlled", "expenditure", "funds", "general", "government", "law", "prime", "proposed", "specific", "supply", "system".
0.220
agencyconstructioncontractsdeliverydesigndiffersentitiesmethodprojectseparatesubstantial
SHARED TOKENS (11): "agency", "construction", "contracts", "delivery", "design", "differs", "entities", "method", "project", "separate", "substantial".
0.220
datadifferententitiesentityfilesfindingnationalrecordrecordsshapeterms
SHARED TOKENS (11): "data", "different", "entities", "entity", "files", "finding", "national", "record", "records", "shape", "terms".
0.220
Grant ↗ Q219140 EXACT TITLE
grantgrants
SHARED TOKENS (2): "grant", "grants". | EXACT TITLE in procurement_public_spending: "Grant". | EXACT TITLE in transportation_infrastructure: "Grant".
0.220
Prison ↗ Q40357 KW CROSS HIGH
administrationauthoritycenterfacilityfunctionsgoverningholdinglargelawprocesssystem
SHARED TOKENS (11): "administration", "authority", "center", "facility", "functions", "governing", "holding", "large", "law", "process", "system".
0.220
Star, Idaho ↗ Q1516815 KW CROSS HIGH
adaboisecanyondistrictidahopopulationschoolschoolssharedstarwest
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "idaho", "population", "school", "schools", "shared", "star", "west".
0.220
accessconnectingjurisdictionslocalmajormoveprovideroadroadsservestraffic
SHARED TOKENS (11): "access", "connecting", "jurisdictions", "local", "major", "move", "provide", "road", "roads", "serves", "traffic".
0.220
assetsauthoritycapabilitydatagovernancehighmanagementorganizationalqualityrolevalue
SHARED TOKENS (11): "assets", "authority", "capability", "data", "governance", "high", "management", "organizational", "quality", "role", "value".
0.220
Bike lane ↗ Q1378400 KW CROSS HIGH
businesseseconomicentrylaneresearchroadroadwaysafetyshowstrafficvehicles
SHARED TOKENS (11): "businesses", "economic", "entry", "lane", "research", "road", "roadway", "safety", "shows", "traffic", "vehicles".
0.200
U.S. Route 26 ↗ Q408902 KW CROSS HIGH
highwayidaholimitedlongmilesoregonsystemtrailwestwestern
SHARED TOKENS (10): "highway", "idaho", "limited", "long", "miles", "oregon", "system", "trail", "west", "western".
0.200
Park and ride ↗ Q738031 KW CROSS HIGH
citieslargepoolpublicroadsystemtransfertransitvehiclevehicles
SHARED TOKENS (10): "cities", "large", "pool", "public", "road", "system", "transfer", "transit", "vehicle", "vehicles".
0.200
boisecitiesdesignatedhighwayhomeidahomajormilesoregonserves
SHARED TOKENS (10): "boise", "cities", "designated", "highway", "home", "idaho", "major", "miles", "oregon", "serves".
0.180
canyonconnectingeaglehighwayidaholongmeridiannampavalley
SHARED TOKENS (9): "canyon", "connecting", "eagle", "highway", "idaho", "long", "meridian", "nampa", "valley".
0.180
adaboisecanyoncountiesidahooregonregiontreasurevalley
SHARED TOKENS (9): "ada", "boise", "canyon", "counties", "idaho", "oregon", "region", "treasure", "valley".
0.180
chartercitiescorporationcountiesgoverninglegallimitedlocalmunicipal
SHARED TOKENS (9): "charter", "cities", "corporation", "counties", "governing", "legal", "limited", "local", "municipal".
0.180
accessadministrationdemandformnetworkphysicalpoolresourcesshared
SHARED TOKENS (9): "access", "administration", "demand", "form", "network", "physical", "pool", "resources", "shared".
0.180
consultantsdeliveryembeddedgovernmentinformationprivaterelationshipsupportingtechnology
SHARED TOKENS (9): "consultants", "delivery", "embedded", "government", "information", "private", "relationship", "supporting", "technology".
0.160
abilityaccessfederalgovernmentinformationlocalpublicrecords
SHARED TOKENS (8): "ability", "access", "federal", "government", "information", "local", "public", "records".
0.160
completioncontractorinsuranceintendedissuedperformanceprojectwork
SHARED TOKENS (8): "completion", "contractor", "insurance", "intended", "issued", "performance", "project", "work".
0.160
americancommercialenvironmentlandlogisticsphysicalprocessproducts
SHARED TOKENS (8): "american", "commercial", "environment", "land", "logistics", "physical", "process", "products".
0.160
determineevidencefinancialinformationmaterialprovidestandardsstated
SHARED TOKENS (8): "determine", "evidence", "financial", "information", "material", "provide", "standards", "stated".
0.160
Parma, Idaho ↗ Q1522393 KW CROSS HIGH
boisecaldwellcanyonidahonampapopulationruralwestern
SHARED TOKENS (8): "boise", "caldwell", "canyon", "idaho", "nampa", "population", "rural", "western".
0.160
costsitselfmethodmultipleroadsecuritytransportationvehicle
SHARED TOKENS (8): "costs", "itself", "method", "multiple", "road", "security", "transportation", "vehicle".
0.140
Surety ↗ KW CROSS HIGH
debtfinanceprincipalprotectsresponsibilityresultingterms
SHARED TOKENS (7): "debt", "finance", "principal", "protects", "responsibility", "resulting", "terms".
0.140
agencycertificationinterestprofessionalpublicqualificationsimply
SHARED TOKENS (7): "agency", "certification", "interest", "professional", "public", "qualification", "simply".
0.140
codefoodmunicipalpublicroleseparatelywaste
SHARED TOKENS (7): "code", "food", "municipal", "public", "role", "separately", "waste".
0.140
commerciallargelicensematerialsoperatevehiclevehicles
SHARED TOKENS (7): "commercial", "large", "license", "materials", "operate", "vehicle", "vehicles".
0.120
adaconnectingcountieshighwayidahostar
SHARED TOKENS (6): "ada", "connecting", "counties", "highway", "idaho", "star".
0.120
Notus, Idaho ↗ Q990903 KW CROSS HIGH
boisecanyonidahopopulationruralsmall
SHARED TOKENS (6): "boise", "canyon", "idaho", "population", "rural", "small".
0.120
Axle load ↗ Q340755 KW CROSS HIGH
connecteddesignengineeringmaximumroadwayvehicle
SHARED TOKENS (6): "connected", "design", "engineering", "maximum", "roadway", "vehicle".
0.100
gardenhighwayidahotreasurevalley
SHARED TOKENS (5): "garden", "highway", "idaho", "treasure", "valley".
0.100
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
0.100
Wilder, Idaho ↗ Q1515350 KW CROSS HIGH
boisecanyonidahonampapopulation
SHARED TOKENS (5): "boise", "canyon", "idaho", "nampa", "population".
◈ Frequently Asked Questions
Procurement Public Spending × Transportation Infrastructure — Treasure Valley
HAIKU · HIGH GATE
How do Federal Highway Administration grants influence Treasure Valley procurement contracts for road construction?
The Federal Highway Administration allocates funding to Idaho transportation projects, which then requires Boise and Ada County to issue public bids meeting federal procurement standards. Local civil engineering firms and contractors in the Treasure Valley compete for these contracts under competitive bidding processes tied to FHA grant requirements.
What role do Boise State University and College of Western Idaho play in public spending decisions for transportation workforce development?
Both institutions receive public funding allocations for apprenticeship programs in civil engineering and logistics that directly supply trained workers to transportation infrastructure projects across the Treasure Valley. These procurement decisions for educational programs determine the availability of skilled labor for the region's public works contractors.
How does Boise Airport procurement affect regional transportation infrastructure spending in the Treasure Valley?
Boise Airport operates under Federal Aviation Administration oversight and must follow federal procurement rules when contracting for runway maintenance, terminal expansion, and ground transportation improvements. These capital projects compete with highway and public transit spending for Idaho Department of Transportation resources across the Treasure Valley's approximately 3,600 square miles.
Why do Treasure Valley municipalities coordinate public spending on surveying and civil engineering services for infrastructure projects?
Ada County and Boise coordinate procurement for surveying and civil engineering services to consolidate contracts for bridges, roads, and public transport corridors, reducing costs and ensuring consistent standards across transportation infrastructure. The Federal Highway Administration requires this coordination as a condition of receiving federal transportation funding.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Procurement Public Spending × Transportation Infrastructure 29 QID bridges 233 edges 6,135 ext links 2026-07-17 22:56:02 UTC de85a06cedee16f9
Procurement Public Spending corridor ↗ Transportation Infrastructure corridor ↗ Transportation Infrastructure × Procurement Public Spending ↗ boisestandard.org/standard ↗
Parent Corridors
Procurement Public Spending × All Other Verticals