—°F Boise, ID
◈ Cross-Vertical Intelligence · Treasure Valley · Boise Standard

Police Law Enforcement ↔ relates to ↔ Substance Use Recovery

20 Wikipedia bridge articles confirmed in both vertical ledgers. 261 deterministic cross-vertical edges. 7,022 external source links harvested. Every edge provenance-stamped. Every claim auditable.

20 QID Bridge Articles
261 Cross Edges
7,022 External Sources
291 Wikipedia Articles
22 🌲 Evergreen
192 🌿 Branch
HIGH SIGNAL · refinery-treasurevalley-v1.0.0
◈ Machine-Readable Schema
Deterministic Cross-Vertical Summary
PASS 2 · ZERO LLM
Entities Compared
Police Law Enforcement
× Substance Use Recovery
QID Bridge Articles
20
confirmed Wikipedia overlap
Total Cross Edges
261
External Sources Harvested
7,022
from Wikipedia external links
Geography
Treasure Valley, Ada County, Canyon County, Idaho, United States
Gate Tier
high
Haiku FAQ generated
Strongest Edge
Idaho State Police
score: 1.1500  ·  type: exact_title_cross  ·  18 shared tokens
QID Bridge Titles (20)
Idaho State PoliceIdaho Supreme CourtIdahoHomelessnessDomestic violenceDrug Enforcement AdministrationProbationBoise State UniversityEmergency medical servicesSupportive housingTreasure ValleyBoise metropolitan areaParoleNampa, IdahoBoise, IdahoAda County, IdahoCanyon County, IdahoCaldwell, IdahoMeridian, IdahoDriving under the influence
Shared Semantics (20 tokens)
idahoboisepopulationmetropolitanpeoplepubliccapitallargestadacanyoncourtdepartmentlawpresentapproximatelytechnologywesternamongdomestichealth
Pipeline
refinery-treasurevalley-v1.0.0
Generated
2026-07-17 22:50:11 UTC
Content Hash
15f031ca30f22e61
◈ Wikipedia Bridge Articles
QID Overlap — Confirmed in Both Vertical Ledgers
20 BRIDGES
Idaho State Police
Q5987459 EXACT TITLE 1.150
QID OVERLAP: Q5987459 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (18): "agency", "children", "court", "creating", "department", "enforcement", "force", "idaho", "investigate", "law", "municipal", "officers", "orders", "organization", "police", "present", "public", "statewide". | URL->A (1): http://www.isp.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho State Police". | EXACT TITLE in substance_use_recovery: "Idaho State Police".
agencychildrencourtcreatingdepartmentenforcementforceidahoinvestigatelawmunicipalofficersordersorganizationpolicepresentpublicstatewide
The Idaho State Police (ISP) is the statewide law enforcement agency for the State of Idaho. It began as the Bureau of Constabulary, created on May 18, 1919, under the new Department of Law Enforcement, to detect and investigate crime, "order abatement of public nuisances and to enforce such orders by appropriate court action, to suppress riots, prevent wrongs to children and animals that are inhibited by law." The state constabulary was also charged with the organization of various state, county and municipal peace officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A.
officers. The bureau was dissolved by the state legislature in 1923. The present force, called the Idaho State Police, was formed 87 years ago in 1939, when Governor C. A. Bottolfsen signed the bill creating it on February 20. Divisions The Idaho State Police is divided geographically into six districts, with headquarters (and training facility) in Meridian, west of Boise. District offices (1–3) are located in Coeur d'Alene, Lewiston, and Meridian. District offices (4–6) are located in Jerome, Pocatello, and Idaho Falls. Each district has a different captain and command staff, are managed separately and are overseen by a major.
Idaho Supreme Court
Q5987471 EXACT TITLE 1.010
QID OVERLAP: Q5987471 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (8): "building", "chief", "court", "courts", "decisions", "idaho", "justice", "present". | URL->A (1): http://www.isc.idaho.gov/. | EXACT TITLE in substance_use_recovery: "Idaho Supreme Court".
buildingchiefcourtcourtsdecisionsidahojusticepresent
he Idaho Supreme Court are binding on all other Idaho state courts. The only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
only court that may reverse or modify its decisions is the Supreme Court of the United States. The court moved into its present building in 1970; it was previously housed in the nearby state capitol building. Justices Justices are elected in non-partisan statewide elections and serve staggered six-year terms. Elections are held in the state primary, now in May, with run-off elections in November. The Chief Justice is selected by an election among the five justices and term length for that office is four years.
Video coverage The Idaho Supreme Court first permitted live video and audio coverage from its chambers in late 1978. See also Courts of Idaho References External links Idaho State Judiciary Idaho Architecture Project.org - Idaho Supreme Court building American Courthouses – Idaho Supreme Court building
Idaho
Q1221 EXACT TITLE 1.000
QID OVERLAP: Q1221 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (26): "approximately", "around", "boise", "capital", "contains", "death", "distinct", "eastern", "idaho", "largest", "national", "official", "organized", "people", "population", "portion", "products", "separate", "significant", "small".... | EXACT TITLE in police_law_enforcement: "Idaho". | EXACT TITLE in substance_use_recovery: "Idaho".
approximatelyaroundboisecapitalcontainsdeathdistincteasternidaholargestnationalofficialorganizedpeoplepopulationportionproductsseparatesignificantsmallsuppliestechnologyunionuseswashingtonwestern
ce of British Columbia. Idaho's state capital and largest city is Boise. With an area of 83,569 square miles (216,440 km2), Idaho is the 14th-largest state by land area. The state has a population of approximately two million people; it ranks as the 13th-least populous and the seventh-least densely populated of the 50 U.S. states. For thousands of years, and prior to European colonization, Idaho had been inhabited by natives. In the early 19th century, Idaho was considered part of the Oregon Country, an area which was disputed between the U.S. and the British Empire. Idaho officially became a U.S. territory with the signing of the Oregon Treaty of 1846, but a separate Idaho Territory was not organized until 1863, instead being included for periods in Oregon Territory and Washington Territory. The state was eventually admitted to the Union on July 3, 1890, becoming the 43rd state. Forming part of the Pacific Northwest (and the associated Cascadia bioregion), Idaho is divided into several distinct geographic and climatic regions. The state's north, the relatively isolated Idaho Panhandle, is closely linked with Eastern Washington, with which it shares the Pacific Time Zone—the rest of the state uses the Mountain Time Zone. The state's south includes the Snake River Plain (which has most of the population and agricultural land), and the southeast incorporates part of the Great Basin. Idaho is quite mountainous and contains several stretches of the Rocky Mountains. The United States Forest Service holds about 38% of Idaho's land, the highest proportion of any state. Industries significant for the state economy include manufacturing, agriculture, mining, forestry, science and technology, and tourism. Idaho has been a predominantly Republican state since statehood, with the Republican Party dominating in both state and national elections; abortion is severely restricted and the state retains the death penalty, including methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield.
Idaho's highest point is Borah Peak, 12,662 ft (3,859 m), in the Lost River Range north of Mackay. Idaho's lowest point, 710 ft (216 m), is in Lewiston, where the Clearwater River joins the Snake River and continues into Washington. The Sawtooth Range is often considered Idaho's most famous mountain range. Other mountain ranges in Idaho include the Bitterroot Range, the White Cloud Mountains, the Lost River Range, the Clearwater Mountains, and the Salmon River Mountains. Salmon-Challis National Forest is located in the east central sections of the state, with Salmon National Forest to the north and Challis National Forest to the south. The forest is in an area known as the Idaho Cobalt Belt, which consists of a 34 miles (55 km) long geological formation of sedimentary rock that contains some of the largest cobalt deposits in the U.S. Idaho has two time zones, with the dividing line approximately midway between Canada and Nevada. Southern Idaho, including the Boise metropolitan area, Idaho Falls, Pocatello, and Twin Falls, are in the Mountain Time Zone. A legislative error (15 U.S.C. ch. 6 §264) theoretically placed this region in the Central Time Zone, but this was corrected with a 2007 amendment.
g methods like the firing squad. The state contains the Idaho National Laboratory. Idaho's agricultural sector supplies many products, but the state is best known for its potato crop, which comprises around one-third of the nationwide yield. Its official state nickname is the "Gem State". Etymology In the early 1860s, when the U.S. Congress was considering organizing a new territory around Pikes Peak in the Rocky Mountains, the name "Idaho" was popular among the Congressional committee, as they believed it to be derived from a Shoshone term meaning "gem of the mountains." Realizing in January 1861 the name was quite possibly a fabrication and not Native American at all, the U.S. Congress ultimately decided to name the area Colorado Territory when it was created. But, by the time this decision was made in February 1861, the town of Idaho Springs, Colorado had already been named after their early frontrunner for a name, Idaho. In 1863, the Territory of Idaho was formed, though “Montana” was nearly its name. More than a decade after the name Idaho was first discussed for the eventual Colorado Territory, George M. Willing, a politician, claimed that he had been inspired by a little girl named Ida and that he coined the name in Washington at the time of the Congressional committee when he had been posing as an elected delegate to Congress. The same year Congress created Colorado Territory, a county called Idaho County was created in eastern Washington Territory. The county was named after a steamship named Idaho, which was launched on the Columbia River in 1860. It is unclear whether the steamship was named before or after the legitimacy of the Native American origins of “Idaho” came into question. Regardless, part of Washington Territory, including Idaho County, was used to create Idaho Territory in 1863. Idaho Territory would later change its boundaries to the area that became the U.S.
H
Q131327 EXACT TITLE 1.000
QID OVERLAP: Q131327 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "approximately", "changes", "emergency", "experience", "family", "form", "government", "homelessness", "house", "housing", "human", "identifying", "legal", "people", "permanent", "primary", "private", "public", "safe", "shelter".... | EXACT TITLE in police_law_enforcement: "Homelessness". | EXACT TITLE in substance_use_recovery: "Homelessness".
approximatelychangesemergencyexperiencefamilyformgovernmenthomelessnesshousehousinghumanidentifyinglegalpeoplepermanentprimaryprivatepublicsafeshelterstandardizedstatusstudiestodaywork
are living on the streets (primary homelessness); have no permanent house or place to live safely are moving between temporary shelters, including houses of friends, family, hotels, and emergency accommodation (secondary homelessness) The legal status of homeless people changes from place to place. Homeless enumeration studies conducted by the government of the United States also include people who sleep in a public or private place that is not designed for use as a regular sleeping accommodation for human beings. Homelessness and poverty are interrelated. There is no standardized method for counting homeless individuals and identifying their needs; consequently, most cities only have estimated figures for their homeless populations. In 2025, approximately 330 million people worldwide experience absolute homelessness, lacking any form of shelter. Homeless persons who travel have been termed vagrants in the past; of those, persons looking for work are hobos, whereas those who do not are tramps.
Homelessness in South Africa dates back to the apartheid period. Increasing unemployment, lack of affordable housing, social disintegration, and social and economic policies have all been identified as contributing factors to the issue. Some scholars argue that solutions to homelessness in South Africa lie more within the private sphere than in the legal and political spheres. There is no national census on homeless people in South Africa, researchers instead rely on individual studies of homeless persons in particular cities. The South African homeless population has been estimated at 200,000 people from a diverse range of backgrounds. One study found that three out of four South African metropolitan municipalities viewed homelessness primarily as a social dependency issue, responding with social interventions. At the same time, homeless South Africans indicated that the most important thing the municipality could assist them with was employment and well-located affordable housing. Asia China In 2011, there were approximately 2.41 million homeless adults and 179,000 homeless children living in the country. However, one publication estimated that there were one million homeless children in China in 2012. Housing in China is highly regulated by the Hukou system. This gives rise to a large number of migrant workers, numbering 290.77 million in 2019. These migrant workers have rural Hukou, but they move to the cities in order to find better jobs, though due to their rural Hukou they are entitled to fewer privileges than those with urban Hukou. According to Huili et al., these migrant workers "live in overcrowded and unsanitary conditions" and are always at risk of displacement to make way for new real estate developments. In 2017, the government responded to a deadly fire in a crowded building in Beijing by cracking down on dense illegal shared accommodations and evicting the residents, leaving many migrant laborers homeless. This comes in the context of larger attempts by the government to limit the population increase in Beijing, often targeting migrant laborers. However, according to official government statistics, migrant workers in China have an average of 20.4 square metres (220 square feet) of living space per capita, and the vast majority of migrant workers have basic living facilities such as heating, bathing, refrigerators, and washing machines. Several natural disasters have led to homelessness in China. The 2000 Yunnan earthquake left 92,479 homeless and destroyed over 41,000 homes. Homelessness among people with mental health problems is 'much less common' in China than in high-income countries, due to stronger family ties, but is increasing due to migration within families and as a result of the one-child policy. A study in Xiangtan found at least 2439 schizophrenic people that have been homeless on a total population of 2.8 million. It was found that "homelessness was more common in individuals from rural communities (where social support services are limited), among those who wander away from their communities (i.e., those not from Xiangtan municipality), and among those with limited education (who are less able to mobilize social supports). Homelessness was also associated with greater age; [the cause] may be that older patients have 'burned their bridges' with relatives and, thus, end up on the streets." During the Cultural Revolution a large part of child welfare homes were closed down, leaving their inhabitants homeless. By the late 1990s, many new homes were set up to accommodate abandoned children. In 1999, the Ministry of Civil Affairs estimated the number of abandoned children in welfare homes to be 66,000. According to the Ministry of Civil Affairs, China had approximately 2,000 shelters and 20,000 social workers to aid approximately three million homeless people in 2014. From 2017 to 2019, the government of Guangdong Province assisted 5,388 homeless people in reuniting with relatives elsewhere in China. The Guangdong government assisted more than 150,000 people over three years. In 2020, in the wake of the COVID-19 pandemic, the Chinese Ministry of Civil Affairs announced several actions of the Central Committee in response to homelessness, including increasing support services and reuniting homeless people with their families. In Wuhan, the situation for homeless people was particularly bad, as the lockdown made it impossible for homeless migrants to return to other parts of the country.
In 2011, there were approximately 2.41 million homeless adults and 179,000 homeless children living in the country. However, one publication estimated that there were one million homeless children in China in 2012. Housing in China is highly regulated by the Hukou system. This gives rise to a large number of migrant workers, numbering 290.77 million in 2019. These migrant workers have rural Hukou, but they move to the cities in order to find better jobs, though due to their rural Hukou they are entitled to fewer privileges than those with urban Hukou. According to Huili et al., these migrant workers "live in overcrowded and unsanitary conditions" and are always at risk of displacement to make way for new real estate developments. In 2017, the government responded to a deadly fire in a crowded building in Beijing by cracking down on dense illegal shared accommodations and evicting the residents, leaving many migrant laborers homeless. This comes in the context of larger attempts by the government to limit the population increase in Beijing, often targeting migrant laborers. However, according to official government statistics, migrant workers in China have an average of 20.4 square metres (220 square feet) of living space per capita, and the vast majority of migrant workers have basic living facilities such as heating, bathing, refrigerators, and washing machines. Several natural disasters have led to homelessness in China. The 2000 Yunnan earthquake left 92,479 homeless and destroyed over 41,000 homes. Homelessness among people with mental health problems is 'much less common' in China than in high-income countries, due to stronger family ties, but is increasing due to migration within families and as a result of the one-child policy. A study in Xiangtan found at least 2439 schizophrenic people that have been homeless on a total population of 2.8 million. It was found that "homelessness was more common in individuals from rural communities (where social support services are limited), among those who wander away from their communities (i.e., those not from Xiangtan municipality), and among those with limited education (who are less able to mobilize social supports). Homelessness was also associated with greater age; [the cause] may be that older patients have 'burned their bridges' with relatives and, thus, end up on the streets." During the Cultural Revolution a large part of child welfare homes were closed down, leaving their inhabitants homeless. By the late 1990s, many new homes were set up to accommodate abandoned children. In 1999, the Ministry of Civil Affairs estimated the number of abandoned children in welfare homes to be 66,000. According to the Ministry of Civil Affairs, China had approximately 2,000 shelters and 20,000 social workers to aid approximately three million homeless people in 2014. From 2017 to 2019, the government of Guangdong Province assisted 5,388 homeless people in reuniting with relatives elsewhere in China. The Guangdong government assisted more than 150,000 people over three years. In 2020, in the wake of the COVID-19 pandemic, the Chinese Ministry of Civil Affairs announced several actions of the Central Committee in response to homelessness, including increasing support services and reuniting homeless people with their families. In Wuhan, the situation for homeless people was particularly bad, as the lockdown made it impossible for homeless migrants to return to other parts of the country.
Domestic violence
Q156537 EXACT TITLE 1.000
QID OVERLAP: Q156537 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (40): "act", "against", "among", "broader", "cases", "child", "children", "conflicts", "context", "control", "create", "death", "direct", "documentation", "domestic", "established", "experience", "family", "financial", "forms".... | EXACT TITLE in police_law_enforcement: "Domestic violence". | EXACT TITLE in substance_use_recovery: "Domestic violence".
actagainstamongbroadercaseschildchildrenconflictscontextcontrolcreatedeathdirectdocumentationdomesticestablishedexperiencefamilyfinancialformshealthlifemembersofficeorganizationpartnerspeopleproduceratesrelationship+10
es one in three of all women are subject to domestic violence at some point in their life. In some countries, domestic violence may be seen as justified or legally permitted, particularly in cases of actual or suspected infidelity on the part of the woman. Research has established that there exists a direct and significant correlation between a country's level of gender inequality and rates of domestic violence, where countries with less gender equality experience higher rates of domestic violence. Domestic violence is among the most underreported crimes worldwide for both men and women. Domestic violence often occurs when the abuser believes that they are entitled to it, or that it is acceptable, justified, or unlikely to be reported. It may produce an intergenerational cycle of violence in children and other family members, who may feel that such violence is acceptable or condoned. Many people do not recognize themselves as abusers or victims, because they may consider their experiences as family conflicts that had gotten out of control. Awareness, perception, definition and documentation of domestic violence differs widely from country to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
ountry to country. Additionally, domestic violence often happens in the context of forced or child marriages. In abusive relationships, there may be a cycle of abuse during which tensions rise and an act of violence is committed, followed by a period of reconciliation and calm. The victims may be trapped in domestically violent situations through isolation, power and control, traumatic bonding to the abuser, cultural acceptance, lack of financial resources, fear, and shame, or to protect children. As a result of abuse, victims may experience physical disabilities, dysregulated aggression, chronic health problems, mental illness, limited finances, and a poor ability to create healthy relationships. Victims may experience severe psychological disorders, such as post-traumatic stress disorder (PTSD).
The first known use of the term domestic violence in a modern context, meaning violence in the home, was in an address to the Parliament of the United Kingdom by Jack Ashley in 1973. The term previously referred primarily to civil unrest, domestic violence from within a country as opposed to international violence perpetrated by a foreign power. Traditionally, domestic violence (D.V.) was mostly associated with physical violence. Terms such as wife abuse, wife beating, wife battering, and battered woman were used, but have declined in popularity due to efforts to include unmarried partners, abuse other than physical, female perpetrators, and same-sex couples. Domestic violence is now commonly defined broadly to include "all acts of physical, sexual, psychological or economic violence" that may be committed by a family member or intimate partner. The term intimate partner violence is often used synonymously with domestic abuse or domestic violence, but it specifically refers to violence occurring within a couple's relationship (i.e. marriage, cohabitation, or non-cohabiting intimate partners). To these, the World Health Organization (WHO) adds controlling behaviors as a form of abuse. Intimate partner violence has been observed in opposite and same-sex relationships, and in the former instance by both men against women and women against men. Family violence is a broader term, often used to include child abuse, elder abuse, and other violent acts between family members.
Drug Enforcement Administration
Q622899 EXACT TITLE 1.000
QID OVERLAP: Q622899 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (26): "act", "administration", "agency", "cause", "community", "controlled", "dea", "department", "domestic", "drug", "drugs", "enforcement", "established", "federal", "government", "involving", "justice", "law", "lead", "national".... | EXACT TITLE in police_law_enforcement: "Drug Enforcement Administration". | EXACT TITLE in substance_use_recovery: "Drug Enforcement Administration".
actadministrationagencycausecommunitycontrolleddeadepartmentdomesticdrugdrugsenforcementestablishedfederalgovernmentinvolvingjusticelawleadnationaloperationsprotectionratherreportssubstancesuses
agency under the U.S. Department of Justice tasked with combating illicit drug trafficking and distribution within the U.S. It is the lead agency for domestic enforcement of the Controlled Substances Act, sharing concurrent jurisdiction with the Federal Bureau of Investigation and U.S. Customs and Border Protection. The DEA is responsible for coordinating and pursuing U.S. drug investigations both domestically and internationally. The DEA has an intelligence unit that is also a member of the U.S. Intelligence Community. While the unit is part of the DEA chain-of-command, it also reports to the director of national intelligence. The administration has been criticized for scheduling drugs that have medicinal uses, and for focusing on operations that allow it to seize money rather than those involving drugs that cause more harm. The DEA was established in 1973 as part of the U.S.
History and mandate The Drug Enforcement Administration was established on July 1, 1973, by Reorganization Plan No. 2 of 1973, signed by President Richard Nixon on July 28. It proposed the creation of a single federal agency to enforce the federal drug laws as well as consolidate and coordinate the government's drug control activities. Congress accepted the proposal, as they were concerned with the growing availability of drugs. As a result, the Bureau of Narcotics and Dangerous Drugs (BNDD), the Office of Drug Abuse Law Enforcement (ODALE); approximately 600 Special Agents of the Bureau of Customs, Customs Agency Service, and other federal offices merged to create the DEA. The DEA is the primary federal agency charged with implementing and enforcing the Controlled Substances Act (CSA), which is Title II of a larger Federal Act called the Comprehensive Drug Abuse Prevention and Control Act of 1970. The DEA is responsible for drugs listed in the CSA's five drug Schedules, categories that rank drugs by their potential for harm, and whether they have a medical use. The CSA seeks to ensure legitimate access to controlled pharmaceuticals, while preventing illicit use of controlled drugs.
On April 19, 1995, Timothy McVeigh carried out a terrorist attack on the Alfred P. Murrah Federal Building in Oklahoma City. He was targeting regional offices for the Federal Bureau of Investigation (FBI), Bureau of Alcohol, Tobacco, Firearms and Explosives (ATF) and DEA, all of which had carried out raids that he viewed as unjustified intrusions on the rights of the people. This attack caused the deaths of two DEA employees, one task force member and two contractors in the Oklahoma City bombing. Subsequently, the DEA headquarters complex was classified as a Level IV installation under United States federal building security standards, meaning it was to be considered a high-risk law enforcement target for terrorists.
P
Q13961 EXACT TITLE 1.000
QID OVERLAP: Q13961 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (31): "alcohol", "behavior", "case", "child", "community", "conditions", "contact", "court", "courts", "criminal", "domestic", "drug", "drugs", "educational", "employed", "incarceration", "law", "means", "officer", "orders".... | EXACT TITLE in police_law_enforcement: "Probation". | EXACT TITLE in substance_use_recovery: "Probation".
alcoholbehaviorcasechildcommunityconditionscontactcourtcourtscriminaldomesticdrugdrugseducationalemployedincarcerationlawmeansofficerorderspermitpotentialprobationprogramremainrequiredrulessubjectsupervisiontreatment+1
as minors, if the instant offense involves child sexual abuse), or with known criminals, particularly co-defendants. Additionally, offenders can be subject to refraining from the use or possession of alcohol and other drugs and may be ordered to submit to alcohol/drug tests or participate in alcohol/drug psychological treatment. Offenders on probation might be fitted with an electronic tag (or monitor), which signals their movement to officials.
icularly co-defendants. Additionally, offenders can be subject to refraining from the use or possession of alcohol and other drugs and may be ordered to submit to alcohol/drug tests or participate in alcohol/drug psychological treatment. Offenders on probation might be fitted with an electronic tag (or monitor), which signals their movement to officials.
When child support nonpayment was criminalized in the early 20th century, probation was the primary punishment levied on nonsupporters. Those in favor of criminalizing nonsupport wanted a penalty that "would maximize deterrence, preserve the family (at least in a financial sense), and lighten the burden on charities and the state to support women and children." When New York authorized probation as a punishment in 1901, the New York City magistrates cited four benefits to probation as opposed to incarceration: "(1) 'Punishment without disgrace, and effective without producing embitterment, resentment or demoralization,' (2) judicial discretion to make the punishment fit the crime, (3) '[p]unishment that is borne solely by the guilty and displacing a system that frequently involved the innocent and helpless,' and (4) punishment attended by increased revenue to the City and by a saving in expense.'" The existence of probation officers in child support cases made it so the state was involved in family life in previously unprecedented ways. Probation officers would often attempt to reconcile separated couples, encourage husbands to drink less alcohol, and teach wives housekeeping skills. Employing probation in nonsupport cases also led to more revenue captured by nonsupporting spouses.
Boise State University
Q891082 EXACT TITLE 1.000
QID OVERLAP: Q891082 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (25): "activity", "among", "arts", "boise", "business", "college", "colleges", "division", "education", "expenditures", "fiscal", "graduate", "health", "idaho", "independent", "institution", "master", "program", "programs", "public".... | EXACT TITLE in police_law_enforcement: "Boise State University". | EXACT TITLE in substance_use_recovery: "Boise State University".
activityamongartsboisebusinesscollegecollegesdivisioneducationexpendituresfiscalgraduatehealthidahoindependentinstitutionmasterprogramprogramspublicreportedresearchschoolteamsuniversity
, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
The university also has an honors college. Within the College of Arts and Sciences is the School of the Environment, approved by the Idaho State Board of Education in 2022 and established in 2023. Boise State's fall enrollment in 2016 was 23,886 students, and approximately 76 percent of these students were Idaho residents. More than 90 percent of Boise State's first-year students come directly from high school. In the 2015–16 school year, Boise State awarded diplomas to 3,916 distinct graduates, including 18 doctorates, 10 education specialists, 670 master's and 2,998 bachelor's degrees. The university is classified among "R2: Doctoral Universities – High research spending and doctorate production".
te offers more than 100 graduate programs, including a variety of MBA programs and the MAcc program in the College of Business and Economics; master's and PhD programs in the Colleges of Engineering, Arts & Sciences, and Education; MPA program in the School of Public Service; and the MPH program in the College of Health Sciences. It is classified among "R2: Doctoral Universities – High research activity".
Emergency medical services
Q860447 EXACT TITLE 1.000
QID OVERLAP: Q860447 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (33): "agencies", "care", "case", "contact", "department", "dispatch", "emergency", "facilities", "historically", "hospital", "life", "medical", "members", "model", "operate", "personnel", "portion", "present", "primary", "public".... | EXACT TITLE in police_law_enforcement: "Emergency medical services". | EXACT TITLE in substance_use_recovery: "Emergency medical services".
agenciescarecasecontactdepartmentdispatchemergencyfacilitieshistoricallyhospitallifemedicalmembersmodeloperatepersonnelportionpresentprimarypublicremainsresourcessearchskillssupportsystemstechnicianstelephonethemtraining+3
ill then dispatch suitable resources for the call. Ambulances are the primary vehicles for delivering EMS, though squad cars, motorcycles, aircraft, boats, fire apparatus, and others may be used. EMS agencies may also operate a non-emergency patient transport service, and some have rescue squads to provide technical rescue or search and rescue services. When EMS is dispatched, they will initiate medical care upon arrival on scene. If it is deemed necessary or a patient requests transport, the unit is then tasked with transferring the patient to the next point of care, typically an emergency department of a hospital. Historically, ambulances only transported patients to care, and this remains the case in parts of the developing world. The term "emergency medical service" was popularised when these services began to emphasise emergency treatment at the scene. In some countries, a substantial portion of EMS calls do not result in a patient being taken to hospital. Training and qualification levels for members and employees of emergency medical services vary widely throughout the world. In some systems, members may be present who are qualified only to drive ambulances, with no medical training. In contrast, most systems have personnel who retain at least basic life support (BLS) certifications.
Advances in the 1960s, especially the development of CPR and defibrillation as the standard form of care for out-of-hospital cardiac arrest, along with new pharmaceuticals, led to changes in the tasks of the ambulances. In Belfast, Northern Ireland the first experimental mobile coronary care ambulance successfully resuscitated patients using these technologies. Freedom House Ambulance Service was the first civilian emergency medical service in the United States to be staffed by paramedics, all of whom were African-American. One well-known report in the US during that time was Accidental Death and Disability: The Neglected Disease of Modern Society, also known as The White Paper. The report concluded that ambulance services in the US varied widely in quality and were often unregulated and unsatisfactory. These studies placed pressure on governments to improve emergency care in general, including the care provided by ambulance services. The government reports resulted in the creation of standards in ambulance construction concerning the internal height of the patient care area (to allow for an attendant to continue to care for the patient during transport), and the equipment (and thus weight) that an ambulance had to carry, and several other factors. In 1971 a progress report was published at the annual meeting, by the then president of American Association of Trauma, Sawnie R. Gaston M.D. Dr. Gaston reported the study was a "superb white paper" that "jolted and wakened the entire structure of organized medicine." This report is created as a "prime mover" and made the "single greatest contribution of its kind to the improvement of emergency medical services". Since this time a concerted effort has been undertaken to improve emergency medical care in the pre-hospital setting. Such advancements included Dr. R Adams Cowley creating the country's first statewide EMS program, in Maryland. The developments were paralleled in other countries. In the United Kingdom, a 1973 law merged the municipal ambulance services into larger agencies and set national standards. In France, the first official SAMU agencies were founded in the 1970s. Organization Depending on country, area within country, or clinical need, emergency medical services may be provided by one or more different types of organization. This variation may lead to large differences in levels of care and expected scope of practice.
Operating separately from (although alongside) the fire and police services of the area, these ambulances are funded by local, provincial or national governments. In some countries, these only tend to be found in big cities, whereas in countries such as the United Kingdom, almost all emergency ambulances are part of a national health system. In the United States, ambulance services provided by a local government are often referred to as "third service" EMS (the fire department, police department, and EMS department forming an emergency services trio) by the members of said service, as well as other city officials and residents. The most notable examples of this model in the United States are Pittsburgh Bureau of Emergency Medical Services, Boston EMS, New Orleans Emergency Medical Services, and Cleveland EMS. Government ambulance services also have to take civil service exams just like government fire departments and police. In the United States, certain federal government agencies employ emergency medical technicians at the basic and advanced life support levels, such as the National Park Service and the Federal Bureau of Prisons. Fire- or police-linked service In countries such as the United States, Japan, France, South Korea and parts of India, ambulances can be operated by the local fire or police services. Fire-based EMS is the most common model in the United States, where nearly all urban fire departments provide EMS and a majority of emergency transport ambulance services in large cities are part of fire departments. Examples of this model are the New York City Fire Department (FDNY) and the Baltimore City Fire Department. It is rare for a police department in the United States to provide EMS or ambulance services, although many police officers have basic medical training (such as Nalaxone use and CPR).
S
Q7644625 EXACT TITLE 0.980
QID OVERLAP: Q7644625 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (14): "active", "community", "departments", "developed", "different", "funding", "health", "homelessness", "housing", "intended", "people", "professional", "supportive", "work". | EXACT TITLE in police_law_enforcement: "Supportive housing". | EXACT TITLE in substance_use_recovery: "Supportive housing".
activecommunitydepartmentsdevelopeddifferentfundinghealthhomelessnesshousingintendedpeopleprofessionalsupportivework
Supportive housing is a combination of housing and services intended as a cost-effective way to help people live more stable, productive lives, and is an active "community services and funding" stream across the United States. It was developed by different professional academics and US governmental departments that supported housing.
Benefits of supportive housing for specific populations groups Supportive housing proposes to be a comprehensive solution to a problem rather than a band-aid fix (such as a shelter). While many of those who stay in the shelter system remain in or return to the system for extended periods of time, a much higher percentage of those who are placed in supportive housing remain housed on a more permanent basis. This idea is also referred to as the Housing First model, an approach to combating chronic homelessness by providing homes upfront and offering help for illnesses and addictions. The concept turns the traditional model, which typically requires sobriety (or prerequisites that can be used for enhanced services before a person can get housing), upside down. Research has shown that coupling permanent housing with supportive services is highly effective at maintaining housing stability, as well as helps improve health outcomes and decreases the use of publicly funded institutions. A review of the impact of these services found that they can improve health outcomes among chronically homeless individuals, including positive changes in self-reported mental health status, substance use, and overall well-being. In the Collaborative Initiative to Help End Chronic Homelessness (CICH), participants who had been homeless for an average of eight years were immediately placed into permanent housing. The CICH evaluation reported that 95% of those individuals were in independent housing after 12 months. A study of homeless people in New York City with serious mental illness found that providing supportive housing to the individuals directly resulted in a 60% decrease in emergency shelter use for clients, as well as decreases in the use of public medical and mental health services and city jails and state prisons. Another study in Seattle in 2009 found that moving "people with chronic alcoholism" into supportive housing resulted in a 33% decline in alcohol use for clients. There is significant support for the contention that supportive housing also costs less than other systems where its tenant base may reside, such as jails, hospitals, mental health facilities, and even shelters. Research on the overall costs to the taxpayer of supportive housing has consistently found the costs to the taxpayer to be about the same or lower than the alternative of a chronically homeless person sleeping in a shelter. The CICH evaluation showed that average costs for healthcare and treatment were reduced by about half, which the largest decline associated with inpatient hospital care. The use of supportive housing has been shown to be cost-effective, resulting in reductions in the use of shelter, ambulance, police/jail, health care, emergency room, behavior health, and other service costs. For example, one 2016 report identified studies documenting that these services can reduce health care costs, emergency department visits, and length of stays in psychiatric hospitals. The Denver Housing First Collaborative documented that the annual cost of supportive housing for a chronically homeless individual was $13,400. However, the per-person reduction in public services recorded by the Denver Housing First Collaborative came to $15,773 per person per year, more than compensating for the annual supportive housing costs. When paired with low-income housing (or mixed-income housing), government subsidies (such as section 8 or Housing choice vouchers) and other revenue generating operations, supportive housing residences are claimed by their supporters to be capable of supporting themselves and even turning a profit (which can be used for enhanced services and amenities for the residents by a non-profit organization). According to a 2007 study done by the National Alliance to End Homelessness, supportive housing helps tenants increase their incomes, work more, get arrested less, make more progress toward recovery, and become more active, valued and productive members of their communities. Impact on neighborhoods Supportive housing can help people facing health challenges to continue to live in the community. However, proposals for new housing projects often faced local opposition, largely based on fears regarding adverse effects on property values and crime rates, local businesses, and the quality of life in the surrounding neighborhood.
Further reading AcademyHealth. (2016, July). Rapid Evidence Review: What Housing-related Services and Supports Improve Health Outcomes among Chronically Homeless Individuals?. Bassuk, Ellen L.; Geller, Stephanie, The Role of Housing and Services in Ending Family Homelessness (2006). Housing Policy Debate 17(4): 781–806. Braisby, D., Echlin, R., Hill, S. & Smith, H. (1984). Changing Futures: Housing and Support Services for People Discharged from Psychiatric Hospitals. London: King's Fund Project Paper. Carling, P.J., Randolph, F.L., Blanch, A.K. & Ridgeway, P. (1988). A review of the research on housing and community integration for people with psychiatric disabilities. National Rehabilitation Information Center Quarterly, 1(3), 1–18. OCLC 33023067 Carling, P.J. (1993, May). Housing and supports for persons with mental illness: Emerging approaches to research and practice. Hospital and Community Psychiatry, 44(5): 439–449. PMID: 8509074; DOI: 10.1176/ps.44.5.439 Cuomo, A.M. (2014). HELP. All Things Possible: Setbacks and Successes in Politics and Life (pp. 80–136). NY, NY: Harper Collins Publishers. ISBN 0-062-30010-5, 9780062300102; OCLC 1199128524 Dilys Page. (1995, April). Whose services? Whose needs? Community Development Journal, 30(2), 217–235. DOI: 10.1093/cdj/30.2.217 Fitton, P. & Wilson, J. (1995). "A home of their own: Achieving supported housing". In: T. Philpot & L. Ward (Eds.), Changing Ideas and Services for People with Learning Disabilities. (pp. 43–54). Oxford: Butterworth-Heinemann, Ltd. ISBN 0-750-62248-2, 9780750622486; OCLC 1302619886 Friedman, Donna Haig, et al., Preventing Homelessness and Promoting Housing Stability: A Comparative Analysis Archived 2023-01-17 at the Wayback Machine, The Boston Foundation, June 2007. Knisley, M. B. & Fleming, M. (1993, May). Implementing supported housing in state and local mental health systems. Hospital and Community Psychiatry, 44(5),456–460. PMID: 8509076 l DOI: 10.1176/ps.44.5.456 Lakin, K. C. & Racino, J.A. (1990). Formation of the Rehabilitation Research and Training Centers on Families and Community Living in US Education. Washington, DC: University of Minnesota and Syracuse University in conjunction with the RRTCS of the USA. Livingston, J. & Srebnik, D. (1991, November). States' strategies for promoting supported housing for persons with psychiatric disabilities. Hospital and Community Psychiatry, 42(11), 1116–1119. PMID: 1743638; DOI: 10.1176/ps.42.11.1116 McCarroll, Christina, "Pathways to housing the homeless", The Christian Science Monitor, May 1, 2002 O’Flaherty, Brendan, Making room : the economics of homelessness, Cambridge, Mass. : Harvard University Press, 1996. ISBN 0-674-54342-4, 0-674-54343-2; OCLC 751331264 Quigley, John M.; Raphael, Steven, The Economics of Homelessness: The Evidence from North America Archived 2022-01-20 at the Wayback Machine, European Journal of Housing Policy 1(3), 2001, 323–336. O'Hara, A. & Day, S. (2001, December). Olmstead and Supportive Housing: A Vision for the Future. Washington, DC: Center for Health Care Strategies and the Technical Assistance Collaborative. OCLC 50119357 Pynoos, J., Hollander-Feldman, P., & Ahrens, J. (2004). Linking Housing and Services for Older Adults: Obstacles, Options, and Opportunities. NY, NY: The Haworth Press. ISBN 0-203-05119-X; OCLC 1082212507 Racino, J. A. (1989, August). Selected Issues in Housing. Prepared for US conference distribution, Rehabilitation Research and Training Center on Community Integration, Syracuse University, Center on Human Policy. Racino, J. (1999). "State policy in housing and support: Evaluation and policy analysis of state systems". In: Policy, Program Evaluation and Research in Disability: Community Support for All. (pp. 263–287). London: Haworth Press. ISBN 0-789-00598-0, 9780789005984; OCLC 301621888 Racino, J. (2014). "Housing and disability: Toward inclusive, equitable, and sustainable housing and communities". Public Administration and Disability: Community Services Administration in the US. NY, NY: CRC Press, Francis and Taylor. ISBN 1-466-57981-1, 9781466579811; OCLC 865641827 Ridgeway, P. & Zipple, A.M.(1990, April). "The paradigm shift in residential services: From the linear continuum to supported housing approaches." Special Issue: Supported Housing: New approaches to residential services. Psychosocial Rehabilitation. Boston, MA: Center for Psychiatric Rehabilitation, Sargent College of Allied Health Professions, Boston University. DOI: 10.1037/h0099479 Rogers, E.S., Farkas, M., Anthony, W., Kash, M., Harding, C., & Olschewski, A. (2009). Systematic Review of Supported Housing Literature 1993–2008. Boston, MA: Boston University Center for Psychiatric Rehabilitation. Roncarati, Jill, Homeless, housed, and homeless again, Journal of the American Academy of Physician's Assistants (authorized for involuntary care by psychiatrists; active legal cases), June 2008. PMID: 18619107; DOI: 10.1097/01720610-200806000-00090 Sheehan, N. & Oakes, C. (2004). "Public policy initiatives addressing supportive housing: The experience of Connecticut". In: Pynoos, J., Holander-Feldman, P. & Ahrens, J. (Eds.), Linking Housing and Services for Older Adults: Obstacles, Options, and Opportunities. pp. 81–113). New York: Haworth Press. ISBN 0-203-05119-X; OCLC 1082212507 Surles, R.C. (1989). Supported Housing Implementation: A Report to the New York State Legislature. Albany, NY: New York State Office of Mental Health. Taylor, S.J. (1987). A Policy Analysis of the Supported Housing Demonstration Project: Pittsburgh, PA. Syracuse, NY: Syracuse University, Center on Human Policy, Community Integration Project. OCLC 27721422 US Housing and Urban Development. (2010, July). Homeless Costs and Interventions: A Portrait of Homelessness in 2009; Low Income Housing Tax Credits' Boost Affordable Rental Housing Supplies; Snapshot of Worst Case Housing Needs in the US.
Treasure Valley
Q7836726 EXACT TITLE 0.980
QID OVERLAP: Q7836726 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (14): "association", "boise", "eastern", "historically", "idaho", "local", "metropolitan", "opportunities", "region", "resources", "rural", "treasure", "valley", "western". | EXACT TITLE in police_law_enforcement: "Treasure Valley". | EXACT TITLE in substance_use_recovery: "Treasure Valley".
associationboiseeasternhistoricallyidaholocalmetropolitanopportunitiesregionresourcesruraltreasurevalleywestern
ern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
The Treasure Valley is a valley in the western United States, primarily in southwestern Idaho, where the Payette, Boise, Weiser, Malheur, and Owyhee rivers drain into the Snake River. It includes all the lowland areas from Vale in rural eastern Oregon to Boise, and is the most populated area in Idaho. Historically, the valley had been known as the Lower Snake River Valley or the Boise River Valley. Pete Olesen, president of the valley's association of local Chambers of Commerce, coined the name "Treasure Valley" in 1959 to reflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas.
eflect the treasure chest of resources and opportunities that the region offered. The valley has a very diverse terrain, from sage flatlands, to mesas, agricultural areas, and urbanized areas. As the Boise Metropolitan Area grows, more and more undeveloped and agricultural land is being urbanized. History Settling the region The tribes that roamed the area, specifically, were the Northern Paiute and Shoshone. In 1834, Thomas McKay built the original Fort Boise, in the area near present-day Parma, which was run for a time by Francois Payette. It later was moved because of flooding troubles and was abandoned in 1854. The Oregon Trail runs through the Treasure Valley. The valley was settled for the most part by ranchers and farmers, initially to supply the gold and silver mining communities in the higher elevations nearby: Idaho City in the Boise Basin and Silver City in the Owyhees. A new Fort Boise was constructed by the U.S. Army in 1863 in present-day Boise, from which the city grew.
Boise metropolitan area
Q4938481 EXACT TITLE 0.960
QID OVERLAP: Q4938481 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:evergreen). | SHARED TOKENS (13): "ada", "boise", "canyon", "component", "counties", "idaho", "largest", "meridian", "metropolitan", "nampa", "population", "treasure", "valley". | EXACT TITLE in police_law_enforcement: "Boise metropolitan area".
adaboisecanyoncomponentcountiesidaholargestmeridianmetropolitannampapopulationtreasurevalley
The Boise, Idaho Metropolitan Statistical Area (MSA) (commonly known as the Boise Metropolitan Area or the Treasure Valley) is an area that encompasses Ada, Boise, Canyon, Gem, and Owyhee counties in southwestern Idaho, anchored by the cities of Boise and Nampa. It is the main component of the wider Boise–Mountain Home–Ontario, ID–OR Combined Statistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian.
Four-year colleges and universities Northwest Nazarene University (NNU), Nampa, Idaho The College of Idaho (C of I), Caldwell, Idaho University of Idaho (U of I), Boise; Extension Campus Idaho State University (ISU), Meridian, Idaho; Extension Campus Community colleges and trade schools College of Western Idaho, Nampa, Idaho (CWI) Nampa; Main Campus, Aspen Classroom Bldg., Canyon County Extension Boise; Ada County Campus Treasure Valley Community College, Caldwell, Idaho (TVCC) Ontario, Oregon; Main Campus Caldwell, Idaho; Caldwell Campus Northwest Lineman College (NLC), Kuna, Idaho Heavy Equipment Operator School of Idaho, Boise Carrington College, Boise Broadview University, Meridian, Idaho University of Phoenix Meridian; Main Campus Boise Bible College, Boise
tistical Area, which adds Elmore and Payette counties in Idaho and Malheur County, Oregon. It is the state's largest officially designated metropolitan area and includes Idaho's three largest cities: Boise, Nampa, and Meridian. Nearly 40 percent of Idaho's total population lives in the area. As of the 2021 estimate, the Boise–Nampa, Idaho Metropolitan Statistical Area (MSA) had a population of 795,268, while the larger Boise City–Mountain Home–Ontario, ID–OR Combined Statistical Area (CSA) had a population of 850,341. The metro area is currently the third largest in the U.S.
Parole
Q5357120 EXACT TITLE 0.940
QID OVERLAP: Q5357120 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (12): "compliance", "conditions", "form", "officers", "originating", "outside", "people", "probation", "rather", "serving", "supervision", "system". | EXACT TITLE in police_law_enforcement: "Parole".
complianceconditionsformofficersoriginatingoutsidepeopleprobationratherservingsupervisionsystem
a system that allows inmates to finish their original sentence outside of prison under supervision. In some jurisdictions in the United States, people may shorten their time on parole through earned compliance credits. Originating from the French word parole ('speech, spoken words' but also 'promise'), the term became associated during the Middle Ages with the release of prisoners who gave their word. This differs greatly from pardon, amnesty or commutation of sentence in that parolees are still considered to be serving their sentences, and may be returned to prison if they violate the conditions of their parole.
Parole, also known as provisional release, supervised release, or being on paper, is a form of early release of a prison inmate where the prisoner agrees to abide by behavioral conditions, including checking in with their designated parole officers, or else they may be rearrested and returned to prison. Parole is not an additional sentence; rather it is a system that allows inmates to finish their original sentence outside of prison under supervision. In some jurisdictions in the United States, people may shorten their time on parole through earned compliance credits. Originating from the French word parole ('speech, spoken words' but also 'promise'), the term became associated during the Middle Ages with the release of prisoners who gave their word. This differs greatly from pardon, amnesty or commutation of sentence in that parolees are still considered to be serving their sentences, and may be returned to prison if they violate the conditions of their parole.
their word. This differs greatly from pardon, amnesty or commutation of sentence in that parolees are still considered to be serving their sentences, and may be returned to prison if they violate the conditions of their parole. It is similar to probation, the key difference being that parole is served for the remainder of a prison sentence, while probation can be granted in place of a prison sentence. History The practice of paroling enemy troops began thousands of years ago, at least as early as the time of Carthage. Parole allowed the prisoners' captors to avoid the burdens of having to feed and care for them while still avoiding having the prisoners rejoin their old ranks once released; it could also allow the captors to recover their own men in a prisoner exchange. Hugo Grotius, an early international lawyer, favorably discussed prisoner of war parole. During the American Civil War, both the Dix–Hill Cartel and the Lieber Code set out rules regarding prisoner of war parole. Francis Lieber's thoughts on parole later reappeared in the Declaration of Brussels of 1874, the Hague Convention, and the Geneva Convention Relative to the Treatment of Prisoners of War. Alexander Maconochie, a Scottish geographer and captain in the Royal Navy, introduced the modern idea of parole when, in 1840, he was appointed superintendent of the British penal colonies in Norfolk Island, Australia. He developed a plan to prepare them for eventual return to society that involved three grades. The first two consisted of promotions earned through good behaviour, labour, and study. The third grade in the system involved conditional liberty outside of prison while obeying rules. A violation would return them to prison and they would start all over again through the ranks of the three-grade process. He reformed its ticket of leave system, instituting what many consider to be the world's first parole system. Prisoners served indeterminate sentences from which they could be released early if they showed evidence of rehabilitation through participation in a graded classification system based on a unit of exchange called a mark. Prisoners earned marks through good behavior, lost them through bad behavior, and could spend them on passage to higher classification statuses ultimately conveying freedom.
Nampa, Idaho
Q622633 QID OVERLAP 0.760
QID OVERLAP: Q622633 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (13): "boise", "canyon", "college", "idaho", "meaning", "meridian", "metropolitan", "nampa", "population", "principal", "student", "university", "western".
boisecanyoncollegeidahomeaningmeridianmetropolitannampapopulationprincipalstudentuniversitywestern
pa ( ) is the most populous city in Canyon County, Idaho, United States. The population was 100,200 at the 2020 census. It is Idaho's third-most populous city. Nampa is about 20 miles (32 km) west of Boise along Interstate 84, and 6 miles (9.7 km) west of Meridian. It is the second principal city of the Boise metropolitan area. The name "Nampa" may have come from a Shoshoni word meaning 'moccasin' or 'footprint'. According to toponymist William O. Bright, the name comes from the Shoshoni word /nampai/, meaning "foot".
History Nampa had its beginnings in the early 1880s when the Oregon Short Line Railroad built a line from Granger, Wyoming, to Huntington, Oregon, that passed through Nampa. In Nampa there is a history museum that marks the railroad's significance. More railroad lines sprang up through Nampa, making it an important railroad town. Alexander and Hannah Duffes established one of the town's first homesteads, eventually forming the Nampa Land and Improvement Company with the help of their friend and co-founder, James McGee. Despite the name, many early settlers called the town "New Jerusalem" because of its citizens' strong religious focus. After only a year the town grew from 15 homes to 50. As amenities were added, Nampa continued to grow, and it was incorporated in 1891. Downtown Nampa's street grid is oriented with the railroad tracks, which run northwest–southeast; this was done intentionally by Alexander Duffes to prevent accidents like one that occurred earlier in a town he had platted near Toronto, where a woman and her two children were killed by a train when their buggy wheel got stuck as they crossed the tracks. As the Oregon Short Line railroad originally bypassed Boise, Nampa has the fanciest of many railroad depots built in the area. Nampa gained attention in 1889 due to a purported archaeological discovery known as the Nampa figurine. George Frederick Wright wrote up details that year for the Boston Society of Natural History. The first elementary school was built in the 1890s. Lakeview School was on a hill on 6th Street and 12th Avenue North, with a view of Lake Ethel. Just after the school's centennial celebration, it was condemned as a school and sold to the First Mennonite Church. In 2008 the building was refurbished, and it is now used by the Idaho Arts Charter School. Lake Ethel, an irrigation reservoir, had long been the site of community picnics, and many citizens fished, swam, boated, and even hunted on it and its surrounding property. But the hunting didn't last long, as O. F. Persons, owner of the adjoining homestead, took offense when local hunters started shooting his pet ducks. The city later auctioned off the lake. E. H. Dewey (a former Nampa mayor) was the only bidder. But occasional flooding led to a series of lawsuits from neighbors. Dewey eventually drained Lake Ethel. Not long after, the city council became interested in buying back the Fritz Miller property as well as the Dewey home. Pressure had been building for more than four years. Nampa citizens wanted another park. On August 7, 1924, the city council passed an ordinance to purchase the Miller property and name it Lakeview Park. A bandstand was completed in 1928, and the municipal swimming pool opened on August 13, 1934. It is Nampa's largest park and many community celebrations are held there. Colonel William H. Dewey, a man who made a fortune mining in Silver City, built the Dewey Palace Hotel in 1902 for $250,000. He died in his hotel in 1903, leaving his son $1 million. The hotel survived the great fire of 1909, which burned several blocks of downtown Nampa, but was razed in 1963 after redevelopment plans failed. Relics from the hotel such as the chandelier and the hotel safe can be found at the Canyon County Historical Museum, which is in the old train depot on Front Street and Nampa City Hall. After demolition the location on First Street between 11th and 12th Ave. South was sold to private enterprise, including a bank and tire store, replacing this building with modern structures. A public-use postage stamp sized park was later placed across the street from the old palace property as a collaboration between the Downtown Alliance of Nampa (the local business council) and an Eagle Scout Project for the Boy Scouts of America. The park includes a large mural/wall sculpture of running horses commissioned for the project. A Carnegie library was built downtown in 1908; it burned down after the library moved in 1966. Nampa Public Library was then on the corner of 1st Street and 11th Avenue South in the old bank building. A new library, on 12th Avenue South, opened in 2015. Deer Flat Reservoir, an offstream irrigation storage reservoir, was constructed by the United States Bureau of Reclamation between 1906 and 1911. Known locally as Lake Lowell, it is surrounded by the Deer Flat National Wildlife Refuge, established in 1909 by President Theodore Roosevelt. The refuge is administered by the U.S. Fish and Wildlife Service. Lake Lowell is filled by the concrete New York Canal; the water is diverted from the Boise River a few miles below Lucky Peak Dam. In 1910, the Idaho State School and Hospital was built northwest of Nampa for the state's developmentally challenged population. It opened in 1918. The institution was largely self-sufficient, with a large farm staffed by the residents. The higher-functioning residents also cared for residents who could not care for themselves. The land for the farm was sold and is now golf courses (Centennial and Ridgecrest), and the residents no longer give primary care to other residents. The institution is modernized and remains in operation, though a few of the oldest buildings now house juvenile offenders. Nampa held an annual harvest festival and farmers' market from about 1908, a time of celebration and community fun. From this festival emerged the Snake River Stampede Rodeo in 1937, which continues to this day. It is one of the top 12 rodeos in the pro rodeo circuits. In 1913, a local congregation of the Church of the Nazarene built a small elementary school, which became to Northwest Nazarene College in 1915 and finally Northwest Nazarene University. As of 2025, the university has approximately 1,800 undergraduate and graduate students. Karcher Mall opened in 1965, the first enclosed shopping mall in the Treasure Valley. It was "the place to gather" for several decades until the Boise Towne Square mall was built in Boise in 1988, drawing business away. Karcher Mall was renamed District 208 in 2022. The Idaho Press-Tribune is the local newspaper for the Canyon County area.
Idaho Hispanic Community Center (IH2C) In 2003, the Hispanic Cultural Center of Idaho (HCCI) opened thanks to community support. It has recently transitioned back to the City of Nampa and was renamed the Idaho Hispanic Community Center (IH2C) and is home to the Idaho Hispanic Foundation. It hosts events, classes, and festivals, including Día de los Muertos, Hispanic Heritage Month, and Día Internacional de la Mujer. It serves as a meeting place for associations and groups. Displays of cultural history are available to the public. Nampa Train Depot Museum The Nampa Train Depot Museum is a historical depot with displays and archives of the area's railroad and cultural history. The Canyon County Historical Society saved the depot from demolition in 1972. Annual Festival of the Arts Nampa's Festival of the Arts, which began in 1987, is held in Lakeview Park every year and includes local art, music, dance, and food.
Boise, Idaho
Q35775 QID OVERLAP 0.760
QID OVERLAP: Q35775 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (13): "ada", "annual", "boise", "capital", "counties", "idaho", "locally", "major", "metropolitan", "population", "technology", "treasure", "valley".
adaannualboisecapitalcountiesidaholocallymajormetropolitanpopulationtechnologytreasurevalley
Boise (locally also ) is the capital and most populous city in the U.S. state of Idaho. It is the county seat of Ada County. The population of the city was 235,685 at the 2020 census. The Boise metropolitan area, located in the Treasure Valley, includes five counties of Idaho with an estimated population of 846,000, the most populous metropolitan area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
an area in Idaho and 95th-most populous in the United States. Located on the Boise River in southwestern Idaho, it is 41 miles (66 km) east of the Oregon border and 110 miles (177 km) north of the Nevada border. Downtown Boise's elevation is 2,704 feet (824 m) above sea level. Boise is home to major employers in the technology, manufacturing, and service sectors, including companies such as Micron Technology and Hewlett-Packard.
...that the military should continue killing Indians 'until the last Indian in the Territories was either on his reservation or enriched the sagebrush with his decaying carcass.' ...if the Indians refused to move there, 'they will be killed or put on the reservation by force, and certainly shot if they don't stay there.' Furthermore, the editor continues, 'The idea that the Indians have any right to the soil is ridiculous. ...They have no more rights to the soil of the Territories of the United States than wolves or coyotes...' This would be our plan of establishing friendship upon an eternal basis with our Indians: Let all the hostile bands of Idaho Territory be called in (they will not be caught in any other manner) to attend a grand treaty; plenty of blankets and nice little trinkets distributed among them; plenty of grub on hand; have a real jolly time with them; then just before the big feast put strychnine in their meat and poison to death the last mother's son of them. At the same time, native warriors around the valley, under the leadership of Howluck also known as "Bigfoot" among white settlers, among others, waged an escalating and intensified guerrilla campaign of harassment of passerby caravans along the Oregon Trail. The United States Army also escalated and intensified "punitive expeditions" against formations of warriors and against civilian communities as well. This marked the start of the "unofficial" Snake War in 1866. This war lasted until 1868, and is statistically the deadliest of the Indian Wars in the West in terms of casualties. In the end, 1,762 men were counted as the casualties of this war from both sides. In 1868, Fort Hall Indian Reservation was established in Southeastern Idaho, about 220 miles upstream, according to the terms of Fort Bridger Treaty. The Boise Valley Shoshone and Bannock Tribes were not party to this treaty. Nevertheless, in April 1869, the United States Military embarked on a campaign of "Removal, rounding up of natives in the region including in and around Boise, and expelling them with cavalry escort to Fort Hall Indian Reservation. This period is known among the Shoshone and Bannock people as Idaho's Trail of Tears. Some of the natives managed to escape, and they ran to either Duck Valley or Fort McDermitt in Nevada. Incorporation and growth Boise's early growth was significantly driven by its role in supplying the nearby gold towns that sprung up in the 1860s northeast and then southwest of the town. Miners sometimes wintered in Boise and a number of early prominent businessmen were miners who settled in town in the years after the gold rush waned. By 1864 substantial agricultural production was underway on easily irrigated lands near the river and three canal companies had been incorporated. Early transportation improvements were largely a result of toll road franchises awarded by the territorial legislature starting in the 1860s. These first ran from Fort Boise to the mining centers in the Boise Basin and east to Rocky Bar and to Rattlesnake Station where they connected to the Oregon Trail. Territorial census records from a special 1864 enumeration list the population of Boise as 1,658, and an act of December 12, 1864, was the first attempt by the Idaho Territorial Legislature to incorporate the city. This was rejected by voters the following March. Two more unsuccessful attempts were made to organize a city administration by election before the 1866 version of the city charter was approved by voters on January 6, 1868. The growing number of homes and businesses, for which owners wanted proper legal title, may have contributed to the eventual success of incorporation. All of these rejected efforts to incorporate the city came after Boise had been controversially made the state capital in 1864 over strong opposition from northern Idaho interests. This decision reflected the rapid shift of population growth from north to south after the discovery of gold in southern Idaho. By 1868 Boise had over 400 permanent buildings with a wide range of commercial services. 1868 also marked the formal beginning of a long advocacy for railroad connections to other Idaho communities and, just as importantly, to other growing cities in the west such as Portland, Oregon. Competing railroad and western state government interests frustrated these efforts for many years. Designed by Alfred B. Mullett, the U.S. Assay Office at 210 Main Street was built in 1871 and today is a National Historic Landmark. It first began accepting gold and silver for purchase on March 2, 1872, largely eliminating the need to transport ore to the mint in San Francisco. A territorial penitentiary, now known as the Old Idaho State Penitentiary, opened the same month several miles east of town. Mining continued to be important to Boise's economic growth and periodic booms contributed to population growth as well, though production of gold and silver probably peaked in the 1860s. 1882's gold and silver production of $3,500,000 declined to $1,488,315 (including lead) by 1899. Boise began to earn its City of Trees nickname in this period with a popular focus on a range of tree planting projects. Thomas J. Davis planted several thousand fruit trees in 1864 and several other early businessmen either founded nurseries or orchards of their own. In the 1870s tree planting began in earnest in downtown Boise led by prominent hotels as well as businessmen and residents. In 1907 Davis donated 43 acres of his orchard property to the city for use as a park in the name of his wife Julia. Commercial agriculture continued to expand, but was slowed by the lack of reliable rail links to regional and national markets and by a lack of large scale irrigation projects, which themselves were often tied to hoped-for railroad projects for financing. A.D. Foote, a successful mining engineer, drew up plans to irrigate up to 500,000 acres immediately south of Boise in 1882, but progress was halting and smaller farms were the norm until after the turn of the century with most located near to the river bottom where soil was productive and irrigation more easily achieved. Fruit orchards proliferated and sugar beets, still an important agricultural industry in Idaho, began to be widely cultivated in the 1890s. Cattle and sheep farming became increasingly important as the century closed. With the exception of dairy, most livestock products were exported from Idaho, unlike other agricultural products which were still largely scaled to support local markets. The timber industry also increasingly thrived in the Boise market in the 1880s and 1890s. Large quantities of timber were exported from elsewhere in Idaho, but a growing Boise supported the expansion of Alexander Rossi's sawmill, first established in 1865. Prominent early Boisean William Ridenbaugh had inherited control of the canal now bearing his name from his uncle William Morris in 1878 and later partnered with Rossi to expand the sawmill capacity under the name Rossi and Ridenbaugh Lumber Company. Their materials supported bridge building and the rapid expansion of Boise in the 1890s. As with many early infrastructure ventures, electrification succeeded only after at least one false start. July 4, 1887, marked the start of electrical transmission from a plant located on the Bench. William Ridenbaugh provided expertise and manpower for the water supply and several months were spent rigging poles and lines from the Bench to the service area across the river. Additional electrical supplies allowed the building of an electric streetcar line in 1891. This ran without interruption until buses replaced the lines in 1927, tracking—and sometimes driving—the development of Boise and nearby communities. This system expanded over several decades, reaching into the North End, South Boise and across the river on Front St. A loop line, completed in 1912, ran as far as Caldwell and Nampa, providing transport throughout the valley. Three early trolley companies merged in 1912 to form the Idaho Traction Company with a depot at 7th and Bannock Streets downtown. Additional services and urban amenities arrived in the 1890s as Boise grew. Exploratory drilling for hot water was successful in 1890 and by the end of the decade many homes along Warm Springs avenue were being heated by this source. A natatorium was built in 1892 close to the source of the hot water near the Idaho State Penitentiary. Churches serving several denominations, a Jewish synagogue, a major hardware store and department store, a Masonic hall, the Columbia Theater, Saint Alphonsus' Hospital, a number of parochial and secular schools, a City Hall and a new Union Pacific passenger station, constructed when service was finally extended to downtown, were all built during the 1890s. Falk's Department Store sponsored a semi-professional baseball team representing Boise from at least 1892 and the city supported other organized sports as they became popular.
Ada County, Idaho
Q109820 QID OVERLAP 0.720
QID OVERLAP: Q109820 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (11): "ada", "boise", "capital", "district", "idaho", "largest", "local", "metropolitan", "population", "private", "washington".
adaboisecapitaldistrictidaholargestlocalmetropolitanpopulationprivatewashington
Ada County is located in the southwestern part of Idaho, United States. As of the 2020 census, the county had a population of 494,967, which by 2025 was estimated to have risen to 546,141. Ada County is by far the state's most populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
populous county; it is home to 26.8% of the state's population. The county seat and largest city is Boise, which is also the state capital. Ada County is included in the Boise metropolitan area. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads.
ea. The Ada County Highway District has jurisdiction over all the local county and city streets, except for private roads and state roads. In the interior Pacific Northwest east of the Cascade Range, Ada County ranks second in population, behind Spokane County, Washington. History Ada County was created by the Idaho Territory legislature on December 22, 1864, partitioned from Boise County. It is named for Ada Riggs, the daughter of H. C. Riggs, a member of the legislature; he established the county and was a co-founder of Boise.
Canyon County, Idaho
Q486078 QID OVERLAP 0.680
QID OVERLAP: Q486078 in police_law_enforcement (tier:evergreen) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "boise", "caldwell", "canyon", "idaho", "largest", "making", "metropolitan", "nampa", "population".
boisecaldwellcanyonidaholargestmakingmetropolitannampapopulation
105, which by 2025 was estimated to have risen to 275,123, making it the second-most populous county in Idaho. The county seat is Caldwell, and its largest city is Nampa. Canyon County is part of the Boise metropolitan area. History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
History Hudson's Bay Company established Fort Boise in 1834 near what is now Parma, but abandoned it in 1855. Emigrants traveled through Canyon County on the Oregon Trail. Discovery of gold in the Boise Basin in 1862 brought settlement to the region again. The lower Boise River was fully contained within Boise County from 1863 until the formation of Ada County in 1864. Settlement of the lower Boise River west of Boise City was limited prior to the completion of the Oregon Short Line Railroad. Middleton was the first European settlement of Canyon County, starting in 1863. The 1870 Census for Ada County listed 76 residents of the Boise Valley, excluding Boise City and the 1880 Census listed 44 residents at Middleton. The arrival of the railroad at Caldwell led to the establishment of a town there as of August 1883. Businessmen James A. McGee and Alexander Duffes filed the plat for nearby Nampa in 1886. Parma was settled around the same time, with the Old Fort Boise post office being moved to the town's location; it was incorporated in 1904. Ada County established precincts for each of the settlements with a combined 1890 Census population of 2,311. Significant settlement of Greenleaf and Notus started around 1904 with the two settlements listed as precincts at the 1910 census. Notus was incorporated in 1921 while Greenleaf was incorporated prior to 1980. Melba was incorporated in 1912 while Wilder was incorporated in 1919. The City of Star annexed a portion of territory in northeast Canyon County prior to 2007, becoming the county's ninth incorporated city. The majority of Star is located within Ada County. The Idaho Legislature created Canyon County from Ada County in an act approved March 7, 1891, effective at the November 26, 1892, election. Caldwell was established as the county seat. The county originally contained all of Canyon and Payette counties and part of Gem; Gem County formed in 1915 and Payette County in 1917.
2000 census As of the 2000 census, there were 131,441 people, 45,018 households and 33,943 families living in the county. The population density was 223 people per square mile (86 people/km2). There were 47,965 housing units at an average density of 81 units per square mile (31 units/km2). The racial makeup of the county was 83.10% White, 0.32% Black or African American, 0.85% Native American, 0.80% Asian, 0.13% Pacific Islander, 12.17% from other races, and 2.62% from two or more races. Hispanic or Latino of any race were 18.61% of the population. 15.9% were of German, 12.7% English, 10.3% American and 7.6% Irish ancestry. There were 45,018 households, of which 39.80% had children under the age of 18 living with them, 60.70% were married couples living together, 10.10% had a female householder with no husband present, and 24.60% were non-families. 19.80% of all households were made up of individuals, and 8.40% had someone living alone who was 65 years of age or older. The average household size was 2.85 and the average family size was 3.28. 30.90% of the population were under the age of 18, 10.70% from 18 to 24, 28.30% from 25 to 44, 19.10% from 45 to 64, and 11.00% who were 65 years of age or older. The median age was 30 years. For every 100 females, there were 98.70 males. For every 100 females age 18 and over, there were 96.30 males. The median household income was $35,884 and the median family income was $40,377. Males had a median income of $29,418 compared with $22,044 for females. The per capita income for the county was $15,155. About 8.70% of families and 12.00% of the population were below the poverty line, including 14.50% of those under age 18 and 10.70% of those age 65 or over. Communities Cities Unincorporated communities Bowmont Huston Roswell Sunnyslope Walters Ferry, Idaho Politics Like the majority of Idaho, Canyon County is reliably Republican by comfortable margins. The last time a Democratic candidate carried the county was in 1936 by Franklin D. Roosevelt.
Caldwell, Idaho
Q849592 QID OVERLAP 0.680
QID OVERLAP: Q849592 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (9): "approximately", "boise", "caldwell", "canyon", "college", "idaho", "locally", "metropolitan", "population".
approximatelyboisecaldwellcanyoncollegeidaholocallymetropolitanpopulation
city in Idaho. As of the 2020 census, Caldwell had a population of 59,996. Caldwell is considered part of the Boise metropolitan area, and is the location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
location of the College of Idaho. The city is located approximately 24 miles (39 km) west of Boise, and approximately 17 miles (27 km) east of the Oregon border. History The present-day location of Caldwell is along a natural passageway to the Inland and Pacific Northwest. Native American tribes from the west coast, north Idaho and as far away as Colorado came to the banks of the Boise River for annual trading fairs, or rendezvous. European and some Hawaiian explorers and traders soon followed the paths left by Native Americans and hopeful emigrants later forged the Oregon Trail and followed those paths to seek a better life in the Oregon Territory. Pioneers of the Trail traveled along the Boise River to Canyon Hill and forded the river close to the Silver Bridge on Plymouth Street. During the Civil War, the discovery of gold in Idaho's mountains brought a variety of new settlers into the area. Many never made it to the mines but settled along the Boise River and run ferries, stage stations, and freighting businesses. These early entrepreneurs created small ranches and farms in the river valleys. Caldwell's inception occurred largely as a result of the construction of the Oregon Short Line Railroad, which connected Wyoming to Oregon through Idaho. Robert E. Strahorn came to the Boise River Valley in 1883 to select a route for the railroad. He rejected the grade into Boise City as too steep and chose a site 30 miles to the west. He drove a stake into an alkali flat of sagebrush and greasewood and the City of Caldwell was platted. Caldwell was named after one of Strahorn's business partners, Alexander Caldwell, a former senator from Kansas. When Caldwell was platted in August 1883, its founder, the Idaho and Oregon Land Improvement Company, started persuading settlers and businessmen to move to the area. Within four months, Caldwell had 600 residents living in 150 dwellings, 40 businesses, a school, a telephone exchange, and two newspapers. On January 15, 1890, the Board of Commissioners of Ada County issued a handwritten order incorporating the City of Caldwell. The College of Idaho was founded in Caldwell in 1891. In 1892, Canyon County was established from a portion of Ada County, and Caldwell was named the county seat. Irrigation canals and waterways were constructed throughout Canyon County, providing the foundation for an agricultural economy. The Oregon Short Line Railroad became part of the larger Union Pacific Railroad network and in 1906 the Caldwell freight and passenger depot was constructed. Caldwell experienced moderate growth as an agricultural processing, commercial retail and educational center during the 20th century. In 2009, the City of Caldwell completed a revitalization project to restore Indian Creek, which runs through downtown Caldwell, but had been used for sewage disposal by local industries and been covered over.
Meridian, Idaho
Q1085274 QID OVERLAP 0.660
QID OVERLAP: Q1085274 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (8): "ada", "among", "boise", "capital", "idaho", "making", "meridian", "population".
adaamongboisecapitalidahomakingmeridianpopulation
Meridian is a city located in Ada County, Idaho, United States. The population was 117,635 at the 2020 census, making it the second most populous city in the county and Idaho, after Boise, the state capital.
Rail transportation (1908–28) Following the raising of $4,000 to lay the Interurban rail line from Onweiler (Meridian and Ustick Roads), the tracks were completed into the village center. Turning east on Broadway and ending at East Second, the last car would spend the night in Meridian before returning to Boise early the next morning with passengers and freight. The interurban Station and Generator building (west one-third of the old library at Meridian and Idaho Streets) was built in 1912, and the line continued on to Nampa via Meridian. The tracks down Broadway were not used after 1912. The Interurban Company entered into receivership and closed in 1928 after 20 years of providing continuous transportation to neighboring towns. It was Meridian's main connection to the area outside the local community. The Union Pacific Railroad spur opened in 1900 and is currently operated by the Boise Valley Railroad. Many industrial customers continue to ship forest, agricultural, and chemical products along this corridor. Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Creamery (1929–70) The city's official website describes the history of the Ada County Dairymen's cooperative creamery as follows:The lowest days of the Great Depression brightened for area dairymen when the Ada County Dairymen's cooperative creamery began operation in 1929. It provided milk checks to those who were members of the cooperative, enabling them to pay their taxes and provide food for their families. Other community members hauled milk to the creamery and were employed by the creamery, whose product was Challenge Butter. The creamery ran seven days a week for 40 years. Additions and improvements were made while the plant was in full operation. Later years saw the Wyeth Laboratories affiliate with the creamery to manufacture SMA baby formula.
Driving under the influence
Q250062 QID OVERLAP 0.640
QID OVERLAP: Q250062 in police_law_enforcement (tier:branch) and substance_use_recovery (tier:branch). | SHARED TOKENS (7): "alcohol", "control", "drug", "drugs", "influence", "operating", "prescription".
alcoholcontroldrugdrugsinfluenceoperatingprescription
ng under the influence (DUI) or driving while intoxicated (DWI) is the crime of driving, operating, or being in control of a vehicle while one is impaired from doing so safely by the effect of either alcohol (see drunk driving) or some other drug, whether recreational or prescription (see drug-impaired driving). Multiple other terms are used for the offense in various jurisdictions. Terminology The name of the offense varies from jurisdiction to jurisdiction and from legal to colloquial terminology. In various jurisdictions the offense is termed "driving under the influence" [of alcohol or other drugs] (DUI), "driving under the influence of intoxicants" (DUII), "driving while impaired" (DWI), "impaired driving", "driving while intoxicated" (DWI), "operating while intoxicated" (OWI), "operating under the influence" (OUI), "operating [a] vehicle under the influence" (OVI), "drunk in charge" (DIC), or "over the prescribed limit" (OPL) (in the UK). Alcohol-related DUI is referred to as "drunk driving", "drunken driving", or "drinking and driving" (US), or "drink-driving" (UK/Ireland/Australia).
Terminology The name of the offense varies from jurisdiction to jurisdiction and from legal to colloquial terminology. In various jurisdictions the offense is termed "driving under the influence" [of alcohol or other drugs] (DUI), "driving under the influence of intoxicants" (DUII), "driving while impaired" (DWI), "impaired driving", "driving while intoxicated" (DWI), "operating while intoxicated" (OWI), "operating under the influence" (OUI), "operating [a] vehicle under the influence" (OVI), "drunk in charge" (DIC), or "over the prescribed limit" (OPL) (in the UK). Alcohol-related DUI is referred to as "drunk driving", "drunken driving", or "drinking and driving" (US), or "drink-driving" (UK/Ireland/Australia).
Definition In typical usage of the terms DUI, DWI, OWI, and OVI, the offense consists of driving a vehicle while affected by alcohol or drugs. However, in the majority of US states, the criminal offense may not involve actual driving of the vehicle but rather may broadly include operating or being physically in control of a motor vehicle while under the influence, even if the person charged is not in the act of driving. For example, individuals found in the driver's seat of a car while intoxicated and holding the car keys, even while parked, may be charged with DUI because they are in control of the vehicle. In contrast, California only makes it illegal to drive a motor vehicle while under the influence, requiring actual "driving". "The distinction between these two terms is material, for it is generally held that the word 'drive,' as used in statutes of this kind, usually denotes movement of the vehicle in some direction, whereas the word 'operate' has a broader meaning so as to include not only the motion of the vehicle but also acts which engage the machinery of the vehicle that, alone or in sequence, will set in motion the motive power of the vehicle." Many DUI laws also apply to motorcycling, boating, piloting aircraft, use of mobile farm machinery such as tractors and combine harvesters, riding horses or driving a horse-drawn vehicle, cycling, or skateboarding, possibly with different BAC level than regular driving. In some jurisdictions, there are separate charges depending on the vehicle used. In Washington state, for instance, BUI (bicycling under the influence) laws recognize that intoxicated cyclists are likely to primarily endanger themselves. Accordingly, law enforcement officers are empowered only to protect the cyclist by impounding the bicycle rather than filing DUI charges. George Smith, a London Taxi cab driver, ended up being the first person to be convicted of driving a motor vehicle while intoxicated, on September 10, 1897, under the "drunk in charge" provision of the 1872 Licensing Act. He was fined 20 shillings, which is equivalent to £112 in 2025. Alcohol Drunk driving (or drink-driving in British English) is the act of driving under the influence of alcohol. A small increase in the blood alcohol content increases the relative risk of a motor vehicle crash. In the United States, alcohol is involved in 30% of all traffic fatalities.
◈ Cross-Vertical Edge Ledger
All Additional Edges — Deterministic Matching
241 EDGES
◈ ADDITIONAL CROSS EDGES · NON-OVERLAP241 edges
🌲 EVERGREEN2 edges
0.650
agencyboisecenterscertifiedcommunitycorrectionaldepartmentenforcementidaholawleadershipmeridianofficerofficersoperatespeopleprobationstandardsthemtraining
SHARED TOKENS (20): "agency", "boise", "centers", "certified", "community", "correctional", "department", "enforcement", "idaho", "law", "leadership", "meridian", "officer", "officers", "operates", "people", "probation", "standards", "them", "training". | URL->A (1): https://www.idoc.idaho.gov/. | EXACT TITLE in police_law_enforcement: "Idaho Department of Correction".
0.650
adaboisecentercommercialdepartmentfacilityfunctionsgeneralidahoincreaseinteragencynationalofficeroperatedoperatesportionprotectionrightssupportuses
SHARED TOKENS (21): "ada", "boise", "center", "commercial", "department", "facility", "functions", "general", "idaho", "increase", "interagency", "national", "officer", "operated", "operates", "portion", "protection", "rights", "support", "uses".... | URL->A (1): http://www.iflyboise.com/. | EXACT TITLE in police_law_enforcement: "Boise Airport".
🌿 BRANCH192 edges
0.500
actionscentercostsformsinformationinternetinvolvingmakespreventionreportsafetysecurityseparatedsinglesocialstudiesstudy
SHARED TOKENS (17): "actions", "center", "costs", "forms", "information", "internet", "involving", "makes", "prevention", "report", "safety", "security", "separated", "single", "social", "studies", "study". | EXACT TITLE in police_law_enforcement: "Internet fraud".
0.500
alcoholbusinesscostdrugsenvironmentfinancialhouseindependentlatermodeloperatingorganizationresidentsrulessupportivesystemtodaytreatment
SHARED TOKENS (18): "alcohol", "business", "cost", "drugs", "environment", "financial", "house", "independent", "later", "model", "operating", "organization", "residents", "rules", "supportive", "system", "today", "treatment". | EXACT TITLE in substance_use_recovery: "Oxford House".
0.500
amongbecomecarecoordinationcriticaldecadesdepartmentsdirectlyemergencyfrontlinegeneralhospitalinterventionsmedicalmedicinemodelpracticeprimaryprogramsproviders
SHARED TOKENS (29): "among", "become", "care", "coordination", "critical", "decades", "departments", "directly", "emergency", "frontline", "general", "hospital", "interventions", "medical", "medicine", "model", "practice", "primary", "programs", "providers".... | EXACT TITLE in substance_use_recovery: "Emergency medicine".
0.500
SWAT ↗ Q324563 EXACT TITLE
amongannualcontrolcrisisdrugsenforcementforcegenericincreasedlawofficerspoliceresearchschoolsearchservesignificantspecializedstudyteams
SHARED TOKENS (22): "among", "annual", "control", "crisis", "drugs", "enforcement", "force", "generic", "increased", "law", "officers", "police", "research", "school", "search", "serve", "significant", "specialized", "study", "teams".... | EXACT TITLE in police_law_enforcement: "SWAT".
0.500
Police ↗ Q35535 EXACT TITLE
activitiesactivityagainstagencyauthorizedbecomecontextdecadesdefensedepartmentdevelopeddifferentenforcementenforcingforcehealthitselflawlegalmembers
SHARED TOKENS (41): "activities", "activity", "against", "agency", "authorized", "become", "context", "decades", "defense", "department", "developed", "different", "enforcement", "enforcing", "force", "health", "itself", "law", "legal", "members".... | EXACT TITLE in police_law_enforcement: "Police". | EXACT TITLE in substance_use_recovery: "Police".
0.500
Cocaine ↗ Q41576 EXACT TITLE
administrationaffectcausecentralcontrolcostdeathdevelopmentdruggroupshistoricallyincreasedleadlegallocalmarketmedicalorganizedpotentialproduction
SHARED TOKENS (30): "administration", "affect", "cause", "central", "control", "cost", "death", "development", "drug", "groups", "historically", "increased", "lead", "legal", "local", "market", "medical", "organized", "potential", "production".... | EXACT TITLE in police_law_enforcement: "Cocaine".
0.500
accessbecomecarecenterdepartmentdepartmentsemergencyentryfacilityhospitalhospitalsmeansmedicalmedicineoperatepresentprimaryrequirestaffingtreatment
SHARED TOKENS (21): "access", "become", "care", "center", "department", "departments", "emergency", "entry", "facility", "hospital", "hospitals", "means", "medical", "medicine", "operate", "present", "primary", "require", "staffing", "treatment".... | EXACT TITLE in police_law_enforcement: "Emergency department". | EXACT TITLE in substance_use_recovery: "Emergency department".
0.500
anotherapplyassistancecapacitydeathemergencyinjuryintendedkeeplawlegalmedicaloperatepeopleprofessionalprotectionreducerequiresrightssystem
SHARED TOKENS (22): "another", "apply", "assistance", "capacity", "death", "emergency", "injury", "intended", "keep", "law", "legal", "medical", "operate", "people", "professional", "protection", "reduce", "requires", "rights", "system".... | EXACT TITLE in substance_use_recovery: "Good Samaritan law".
0.500
againstcasecausecourtcriminaldescribingequivalentevidencefactsformalinformationkeepknowledgelawlegalpeoplepersonpoliceproceduresrequired
SHARED TOKENS (24): "against", "case", "cause", "court", "criminal", "describing", "equivalent", "evidence", "facts", "formal", "information", "keep", "knowledge", "law", "legal", "people", "person", "police", "procedures", "required".... | EXACT TITLE in police_law_enforcement: "Probable cause".
0.500
againstcontrolleddrugdrugsevengovernmentincorporatedlawnationalpotentiallyprescriptionproductionregulatedsinglesubstanceswhose
SHARED TOKENS (16): "against", "controlled", "drug", "drugs", "even", "government", "incorporated", "law", "national", "potentially", "prescription", "production", "regulated", "single", "substances", "whose". | EXACT TITLE in police_law_enforcement: "Controlled substance". | EXACT TITLE in substance_use_recovery: "Controlled substance".
0.500
Heroin ↗ Q60168 EXACT TITLE
administrationamongapproximatelyaroundcontextcontrolleddrugdrugsformfunctionhistoryincreasedpeoplepossessproductionrapidsidesinglesubstancestreatment
SHARED TOKENS (21): "administration", "among", "approximately", "around", "context", "controlled", "drug", "drugs", "form", "function", "history", "increased", "people", "possess", "production", "rapid", "side", "single", "substances", "treatment".... | EXACT TITLE in police_law_enforcement: "Heroin".
0.500
activitiesagencyalcoholannualbudgetcriminaldepartmentenforcementfederalhandlinginvolvingjusticelawlicensinglocalofficersoperatesoperationpreventionproducts
SHARED TOKENS (25): "activities", "agency", "alcohol", "annual", "budget", "criminal", "department", "enforcement", "federal", "handling", "involving", "justice", "law", "licensing", "local", "officers", "operates", "operation", "prevention", "products".... | EXACT TITLE in police_law_enforcement: "Bureau of Alcohol, Tobacco, Firearms and Explosives".
0.500
Fentanyl ↗ Q407541 EXACT TITLE
actionsalongsideamongcasedeathdrugdrugsfamilyfederalformhealthhealthcareincreasedinvolvingleadlocalmakesmanagementmedicalmedicine
SHARED TOKENS (31): "actions", "alongside", "among", "case", "death", "drug", "drugs", "family", "federal", "form", "health", "healthcare", "increased", "involving", "lead", "local", "makes", "management", "medical", "medicine".... | EXACT TITLE in substance_use_recovery: "Fentanyl".
0.500
Clery Act ↗ Q5131951 EXACT TITLE
actagainstcampuscodecollegescompliancedepartmentdisclosureeducationfederalfinancialinformationinstitutionskeeplawpolicyprogramsrequiressafetysecurity
SHARED TOKENS (23): "act", "against", "campus", "code", "colleges", "compliance", "department", "disclosure", "education", "federal", "financial", "information", "institutions", "keep", "law", "policy", "programs", "requires", "safety", "security".... | EXACT TITLE in police_law_enforcement: "Clery Act".
0.500
accessamongcarecasecaseschildcommunitiescommunitycontroldevelopeddevelopmentdifferenteducationevenhealthhealthcarehumaninfrastructureinterventionsknowledge
SHARED TOKENS (50): "access", "among", "care", "case", "cases", "child", "communities", "community", "control", "developed", "development", "different", "education", "even", "health", "healthcare", "human", "infrastructure", "interventions", "knowledge".... | EXACT TITLE in police_law_enforcement: "Public health".
0.500
casescenterscourtcriminalentryevenhistoryindividualinformationnationalpersonpolicepotentialrecordrecordsrelevant
SHARED TOKENS (16): "cases", "centers", "court", "criminal", "entry", "even", "history", "individual", "information", "national", "person", "police", "potential", "record", "records", "relevant". | EXACT TITLE in substance_use_recovery: "Criminal record".
0.500
centercenterscentralcomputercontroldatadispatchdisplaysemergencyfunctionsinformationmaintenanceoperatorspermitpersonnelpublicpublic-safetyresourcessafetystatus
SHARED TOKENS (26): "center", "centers", "central", "computer", "control", "data", "dispatch", "displays", "emergency", "functions", "information", "maintenance", "operators", "permit", "personnel", "public", "public-safety", "resources", "safety", "status".... | EXACT TITLE in police_law_enforcement: "Computer-aided dispatch".
0.500
accountabilityagainstagenciesbehaviorcontroldepartmentsemploymentenforcementindependentindividuallawofficersoversightpoliceproceduresprocesspublicratherresearchreview
SHARED TOKENS (23): "accountability", "against", "agencies", "behavior", "control", "departments", "employment", "enforcement", "independent", "individual", "law", "officers", "oversight", "police", "procedures", "process", "public", "rather", "research", "review".... | EXACT TITLE in police_law_enforcement: "Police accountability".
0.500
analysisanotherbehaviorcommunitycontroldrugeducationalfamilyframeworkhealthinterventionslargestmanagementmodelproceduresproduceprogramrulestrainingtreatment
SHARED TOKENS (21): "analysis", "another", "behavior", "community", "control", "drug", "educational", "family", "framework", "health", "interventions", "largest", "management", "model", "procedures", "produce", "program", "rules", "training", "treatment".... | EXACT TITLE in substance_use_recovery: "Contingency management".
0.500
Cybercrime ↗ Q29137 EXACT TITLE
accessactionsactivitiesagainstcausecomputercriminaldatadetectiondigitalfinancialgovernmentsgroupsinformationinternetinvolvingmajornetworknetworksorganizations
SHARED TOKENS (35): "access", "actions", "activities", "against", "cause", "computer", "criminal", "data", "detection", "digital", "financial", "governments", "groups", "information", "internet", "involving", "major", "network", "networks", "organizations".... | EXACT TITLE in police_law_enforcement: "Cybercrime".
0.500
administrationadministrativeanalysisconcerningcostcostsdifferentdocumenteddutiesestablishedevaluationfundinginformationintendedlawmanagementmarketoutcomespeoplepolicies
SHARED TOKENS (43): "administration", "administrative", "analysis", "concerning", "cost", "costs", "different", "documented", "duties", "established", "evaluation", "funding", "information", "intended", "law", "management", "market", "outcomes", "people", "policies".... | EXACT TITLE in substance_use_recovery: "Program evaluation".
0.500
activityaffectsamongcausechangesclassificationcontrolleddifferentdrugdrugsfullhealthhistoryhourincreasemedicalmedicineorganizationpotentialpotentially
SHARED TOKENS (28): "activity", "affects", "among", "cause", "changes", "classification", "controlled", "different", "drug", "drugs", "full", "health", "history", "hour", "increase", "medical", "medicine", "organization", "potential", "potentially".... | EXACT TITLE in substance_use_recovery: "Buprenorphine".
0.500
approachesarticlebehaviorcentralchangescoredescribeddescriptiondevelopedexperienceinfluencemakingproblemprocedurespublishedratherrelationshiptreatment
SHARED TOKENS (18): "approaches", "article", "behavior", "central", "changes", "core", "described", "description", "developed", "experience", "influence", "making", "problem", "procedures", "published", "rather", "relationship", "treatment". | EXACT TITLE in substance_use_recovery: "Motivational interviewing".
0.500
Prison ↗ Q40357 EXACT TITLE
administrationauthoritycentercorrectionalcriminal-justicedetentionfacilityformsfunctionsgoverninggroupshousejusticelawneutralpeopleprimaryprocessservesystem
SHARED TOKENS (20): "administration", "authority", "center", "correctional", "criminal-justice", "detention", "facility", "forms", "functions", "governing", "groups", "house", "justice", "law", "neutral", "people", "primary", "process", "serve", "system". | EXACT TITLE in police_law_enforcement: "Prison".
0.500
Pharmacy ↗ EXACT TITLE
becomecarecommunitydirectdrugdrugshealthinformationinstitutionallinksmodernofficepharmaciespracticeprimaryproductsprofessionalrelatedsafesafety
SHARED TOKENS (23): "become", "care", "community", "direct", "drug", "drugs", "health", "information", "institutional", "links", "modern", "office", "pharmacies", "practice", "primary", "products", "professional", "related", "safe", "safety".... | EXACT TITLE in substance_use_recovery: "Pharmacy".
0.500
amongcarechangescollectioncombinescommunicationconditionsdatadecadesdifferentdigitalhealthhealthcarehistoryidentifyinformationmeansmedicalnetworksopen
SHARED TOKENS (35): "among", "care", "changes", "collection", "combines", "communication", "conditions", "data", "decades", "different", "digital", "health", "healthcare", "history", "identify", "information", "means", "medical", "networks", "open".... | EXACT TITLE in substance_use_recovery: "Electronic health record".
0.500
actactiveanotherconditionscontrolcriminaldrugforcefrequentlyhealthorganizationssafetyshowthemusesviolence
SHARED TOKENS (16): "act", "active", "another", "conditions", "control", "criminal", "drug", "force", "frequently", "health", "organizations", "safety", "show", "them", "uses", "violence". | EXACT TITLE in police_law_enforcement: "Violent crime".
0.500
actagainstbecomechildrencommercialdecadesdistinctenforcementforceformformshumanindividuallaborlegalmodernnationalorganizationspeoplepolicies
SHARED TOKENS (24): "act", "against", "become", "children", "commercial", "decades", "distinct", "enforcement", "force", "form", "forms", "human", "individual", "labor", "legal", "modern", "national", "organizations", "people", "policies".... | EXACT TITLE in police_law_enforcement: "Human trafficking".
0.500
connectioncontroldisclosuredistincteducationemergencyexperienceformsknowledgemedicalmeetmembersorganizationspeoplepersonpersonnelpositionpracticalrelationshiprelevant
SHARED TOKENS (30): "connection", "control", "disclosure", "distinct", "education", "emergency", "experience", "forms", "knowledge", "medical", "meet", "members", "organizations", "people", "person", "personnel", "position", "practical", "relationship", "relevant".... | EXACT TITLE in substance_use_recovery: "Peer support".
0.500
actadministrationagenciesclassificationcontrolcontrolleddeadecisionsdrugdrugsenforcementestablishingfederalfoodlawmedicalnationalpolicypotentialprevention
SHARED TOKENS (27): "act", "administration", "agencies", "classification", "control", "controlled", "dea", "decisions", "drug", "drugs", "enforcement", "establishing", "federal", "food", "law", "medical", "national", "policy", "potential", "prevention".... | EXACT TITLE in substance_use_recovery: "Controlled Substances Act".
0.500
Medicaid ↗ Q1141363 EXACT TITLE
accessactannualbecomebenefitscarechildrencostcostscourtcoverageeligibilityestablishedexpandedfederalfinancialfundinggeneralgovernmentgovernments
SHARED TOKENS (48): "access", "act", "annual", "become", "benefits", "care", "children", "cost", "costs", "court", "coverage", "eligibility", "established", "expanded", "federal", "financial", "funding", "general", "government", "governments".... | EXACT TITLE in police_law_enforcement: "Medicaid". | EXACT TITLE in substance_use_recovery: "Medicaid".
0.500
Social work ↗ Q205398 EXACT TITLE
administrationadvocacyagenciesartsbecomechildcommunitiescommunitydevelopeddevelopmentdirectlydisciplineeducationfamilygovernmentgroupshealthhumanindividualinterventions
SHARED TOKENS (40): "administration", "advocacy", "agencies", "arts", "become", "child", "communities", "community", "developed", "development", "directly", "discipline", "education", "family", "government", "groups", "health", "human", "individual", "interventions".... | EXACT TITLE in substance_use_recovery: "Social work".
0.500
authoritybehaviorcapacitycausechangeschildchildrenconcerningcontextcourtcourtscreatecriminaldatadevelopmentdifferentlyexactgeneralincreasinglyintervention
SHARED TOKENS (44): "authority", "behavior", "capacity", "cause", "changes", "child", "children", "concerning", "context", "court", "courts", "create", "criminal", "data", "development", "differently", "exact", "general", "increasingly", "intervention".... | EXACT TITLE in police_law_enforcement: "Juvenile court".
0.500
activeactivityamongbeyondcentralchangescontinuouslycontrolleddrugdrugsformsfunctionhumanidenticalincreaseinjuryinvolvingleadplacementpossess
SHARED TOKENS (32): "active", "activity", "among", "beyond", "central", "changes", "continuously", "controlled", "drug", "drugs", "forms", "function", "human", "identical", "increase", "injury", "involving", "lead", "placement", "possess".... | EXACT TITLE in police_law_enforcement: "Methamphetamine".
0.500
activitiesagenciesbeyondcollegecreditdevelopmentdifferentdivisioneducationformalformsfrequentlygeneralgovernmentinstitutionalintendedlifeoperationprofessionalprograms
SHARED TOKENS (32): "activities", "agencies", "beyond", "college", "credit", "development", "different", "division", "education", "formal", "forms", "frequently", "general", "government", "institutional", "intended", "life", "operation", "professional", "programs".... | EXACT TITLE in substance_use_recovery: "Continuing education".
0.500
administrationagencyapproximatelyauthoritybudgetconnectingdatadepartmentdetectionemployedenforcementfacilitiesfederalfiscalgovernmentgroupsidentificationlawlocalmission
SHARED TOKENS (42): "administration", "agency", "approximately", "authority", "budget", "connecting", "data", "department", "detection", "employed", "enforcement", "facilities", "federal", "fiscal", "government", "groups", "identification", "law", "local", "mission".... | EXACT TITLE in police_law_enforcement: "Transportation Security Administration".
0.500
activitiesagenciesagencyauthoritybuildingcentralcollectioncommunitycoordinationcriminaldepartmentdomesticenforcementestablishedfederalfunctionfunctionsgeneralgovernmentjustice
SHARED TOKENS (40): "activities", "agencies", "agency", "authority", "building", "central", "collection", "community", "coordination", "criminal", "department", "domestic", "enforcement", "established", "federal", "function", "functions", "general", "government", "justice".... | EXACT TITLE in police_law_enforcement: "Federal Bureau of Investigation".
0.500
Methadone ↗ Q179996 EXACT TITLE
amongdailydevelopedfrequentlyfunctionhealthinvolvinglifemaintenancemanagementmedicineorganizationpeoplerapidriskssidesingletreatment
SHARED TOKENS (18): "among", "daily", "developed", "frequently", "function", "health", "involving", "life", "maintenance", "management", "medicine", "organization", "people", "rapid", "risks", "side", "single", "treatment". | EXACT TITLE in substance_use_recovery: "Methadone".
0.500
Drug court ↗ Q5308883 EXACT TITLE
addresscommunitiescourtcourtscriminaldefensedrugenforcementhealthlawmodelpotentiallyprobationprocesspublicreducesocialspecializedtestingtreatment
SHARED TOKENS (21): "address", "communities", "court", "courts", "criminal", "defense", "drug", "enforcement", "health", "law", "model", "potentially", "probation", "process", "public", "reduce", "social", "specialized", "testing", "treatment".... | EXACT TITLE in substance_use_recovery: "Drug court".
0.500
addressapproachesassociationbehaviorchangingchildrencombinesconditionsdevelopeddevelopmentformformshealthidentifiedindividualmaintenancemedicalnationaloriginatingprocess
SHARED TOKENS (29): "address", "approaches", "association", "behavior", "changing", "children", "combines", "conditions", "developed", "development", "form", "forms", "health", "identified", "individual", "maintenance", "medical", "national", "originating", "process".... | EXACT TITLE in substance_use_recovery: "Cognitive behavioral therapy".
0.500
Psychology ↗ Q9418 EXACT TITLE
activityanotherassessmentbehaviorboundariesdevelopmentdisciplineeducationemployedfamilyfunctionsgroupshealthhospitalshumanindividualknowledgelinkingmediamedical
SHARED TOKENS (36): "activity", "another", "assessment", "behavior", "boundaries", "development", "discipline", "education", "employed", "family", "functions", "groups", "health", "hospitals", "human", "individual", "knowledge", "linking", "media", "medical".... | EXACT TITLE in substance_use_recovery: "Psychology".
0.500
accessactivitiesactivityagainstalcoholanotherapproachescarechangesdifferentdrugeducationenvironmentfacilitiesfoodhealthhomelessnesshumaninformationlegal
SHARED TOKENS (45): "access", "activities", "activity", "against", "alcohol", "another", "approaches", "care", "changes", "different", "drug", "education", "environment", "facilities", "food", "health", "homelessness", "human", "information", "legal".... | EXACT TITLE in substance_use_recovery: "Harm reduction".
0.500
actagainstagencieschildchildrencreditdepartmentenforcementfederalforceinternetjusticejuvenilelawlocalnationalnetworkofficeofficersoperation
SHARED TOKENS (27): "act", "against", "agencies", "child", "children", "credit", "department", "enforcement", "federal", "force", "internet", "justice", "juvenile", "law", "local", "national", "network", "office", "officers", "operation".... | EXACT TITLE in police_law_enforcement: "Internet Crimes Against Children Task Force".
0.500
Pharmacist ↗ Q105186 EXACT TITLE
actionsamongcarecollegescommunitydifferentdrugdrugseducationgovernmenthealthhealthcarehospitalknowledgelegallicensingmanagementmasterpositionspotential
SHARED TOKENS (38): "actions", "among", "care", "colleges", "community", "different", "drug", "drugs", "education", "government", "health", "healthcare", "hospital", "knowledge", "legal", "licensing", "management", "master", "positions", "potential".... | EXACT TITLE in substance_use_recovery: "Pharmacist".
0.500
Alcoholism ↗ Q15326 EXACT TITLE
affectedaffectsalcoholamongchildcontextcontrolledcostcostsdevelopmentdirectlyenvironmentevidenceformsgroupshealthhistoricalincreaseincreasedindividual
SHARED TOKENS (45): "affected", "affects", "alcohol", "among", "child", "context", "controlled", "cost", "costs", "development", "directly", "environment", "evidence", "forms", "groups", "health", "historical", "increase", "increased", "individual".... | EXACT TITLE in substance_use_recovery: "Alcoholism".
0.500
Telehealth ↗ Q46994 EXACT TITLE
accessadministrationanotherbridgecarecasecommunicationconditionsdatadefinesdigitaleducationevenfacilitiesfundinghealthhealthcareinformationintegrationmanagement
SHARED TOKENS (38): "access", "administration", "another", "bridge", "care", "case", "communication", "conditions", "data", "defines", "digital", "education", "even", "facilities", "funding", "health", "healthcare", "information", "integration", "management".... | EXACT TITLE in substance_use_recovery: "Telehealth".
0.500
approachescannotcasescenterchildchildrenconnectcriminaldatadeathdepartmentfamilyformalinformationlawlegalnationalofficialorganizationspeople
SHARED TOKENS (29): "approaches", "cannot", "cases", "center", "child", "children", "connect", "criminal", "data", "death", "department", "family", "formal", "information", "law", "legal", "national", "official", "organizations", "people".... | EXACT TITLE in police_law_enforcement: "Missing person".
0.500
actadministrationagencyassistancecourtcriminaldecisionsdepartmentdistrictenforcementenforcingestablishedfederalforcegeneralgovernmenthistoryjudicialjusticelaw
SHARED TOKENS (36): "act", "administration", "agency", "assistance", "court", "criminal", "decisions", "department", "district", "enforcement", "enforcing", "established", "federal", "force", "general", "government", "history", "judicial", "justice", "law".... | EXACT TITLE in police_law_enforcement: "United States Marshals Service".
0.500
demandemergencyformalformsgovernmenthomelessnesshousingincreasedindexlocalnationalownershiprecognizedresponsesocial
SHARED TOKENS (15): "demand", "emergency", "formal", "forms", "government", "homelessness", "housing", "increased", "index", "local", "national", "ownership", "recognized", "response", "social". | EXACT TITLE in substance_use_recovery: "Affordable housing".
0.500
agreementalcoholamongapproximatelyconcerningdevelopmentdrugsevaluationfamilygeneralhealthincorporatedindividualinternetinterventionmedicalmedicinemembersorganizationsoversight
SHARED TOKENS (38): "agreement", "alcohol", "among", "approximately", "concerning", "development", "drugs", "evaluation", "family", "general", "health", "incorporated", "individual", "internet", "intervention", "medical", "medicine", "members", "organizations", "oversight".... | EXACT TITLE in substance_use_recovery: "Addiction medicine".
0.500
alcoholamongcausecentralconcerningconditionscontrolledcoredeathdepartmentdrugdrugsenvironmentfacilitiesfrequentlygovernmenthealthincreasedmajormedical
SHARED TOKENS (40): "alcohol", "among", "cause", "central", "concerning", "conditions", "controlled", "core", "death", "department", "drug", "drugs", "environment", "facilities", "frequently", "government", "health", "increased", "major", "medical".... | EXACT TITLE in substance_use_recovery: "Benzodiazepine".
0.500
analysiscasescriminaldatadefensedevelopedemployedevidencefinancialgovernedgovernmentlawlegalmajormodernpatternspracticespreserveprivaterelated
SHARED TOKENS (26): "analysis", "cases", "criminal", "data", "defense", "developed", "employed", "evidence", "financial", "governed", "government", "law", "legal", "major", "modern", "patterns", "practices", "preserve", "private", "related".... | EXACT TITLE in police_law_enforcement: "Forensic science".
0.500
activedailyeducationalengagementfacilitiesfacilityfamilygroupshealthhospitalindividualoperatesparticipationprogramprogrammingprogramsrequireresidentialscalesmall
SHARED TOKENS (25): "active", "daily", "educational", "engagement", "facilities", "facility", "family", "groups", "health", "hospital", "individual", "operates", "participation", "program", "programming", "programs", "require", "residential", "scale", "small".... | EXACT TITLE in substance_use_recovery: "Intensive outpatient program".
0.500
Nursing ↗ Q121176 EXACT TITLE
actcarecertificationchangingcomponentdemandeducationgraduatehealthhealthcarehumaninjurylargestlifememberspracticepreventionprotectionproviderspublic
SHARED TOKENS (25): "act", "care", "certification", "changing", "component", "demand", "education", "graduate", "health", "healthcare", "human", "injury", "largest", "life", "members", "practice", "prevention", "protection", "providers", "public".... | EXACT TITLE in substance_use_recovery: "Nursing".
0.500
agenciesanalysisdataenforcementexaminingfunctionidentifyinginformationlawpatternspolicepreventionprocessreportresourcesrolesocial
SHARED TOKENS (17): "agencies", "analysis", "data", "enforcement", "examining", "function", "identifying", "information", "law", "patterns", "police", "prevention", "process", "report", "resources", "role", "social". | EXACT TITLE in police_law_enforcement: "Crime analysis".
0.500
benefitscasescommunitycriminaldistinctformjusticepeoplepersonprogramsreceivingreplacerequirementsschoolwork
SHARED TOKENS (15): "benefits", "cases", "community", "criminal", "distinct", "form", "justice", "people", "person", "programs", "receiving", "replace", "requirements", "school", "work". | EXACT TITLE in substance_use_recovery: "Community service".
0.500
casecomputercourtcourtsdecadesdifferentlydigitaldisclosuredocumentsestablishedevidencefederalfilesformincreasedinformationlawpotentiallyproceduresprograms
SHARED TOKENS (27): "case", "computer", "court", "courts", "decades", "differently", "digital", "disclosure", "documents", "established", "evidence", "federal", "files", "form", "increased", "information", "law", "potentially", "procedures", "programs".... | EXACT TITLE in police_law_enforcement: "Digital evidence".
0.500
adaboardboisecampuscanyoncollegecollegescommunitycountiescreditdevelopmenteasterneducationgovernedidahonampapopulationprimaryprogramspublic
SHARED TOKENS (29): "ada", "board", "boise", "campus", "canyon", "college", "colleges", "community", "counties", "credit", "development", "eastern", "education", "governed", "idaho", "nampa", "population", "primary", "programs", "public".... | EXACT TITLE in police_law_enforcement: "College of Western Idaho".
0.500
Arrest ↗ Q1403016 EXACT TITLE
actagainstcasescauseconditionscontrolcourtcriminalcustodyenforcementjusticelawlegalofficerspersonpolicepowersproduceprotectionrequire
SHARED TOKENS (22): "act", "against", "cases", "cause", "conditions", "control", "court", "criminal", "custody", "enforcement", "justice", "law", "legal", "officers", "person", "police", "powers", "produce", "protection", "require".... | EXACT TITLE in police_law_enforcement: "Arrest". | EXACT TITLE in substance_use_recovery: "Arrest".
0.500
carecausecontrolcreatesdisposaldrugdrugsevenhealthhealthcareinformationmanagementmedicalopportunitiesorganizationspeopleremainsafescalesystem
SHARED TOKENS (23): "care", "cause", "control", "creates", "disposal", "drug", "drugs", "even", "health", "healthcare", "information", "management", "medical", "opportunities", "organizations", "people", "remain", "safe", "scale", "system".... | EXACT TITLE in police_law_enforcement: "Drug disposal". | EXACT TITLE in substance_use_recovery: "Drug disposal".
0.500
accessadministrationaffectedalcoholapproximatelyaroundcannotcausedependdrugindividualinterventionspartlypeoplepermanentpersonprescriptionrecommendedreducerisk
SHARED TOKENS (24): "access", "administration", "affected", "alcohol", "approximately", "around", "cannot", "cause", "depend", "drug", "individual", "interventions", "partly", "people", "permanent", "person", "prescription", "recommended", "reduce", "risk".... | EXACT TITLE in substance_use_recovery: "Opioid overdose".
0.500
actagenciesagencyauthoritycodedistrictemergencyenforcementenforcinggovernmentgovernmentslawlocalmunicipalofficerofficerspoliceregionalrulessubject
SHARED TOKENS (22): "act", "agencies", "agency", "authority", "code", "district", "emergency", "enforcement", "enforcing", "government", "governments", "law", "local", "municipal", "officer", "officers", "police", "regional", "rules", "subject".... | EXACT TITLE in police_law_enforcement: "Code enforcement".
0.500
Evidence ↗ Q1347572 EXACT TITLE
accessapproachescaseclaimsconnectiondescribesdifferentestablishevidenceexactexperiencegeneralinformationknowledgelawmakesneutralprivaterelevantrole
SHARED TOKENS (23): "access", "approaches", "case", "claims", "connection", "describes", "different", "establish", "evidence", "exact", "experience", "general", "information", "knowledge", "law", "makes", "neutral", "private", "relevant", "role".... | EXACT TITLE in police_law_enforcement: "Evidence". | EXACT TITLE in substance_use_recovery: "Evidence".
0.500
administrativeagenciesboardbudgetcontrolenforcementfundinggovernmentlawlegallocalmunicipalpolicepowersreport
SHARED TOKENS (15): "administrative", "agencies", "board", "budget", "control", "enforcement", "funding", "government", "law", "legal", "local", "municipal", "police", "powers", "report". | EXACT TITLE in police_law_enforcement: "Municipal police". | EXACT TITLE in substance_use_recovery: "Municipal police".
0.480
approachescarecasecommunitycoordinationcourtsgeneralhealthlawlegalmanagementmedicalsystemtreatment
SHARED TOKENS (14): "approaches", "care", "case", "community", "coordination", "courts", "general", "health", "law", "legal", "management", "medical", "system", "treatment". | EXACT TITLE in police_law_enforcement: "Case management". | EXACT TITLE in substance_use_recovery: "Case management".
0.480
addressapproximatelycommunitydifferentdispatchemergencyofficeoperationprobationpublicreportingsafetysystemtelephone
SHARED TOKENS (14): "address", "approximately", "community", "different", "dispatch", "emergency", "office", "operation", "probation", "public", "reporting", "safety", "system", "telephone". | EXACT TITLE in police_law_enforcement: "911 (emergency telephone number)". | EXACT TITLE in substance_use_recovery: "911 (emergency telephone number)".
0.480
agenciesconsumerenforcementenforcinggeneralidaholawlegallocalofficeownershipprotectionrepresentationunion
SHARED TOKENS (14): "agencies", "consumer", "enforcement", "enforcing", "general", "idaho", "law", "legal", "local", "office", "ownership", "protection", "representation", "union". | EXACT TITLE in police_law_enforcement: "Idaho Attorney General".
0.480
alcoholdirectdirectlydrugdrugshealthincreasedindividualoperatingpatternpeoplereducerelatedsubstances
SHARED TOKENS (14): "alcohol", "direct", "directly", "drug", "drugs", "health", "increased", "individual", "operating", "pattern", "people", "reduce", "related", "substances". | EXACT TITLE in substance_use_recovery: "Substance use disorder".
0.480
activitiesamongcriminaldatabaseeducationemploymenthistoryidentificationindividualpersonprocessrecordsearchsecurity
SHARED TOKENS (14): "activities", "among", "criminal", "database", "education", "employment", "history", "identification", "individual", "person", "process", "record", "search", "security". | EXACT TITLE in police_law_enforcement: "Background check".
0.460
Dispatcher ↗ Q570755 EXACT TITLE
coordinatesdepartmentsdirectemergencyinformationmedicaloperationsorganizationspersonnelpoliceproviderspublicsystems
SHARED TOKENS (13): "coordinates", "departments", "direct", "emergency", "information", "medical", "operations", "organizations", "personnel", "police", "providers", "public", "systems". | EXACT TITLE in police_law_enforcement: "Dispatcher".
0.450
activityagenciescomponentcourtscriminaldepartmentsdetentiondutiesemergencyenforcementfacilitiesfederalinfrastructurejudicialjusticelawlocalmaintenancemajorofficers
SHARED TOKENS (35): "activity", "agencies", "component", "courts", "criminal", "departments", "detention", "duties", "emergency", "enforcement", "facilities", "federal", "infrastructure", "judicial", "justice", "law", "local", "maintenance", "major", "officers".... | URL->A (1): https://www.irs.gov/compliance/criminal-investigation.
0.440
activitycommunitycriminalmembersneighborhoodorganizedpreventionreportresidentssafesafetysecurity
SHARED TOKENS (12): "activity", "community", "criminal", "members", "neighborhood", "organized", "prevention", "report", "residents", "safe", "safety", "security". | EXACT TITLE in police_law_enforcement: "Neighborhood watch".
0.440
controldifferentdrugdrugseducationforminformationmeaningmedicalmedicinepotentialprescription
SHARED TOKENS (12): "control", "different", "drug", "drugs", "education", "form", "information", "meaning", "medical", "medicine", "potential", "prescription". | EXACT TITLE in substance_use_recovery: "Prescription drug".
0.420
agenciescourtscriminaldefensegovernmentinstitutionsjusticepoliceprimarysupportsystem
SHARED TOKENS (11): "agencies", "courts", "criminal", "defense", "government", "institutions", "justice", "police", "primary", "support", "system". | EXACT TITLE in police_law_enforcement: "Criminal justice". | EXACT TITLE in substance_use_recovery: "Criminal justice".
0.420
agenciesanalysiscomponentenforcementidentifyinformationlawpatternspolicingstrategysystems
SHARED TOKENS (11): "agencies", "analysis", "component", "enforcement", "identify", "information", "law", "patterns", "policing", "strategy", "systems". | EXACT TITLE in police_law_enforcement: "Crime mapping".
0.420
Naltrexone ↗ Q409587 EXACT TITLE
alcoholamongdrugsmedicalmodelpeoplerecommendedsafesidethemtreatment
SHARED TOKENS (11): "alcohol", "among", "drugs", "medical", "model", "people", "recommended", "safe", "side", "them", "treatment". | EXACT TITLE in substance_use_recovery: "Naltrexone".
0.420
federalgeneralgovernmentgrantgrantsoversightprogramsregionalrevenuesmallerspecified
SHARED TOKENS (11): "federal", "general", "government", "grant", "grants", "oversight", "programs", "regional", "revenue", "smaller", "specified". | EXACT TITLE in substance_use_recovery: "Block grant".
0.400
activitydescribedisposalfunctionsmaterialsprocesspublicsafesafetyseparate
SHARED TOKENS (10): "activity", "describe", "disposal", "functions", "materials", "process", "public", "safe", "safety", "separate". | EXACT TITLE in police_law_enforcement: "Bomb disposal".
0.400
activitiesenforcementforcelawmunicipalnationalorganizedpoliceregionalrelevant
SHARED TOKENS (10): "activities", "enforcement", "force", "law", "municipal", "national", "organized", "police", "regional", "relevant". | EXACT TITLE in police_law_enforcement: "State police". | EXACT TITLE in substance_use_recovery: "State police".
0.380
emergencyhousingpeoplepermanentpopulationresidentssheltersupporttransition
SHARED TOKENS (9): "emergency", "housing", "people", "permanent", "population", "residents", "shelter", "support", "transition". | EXACT TITLE in substance_use_recovery: "Transitional housing".
0.360
agenciesdocumenteddocumentsexpectationsgovernmentinformationpublicrecords
SHARED TOKENS (8): "agencies", "documented", "documents", "expectations", "government", "information", "public", "records". | EXACT TITLE in police_law_enforcement: "Public records".
0.340
casesclaimsdrugevidencehumanmedicinesubstances
SHARED TOKENS (7): "cases", "claims", "drug", "evidence", "human", "medicine", "substances". | EXACT TITLE in substance_use_recovery: "Detoxification".
0.340
crisisdomesticenforcementlawofficerpeopleviolence
SHARED TOKENS (7): "crisis", "domestic", "enforcement", "law", "officer", "people", "violence". | EXACT TITLE in police_law_enforcement: "Crisis negotiation".
0.340
Relapse ↗ Q2292472 EXACT TITLE
activitybehaviordevelopeddrugformmedicalmedicine
SHARED TOKENS (7): "activity", "behavior", "developed", "drug", "form", "medical", "medicine". | EXACT TITLE in substance_use_recovery: "Relapse".
0.320
Sheriff ↗ Q578478 EXACT TITLE
developeddutiesgovernmenthistoricalofficeofficial
SHARED TOKENS (6): "developed", "duties", "government", "historical", "office", "official". | EXACT TITLE in police_law_enforcement: "Sheriff". | EXACT TITLE in substance_use_recovery: "Sheriff".
0.320
agencydepartmenthealthidahopublicwelfare
SHARED TOKENS (6): "agency", "department", "health", "idaho", "public", "welfare". | EXACT TITLE in substance_use_recovery: "Idaho Department of Health and Welfare".
0.300
amonganotherbenefitscasedescribeexperienceincreasedindividuallifemaintenancepeopleprogramsratesretentionsocialtreatment
SHARED TOKENS (16): "among", "another", "benefits", "case", "describe", "experience", "increased", "individual", "life", "maintenance", "people", "programs", "rates", "retention", "social", "treatment".
0.300
actagenciescontrolcouncildefensedepartmentdepartmentsfederalhealthhousehumanjusticeoperationspolicypublicresponseresponsibilitiessecuritysignificanttransportation
SHARED TOKENS (20): "act", "agencies", "control", "council", "defense", "department", "departments", "federal", "health", "house", "human", "justice", "operations", "policy", "public", "response", "responsibilities", "security", "significant", "transportation".
0.300
Criminology ↗ Q161733 KW CROSS HIGH
activitiesadministrationagenciesbodiesconditionscontrolcorrectionalcriminaldirectseducationalenforcementinstitutionsjudicialjusticelawlegallegislativemultidisciplinaryprivateprocesses
SHARED TOKENS (28): "activities", "administration", "agencies", "bodies", "conditions", "control", "correctional", "criminal", "directs", "educational", "enforcement", "institutions", "judicial", "justice", "law", "legal", "legislative", "multidisciplinary", "private", "processes"....
0.300
agreementaroundcannotcaredirecteducationalhealthhealthcaremedicalmodelpracticepractitionerpresentprincipalproviderprovidersrequiredservesignificantskills
SHARED TOKENS (26): "agreement", "around", "cannot", "care", "direct", "educational", "health", "healthcare", "medical", "model", "practice", "practitioner", "present", "principal", "provider", "providers", "required", "serve", "significant", "skills"....
0.300
Family therapy ↗ Q870449 KW CROSS HIGH
behaviorbenefitschildrendevelopeddevelopmentdifferentdirectfamilyhumanindividualinfluenceinteractioninvolvingmembersparticipationpeopleproblemrelatedrelationshipsschools
SHARED TOKENS (26): "behavior", "benefits", "children", "developed", "development", "different", "direct", "family", "human", "individual", "influence", "interaction", "involving", "members", "participation", "people", "problem", "related", "relationships", "schools"....
0.300
accesscentercentersdepartmentemergencyinternetlocalmedicalnetworkoperatorspeoplepolicepublicpublic-safetyresponsesafetysystemtelephonetrained
SHARED TOKENS (19): "access", "center", "centers", "department", "emergency", "internet", "local", "medical", "network", "operators", "people", "police", "public", "public-safety", "response", "safety", "system", "telephone", "trained".
0.300
Mental disorder ↗ Q12135 KW CROSS HIGH
affectaffectsaroundbehaviorcaseschangescommunitycontextdetentiondifferentfunctionshealthhospitalsincreaseindividualinterventionsmajormakingmedicalpattern
SHARED TOKENS (31): "affect", "affects", "around", "behavior", "cases", "changes", "community", "context", "detention", "different", "functions", "health", "hospitals", "increase", "individual", "interventions", "major", "making", "medical", "pattern"....
0.300
Security guard ↗ Q856887 KW CROSS HIGH
actionsagenciesauthoritybehaviorcriminaldepartmentsdirectlyeligibilityemergencyemployedenforcingexperiencefunctiongovernedgovernmenthiringhousingindividuallegallocal
SHARED TOKENS (40): "actions", "agencies", "authority", "behavior", "criminal", "departments", "directly", "eligibility", "emergency", "employed", "enforcing", "experience", "function", "governed", "government", "hiring", "housing", "individual", "legal", "local"....
0.300
activitiesadoptedanotherapplyarticleauthorityauthorizedbenefitsboardcapacitycaseschildconditionsdecisionsevidencefactsforceformhealthcareindividual
SHARED TOKENS (49): "activities", "adopted", "another", "apply", "article", "authority", "authorized", "benefits", "board", "capacity", "cases", "child", "conditions", "decisions", "evidence", "facts", "force", "form", "healthcare", "individual"....
0.300
Managed care ↗ Q1416012 KW CROSS HIGH
actactivitiesbecomecarecasescontractingcontrolscostcostsformshealthhealthcareincreasedinsuranceintendedlifemaintenancemanagementmedicalorganization
SHARED TOKENS (28): "act", "activities", "become", "care", "cases", "contracting", "controls", "cost", "costs", "forms", "health", "healthcare", "increased", "insurance", "intended", "life", "maintenance", "management", "medical", "organization"....
0.300
Group home ↗ Q442993 KW CROSS HIGH
activityarticlecannotcarecasechildrenfacilitiesfacilityfamilyhealthhousemedicalmodelpeopleprogramsrelatedreportedresidentialresidentsstructured
SHARED TOKENS (21): "activity", "article", "cannot", "care", "case", "children", "facilities", "facility", "family", "health", "house", "medical", "model", "people", "programs", "related", "reported", "residential", "residents", "structured"....
0.300
DNA profiling ↗ Q476697 KW CROSS HIGH
analysiscriminaldevelopedeligibilityestablishevidenceidentifyindividualintendedmedicalmodernprocessprofilesratherreliableresearchstudytestinguniversityvariable
SHARED TOKENS (20): "analysis", "criminal", "developed", "eligibility", "establish", "evidence", "identify", "individual", "intended", "medical", "modern", "process", "profiles", "rather", "reliable", "research", "study", "testing", "university", "variable".
0.300
againstassistancecasescausecommunitycourtcriminaldifferentdistrictgovernmentgrantsincorporatedprocessprosecutionspublicrelatedremainrequirementrequiresrights
SHARED TOKENS (21): "against", "assistance", "cases", "cause", "community", "court", "criminal", "different", "district", "government", "grants", "incorporated", "process", "prosecutions", "public", "related", "remain", "requirement", "requires", "rights"....
0.300
accessactivecapacitycollaborationcommunitycreatedrugdrugseducationenforcementgenerichealthhealthcarehumanincreasedincreasinglyindexpreventionproblemproducts
SHARED TOKENS (35): "access", "active", "capacity", "collaboration", "community", "create", "drug", "drugs", "education", "enforcement", "generic", "health", "healthcare", "human", "increased", "increasingly", "index", "prevention", "problem", "products"....
0.300
Police dog ↗ Q39235 KW CROSS HIGH
becomecriminaldrugsdutiesenforcementevidencelawlocalnationalofficerspeoplepoliceprogramsremainsmallertrainedtrainingwork
SHARED TOKENS (18): "become", "criminal", "drugs", "duties", "enforcement", "evidence", "law", "local", "national", "officers", "people", "police", "programs", "remain", "smaller", "trained", "training", "work".
0.300
Dashcam ↗ Q5226605 KW CROSS HIGH
broadercommercialcomponentcontinuouslycoredatadigitalformfullrecordrecordsregistrationsourcesystemstechnologyvideo
SHARED TOKENS (16): "broader", "commercial", "component", "continuously", "core", "data", "digital", "form", "full", "record", "records", "registration", "source", "systems", "technology", "video".
0.300
accountabilityactcareconfidentialitydevelopeddisclosurefacilityhealthincreaseinstitutionsinsurancemanagementmedicalmodernpeoplepracticeprivacyprovidersrecordsreduce
SHARED TOKENS (22): "accountability", "act", "care", "confidentiality", "developed", "disclosure", "facility", "health", "increase", "institutions", "insurance", "management", "medical", "modern", "people", "practice", "privacy", "providers", "records", "reduce"....
0.300
actauthorityauthorizedbroaderchangescourtcourtsenforcementfederalforcegrantintendedlawofficepeopleprivateprotectionprovisionsreceivingreports
SHARED TOKENS (26): "act", "authority", "authorized", "broader", "changes", "court", "courts", "enforcement", "federal", "force", "grant", "intended", "law", "office", "people", "private", "protection", "provisions", "receiving", "reports"....
0.300
alcoholconditionsdrugdrugsfinancialgeneralgroupslegalmedicalparticipationpeopleprescriptionpresentprocessprocessessocialsubstancestrainedtreatment
SHARED TOKENS (19): "alcohol", "conditions", "drug", "drugs", "financial", "general", "groups", "legal", "medical", "participation", "people", "prescription", "present", "process", "processes", "social", "substances", "trained", "treatment".
0.300
actadministrationagainstagenciesagencyanotherassociationauthorityauthorizedcommunityconsolidationcontrolcontrolledcreatesdatadeadepartmentdrugdrugsenforcement
SHARED TOKENS (56): "act", "administration", "against", "agencies", "agency", "another", "association", "authority", "authorized", "community", "consolidation", "control", "controlled", "creates", "data", "dea", "department", "drug", "drugs", "enforcement"....
0.300
agenciesagencyaroundcasescontroldutiesemergencyenforcementevenfederalforcefunctionsgenerallawmanagementmedicalofficerspolicepolicingprograms
SHARED TOKENS (29): "agencies", "agency", "around", "cases", "control", "duties", "emergency", "enforcement", "even", "federal", "force", "functions", "general", "law", "management", "medical", "officers", "police", "policing", "programs"....
0.300
behaviorcriminaldifferentenforcementformfutureintendedinterventionjudicialjusticelawoperationsprogramsystemsystems
SHARED TOKENS (15): "behavior", "criminal", "different", "enforcement", "form", "future", "intended", "intervention", "judicial", "justice", "law", "operations", "program", "system", "systems".
0.300
Organized crime ↗ Q46952 KW CROSS HIGH
actactivitiesactivityadministrationarticleassessmentassociationbecomebroaderbusinesscasescommunitycontrolcriminaldecadesdefinesdemanddepartmentdescribedevelopment
SHARED TOKENS (73): "act", "activities", "activity", "administration", "article", "assessment", "association", "become", "broader", "business", "cases", "community", "control", "criminal", "decades", "defines", "demand", "department", "describe", "development"....
0.300
associationcurrentdailydeathdifferentfamilyformshealthhistoryincreasedindividualmedicalpeopleprescriptionprofessionalprogramsrecommendedreportedresponsibilitiesrisk
SHARED TOKENS (26): "association", "current", "daily", "death", "different", "family", "forms", "health", "history", "increased", "individual", "medical", "people", "prescription", "professional", "programs", "recommended", "reported", "responsibilities", "risk"....
0.300
agencyagreementamongassociationbenefitsbusinesscarecasecentralcommunitycontractcostscoveragecoveringdeathentityevidencegovernmenthealthindividual
SHARED TOKENS (34): "agency", "agreement", "among", "association", "benefits", "business", "care", "case", "central", "community", "contract", "costs", "coverage", "covering", "death", "entity", "evidence", "government", "health", "individual"....
0.300
analysisassessmentauthoritycommunitycontrolengagementexpandedidentificationidentifyleadmodelofficersorganizationspolicepolicingpreventionprivatepublicrequiresresearch
SHARED TOKENS (26): "analysis", "assessment", "authority", "community", "control", "engagement", "expanded", "identification", "identify", "lead", "model", "officers", "organizations", "police", "policing", "prevention", "private", "public", "requires", "research"....
0.300
addressagenciesagencyassignmentauthoritydifferentdivisionenforcementinterventionjusticeofficerofficersoperatepeopleperipheralpolicepublicseparatetransportationunits
SHARED TOKENS (21): "address", "agencies", "agency", "assignment", "authority", "different", "division", "enforcement", "intervention", "justice", "officer", "officers", "operate", "people", "peripheral", "police", "public", "separate", "transportation", "units"....
0.300
activitiesanotheraroundauthoritybecomecarecomponentcontrolcontrolleddirecteducationevidenceexaminedexperiencefinancialformalgeneralhealthhealthcareoccupational
SHARED TOKENS (40): "activities", "another", "around", "authority", "become", "care", "component", "control", "controlled", "direct", "education", "evidence", "examined", "experience", "financial", "formal", "general", "health", "healthcare", "occupational"....
0.300
accessaffectagenciesarticlebeyondchildchildrencollaborationcommunitycomponentcoordinationcreatecreatingdefinesdevelopmenteducationenvironmentevenfamilyfuture
SHARED TOKENS (62): "access", "affect", "agencies", "article", "beyond", "child", "children", "collaboration", "community", "component", "coordination", "create", "creating", "defines", "development", "education", "environment", "even", "family", "future"....
0.300
Epidemiology ↗ Q133805 KW CROSS HIGH
amonganalysisassessmentcollectionconditionsdatadecisionsdescribedescriptiondesignexaminedfunctiongeneralhealthhealthcarehistoricallyhumanidentifyinginteractionknowledge
SHARED TOKENS (42): "among", "analysis", "assessment", "collection", "conditions", "data", "decisions", "describe", "description", "design", "examined", "function", "general", "health", "healthcare", "historically", "human", "identifying", "interaction", "knowledge"....
0.300
approximatelyboisedatadistrictevengovernmenthouseidaholegislativememberspeoplepopulationresidentssinglewashington
SHARED TOKENS (15): "approximately", "boise", "data", "district", "even", "government", "house", "idaho", "legislative", "members", "people", "population", "residents", "single", "washington".
0.300
approachesbehaviorcarecommunicationcomputercontextdatadesigndevelopmenthealthhealthcarehospitalsinformationinstitutionsmanagementmedicalmultidisciplinaryresearchstudysystems
SHARED TOKENS (21): "approaches", "behavior", "care", "communication", "computer", "context", "data", "design", "development", "health", "healthcare", "hospitals", "information", "institutions", "management", "medical", "multidisciplinary", "research", "study", "systems"....
0.300
accessactivitiesaddressapplycarecenterchildrencriminalenforcementfullgovernmenthousinginformationinternetkeeplawpersonprobationpublicregistration
SHARED TOKENS (28): "access", "activities", "address", "apply", "care", "center", "children", "criminal", "enforcement", "full", "government", "housing", "information", "internet", "keep", "law", "person", "probation", "public", "registration"....
0.300
accountabilityactadministrativeauthorizedcarecasesconcerningconfidentialitycoverageentityfamilyfederalhealthhealthcareinformationinsurancelawlifemedicalmembers
SHARED TOKENS (29): "accountability", "act", "administrative", "authorized", "care", "cases", "concerning", "confidentiality", "coverage", "entity", "family", "federal", "health", "healthcare", "information", "insurance", "law", "life", "medical", "members"....
0.300
aroundassessmentbecomebuiltcommunityconflictearlierenforcementexpansionlawmanagementmodelofficersoperationspolicepolicingratherriskservestrategy
SHARED TOKENS (21): "around", "assessment", "become", "built", "community", "conflict", "earlier", "enforcement", "expansion", "law", "management", "model", "officers", "operations", "police", "policing", "rather", "risk", "serve", "strategy"....
0.300
administrativeauthoritycriminaldutiesenforcementlawlegallifemodernofficerofficerspersonpolicepowerspublicrelatedresponsibilitiessafetysecurityseparate
SHARED TOKENS (22): "administrative", "authority", "criminal", "duties", "enforcement", "law", "legal", "life", "modern", "officer", "officers", "person", "police", "powers", "public", "related", "responsibilities", "safety", "security", "separate"....
0.300
accountabilityactactionsadministrationagencycriminaldepartmentdescribeddistinctdomesticenforcementfederalforcefunctionsincreasedincreasinglylargestlawlegalmaintains
SHARED TOKENS (45): "accountability", "act", "actions", "administration", "agency", "criminal", "department", "described", "distinct", "domestic", "enforcement", "federal", "force", "functions", "increased", "increasingly", "largest", "law", "legal", "maintains"....
0.300
actionscannotcourtcriminalenforcemententerequivalentevidencelawofficerofficerspersonpolicepowersprivacyprivateprocessrequirerulesearch
SHARED TOKENS (21): "actions", "cannot", "court", "criminal", "enforcement", "enter", "equivalent", "evidence", "law", "officer", "officers", "person", "police", "powers", "privacy", "private", "process", "require", "rule", "search"....
0.300
activityaffectedagainstalcoholamongcentralcontainingcontainsdeathdistinctdrugdrugsexacthealthincreasedleadlegalnewsorganizationproduce
SHARED TOKENS (24): "activity", "affected", "against", "alcohol", "among", "central", "containing", "contains", "death", "distinct", "drug", "drugs", "exact", "health", "increased", "lead", "legal", "news", "organization", "produce"....
0.300
Morphine ↗ Q81225 KW CROSS HIGH
administrationaffectamongapproximatelycausecentraldevelopeddirectlydrugfamilyfrequentlygenerichealthincreaselabororganizationpotentiallyprimaryresponseside
SHARED TOKENS (22): "administration", "affect", "among", "approximately", "cause", "central", "developed", "directly", "drug", "family", "frequently", "generic", "health", "increase", "labor", "organization", "potentially", "primary", "response", "side"....
0.300
becomesbehaviordrugexpandedexperiencefinancialformframeworkidenticalidentifiedimplyindividualleadmodernpersonprocessprocessesratherrelatedrisk
SHARED TOKENS (23): "becomes", "behavior", "drug", "expanded", "experience", "financial", "form", "framework", "identical", "identified", "imply", "individual", "lead", "modern", "person", "process", "processes", "rather", "related", "risk"....
0.300
agenciesauthorizedcarecontrolleddatadatabasedrugdrugsenforcementestablishedevidencefederallyhealthidentifyingincreasedlawlicensingpharmaciespotentiallyprescription
SHARED TOKENS (34): "agencies", "authorized", "care", "controlled", "data", "database", "drug", "drugs", "enforcement", "established", "evidence", "federally", "health", "identifying", "increased", "law", "licensing", "pharmacies", "potentially", "prescription"....
0.300
actagainstappropriationsapproximatelyassistancecasecasesconsolidatedcontrolcourtcourtscriminaldepartmentdistrictdrugenforcementestablishedfederalfiscalfunding
SHARED TOKENS (38): "act", "against", "appropriations", "approximately", "assistance", "case", "cases", "consolidated", "control", "court", "courts", "criminal", "department", "district", "drug", "enforcement", "established", "federal", "fiscal", "funding"....
0.300
agenciesanothercommercialcontractorscostcriminalenforcementlawmeansofficerspersonprivaterisktransporttransportation
SHARED TOKENS (15): "agencies", "another", "commercial", "contractors", "cost", "criminal", "enforcement", "law", "means", "officers", "person", "private", "risk", "transport", "transportation".
0.300
analysiscarecollectioncurrentdatadecisionsdescribeevidenceexperienceexternalguidehealthhealthcarehumanindividualinformationmakingmanagementmeansmedicine
SHARED TOKENS (25): "analysis", "care", "collection", "current", "data", "decisions", "describe", "evidence", "experience", "external", "guide", "health", "healthcare", "human", "individual", "information", "making", "management", "means", "medicine"....
0.300
activityassistancecannotcasescostscourtcriminalcurrentcustodydetentiondocumentsentergovernmenthouselawofficialpersonprocesspublicresearch
SHARED TOKENS (25): "activity", "assistance", "cannot", "cases", "costs", "court", "criminal", "current", "custody", "detention", "documents", "enter", "government", "house", "law", "official", "person", "process", "public", "research"....
0.300
accessagenciesanalysisapproximatelyaroundcasescriminaldatadatabasedirectlyenforcementfamilyidentifiedidentifyidentifyingindividualinformationlawleadlegal
SHARED TOKENS (32): "access", "agencies", "analysis", "approximately", "around", "cases", "criminal", "data", "database", "directly", "enforcement", "family", "identified", "identify", "identifying", "individual", "information", "law", "lead", "legal"....
0.300
addressingappointedauthorizedcommissionedconcerningdepartmenteducationfederalfundinggeneralgovernmenthealthhealthcarehumanmattersmedicalmissionprimaryprivatepublic
SHARED TOKENS (24): "addressing", "appointed", "authorized", "commissioned", "concerning", "department", "education", "federal", "funding", "general", "government", "health", "healthcare", "human", "matters", "medical", "mission", "primary", "private", "public"....
0.300
activitiesapprovalbenefitsbudgetcentraldefensedutieseducationentityexpendituresfeesfinancialfiscalgovernmenthealthcareindividualinfrastructureinstitutionsitselflaw
SHARED TOKENS (28): "activities", "approval", "benefits", "budget", "central", "defense", "duties", "education", "entity", "expenditures", "fees", "financial", "fiscal", "government", "healthcare", "individual", "infrastructure", "institutions", "itself", "law"....
0.300
actcommunitiesconflictcrisisdrugdrugsfederalhistorylargestlawmedicalpdfpreventionsinglesupporttexttreatment
SHARED TOKENS (17): "act", "communities", "conflict", "crisis", "drug", "drugs", "federal", "history", "largest", "law", "medical", "pdf", "prevention", "single", "support", "text", "treatment".
0.300
Police academy ↗ Q277845 KW CROSS HIGH
agenciesagencyamongaroundcentercollegecriminalcrisisdepartmentdutiesenforcementevenfacilitiesforceindividuallawlegalmedicalofficerofficers
SHARED TOKENS (34): "agencies", "agency", "among", "around", "center", "college", "criminal", "crisis", "department", "duties", "enforcement", "even", "facilities", "force", "individual", "law", "legal", "medical", "officer", "officers"....
0.300
accessactionsactivitiesadministrationagencyassociationcapacitycenterschangescontroldepartmenteducationalfederalfoodgovernmenthealthhumaninformationinjuryinstitutional
SHARED TOKENS (37): "access", "actions", "activities", "administration", "agency", "association", "capacity", "centers", "changes", "control", "department", "educational", "federal", "food", "government", "health", "human", "information", "injury", "institutional"....
0.300
agenciesaroundcollectioncreatedatadescribedenforcementformgovernmentincreasedlawpoliceprivacyratesregistrationsurveillancesystemstasktechnologytext
SHARED TOKENS (21): "agencies", "around", "collection", "create", "data", "described", "enforcement", "form", "government", "increased", "law", "police", "privacy", "rates", "registration", "surveillance", "systems", "task", "technology", "text"....
0.300
Psychotherapy ↗ Q183257 KW CROSS HIGH
approachesbehaviorbenefitschildrenconditionscontrolleddifferentfamilyformsgeneralgroupshealthincreaseindividualinteractioninvolvingitselfoutcomespersonpotential
SHARED TOKENS (37): "approaches", "behavior", "benefits", "children", "conditions", "controlled", "different", "family", "forms", "general", "groups", "health", "increase", "individual", "interaction", "involving", "itself", "outcomes", "person", "potential"....
0.300
accountabilityadministrationcapacitychangeschangingcommunityenforcementgroupslawmakesofficersorganizationaloutcomespolicepolicingpublicquestionssafetyscholarshipsecurity
SHARED TOKENS (21): "accountability", "administration", "capacity", "changes", "changing", "community", "enforcement", "groups", "law", "makes", "officers", "organizational", "outcomes", "police", "policing", "public", "questions", "safety", "scholarship", "security"....
0.300
Rape kit ↗ Q7293902 KW CROSS HIGH
assistancecasescollectioncriminaldevelopedevidencefrequentlyidentifyingmedicalorganizationpersonnelpolicesafestandardizedtodayuniform
SHARED TOKENS (16): "assistance", "cases", "collection", "criminal", "developed", "evidence", "frequently", "identifying", "medical", "organization", "personnel", "police", "safe", "standardized", "today", "uniform".
0.300
actapplicantsbenefitsbudgetcannotcarechangesconditionscostscourtcoverageeducationeligibilityexpandedexpansionfederalforceformallyfundinghealth
SHARED TOKENS (49): "act", "applicants", "benefits", "budget", "cannot", "care", "changes", "conditions", "costs", "court", "coverage", "education", "eligibility", "expanded", "expansion", "federal", "force", "formally", "funding", "health"....
0.300
Imprisonment ↗ Q841236 KW CROSS HIGH
againstauthorityauthorizedbecomecasecauseconditionsdetentionemployedevenevidenceforceformsgovernmenthumanimplyincarcerationitselfjudiciallaw
SHARED TOKENS (30): "against", "authority", "authorized", "become", "case", "cause", "conditions", "detention", "employed", "even", "evidence", "force", "forms", "government", "human", "imply", "incarceration", "itself", "judicial", "law"....
0.300
addressingadoptedauthorityauthorizedbecomeboardcasescollegecourtdecisionsdefineseducationenforcementfederalgovernmentgovernmentshouselawlifeparticipation
SHARED TOKENS (35): "addressing", "adopted", "authority", "authorized", "become", "board", "cases", "college", "court", "decisions", "defines", "education", "enforcement", "federal", "government", "governments", "house", "law", "life", "participation"....
0.300
administratorsagencyarticlecreatedefinesdepartmentdistrictdocumentdutiesemployedenforcementenvironmentjusticelawlocalofficerofficerspolicepowersprevention
SHARED TOKENS (28): "administrators", "agency", "article", "create", "defines", "department", "district", "document", "duties", "employed", "enforcement", "environment", "justice", "law", "local", "officer", "officers", "police", "powers", "prevention"....
0.300
Body camera ↗ Q17020273 KW CROSS HIGH
behaviorcommunitiesdecadesenforcementevidenceforcehealthcarelawmediamedicalpeoplepersonnelpolicepublicrecordrecordingresearchshowssocialsupport
SHARED TOKENS (26): "behavior", "communities", "decades", "enforcement", "evidence", "force", "healthcare", "law", "media", "medical", "people", "personnel", "police", "public", "record", "recording", "research", "shows", "social", "support"....
0.300
Mounted police ↗ Q578015 KW CROSS HIGH
cannotcontroldeathdutiesemployedfunctionincreasinglyofficerofficerspeoplepolicepolicingpreventionrisksearchspecializedthemtrainedunits
SHARED TOKENS (19): "cannot", "control", "death", "duties", "employed", "function", "increasingly", "officer", "officers", "people", "police", "policing", "prevention", "risk", "search", "specialized", "them", "trained", "units".
0.300
Drug checking ↗ Q3519101 KW CROSS HIGH
affectedbecomecriticaldevelopeddrugdrugshealthidentificationidentifyinginformationlaterlocalnationalpeopleprogramspublicreducerisksrolesafe
SHARED TOKENS (27): "affected", "become", "critical", "developed", "drug", "drugs", "health", "identification", "identifying", "information", "later", "local", "national", "people", "programs", "public", "reduce", "risks", "role", "safe"....
0.300
Housing First ↗ Q1631460 KW CROSS HIGH
addressaffectagainstapproachescarecausechildrencommunitycostdecadesdifferenteducationemergencyemploymentevidencefamilyformgovernmenthealthcarehomelessness
SHARED TOKENS (53): "address", "affect", "against", "approaches", "care", "cause", "children", "community", "cost", "decades", "different", "education", "emergency", "employment", "evidence", "family", "form", "government", "healthcare", "homelessness"....
0.300
actionsactivitiesaffectedcarecausechildrencostdecisionseducationevenhealthhealthcareidentifyincreaseindexindividualinformationorganizationoutsidepeople
SHARED TOKENS (33): "actions", "activities", "affected", "care", "cause", "children", "cost", "decisions", "education", "even", "health", "healthcare", "identify", "increase", "index", "individual", "information", "organization", "outside", "people"....
0.300
activeactivitiesalcoholanalysisapplicantsbecomescausecombinescontextdeathdetectiondistinctdrugdrugsemployedevidenceexpandedformfrequentlyhuman
SHARED TOKENS (41): "active", "activities", "alcohol", "analysis", "applicants", "becomes", "cause", "combines", "context", "death", "detection", "distinct", "drug", "drugs", "employed", "evidence", "expanded", "form", "frequently", "human"....
0.300
actactivityanotherbusinesscapitalcentralconsolidatedconsolidationcontrolcreatedepartmentdescribeddirectentityfederalgovernedgovernmentjusticelawlegal
SHARED TOKENS (39): "act", "activity", "another", "business", "capital", "central", "consolidated", "consolidation", "control", "create", "department", "described", "direct", "entity", "federal", "governed", "government", "justice", "law", "legal"....
0.300
addressassociationbehaviorcannotcodecontroldevelopeddrugexamininglifemakingorganizationsprocessprogramprogramspublished
SHARED TOKENS (16): "address", "association", "behavior", "cannot", "code", "control", "developed", "drug", "examining", "life", "making", "organizations", "process", "program", "programs", "published".
0.300
advocacyagenciesarticleassistancechangescommunitycourtcriminaldomesticgeneralgroupsidentityinformationjusticeknowledgelegalmedicinenationaloutcomespeople
SHARED TOKENS (33): "advocacy", "agencies", "article", "assistance", "changes", "community", "court", "criminal", "domestic", "general", "groups", "identity", "information", "justice", "knowledge", "legal", "medicine", "national", "outcomes", "people"....
0.300
communicationcoordinationemergencygroupsinformationintendedorganizedprimaryreceivingsourcessystemsystemstextthereforeunifiedvideo
SHARED TOKENS (16): "communication", "coordination", "emergency", "groups", "information", "intended", "organized", "primary", "receiving", "sources", "system", "systems", "text", "therefore", "unified", "video".
0.300
acquireactivitiesagencyassistanceauthorizedbenefitsdirectentityfederalfinancialformfundinggeneralgovernmentgrantgrantslawlocalorganizationorganizations
SHARED TOKENS (26): "acquire", "activities", "agency", "assistance", "authorized", "benefits", "direct", "entity", "federal", "financial", "form", "funding", "general", "government", "grant", "grants", "law", "local", "organization", "organizations"....
0.300
analysiscasescontrolcourtcriminalcustodydocumentdocumentationdocumentsdrugevidencefoodhistoricalhistorylegalmanagementmaterialsmeaningmeansownership
SHARED TOKENS (27): "analysis", "cases", "control", "court", "criminal", "custody", "document", "documentation", "documents", "drug", "evidence", "food", "historical", "history", "legal", "management", "materials", "meaning", "means", "ownership"....
0.300
actagainstboisecasecasesclaimscourtcriminaldistrictfederalgovernmentidahonationalofficewhose
SHARED TOKENS (15): "act", "against", "boise", "case", "cases", "claims", "court", "criminal", "district", "federal", "government", "idaho", "national", "office", "whose".
0.300
actaffectedagainstagenciesamongappropriationsbuildingcasescommunitiesconnectionconsolidatedcrisisdescribeddomesticenforcementestablishedevenexperienceformsgovernment
SHARED TOKENS (40): "act", "affected", "against", "agencies", "among", "appropriations", "building", "cases", "communities", "connection", "consolidated", "crisis", "described", "domestic", "enforcement", "established", "even", "experience", "forms", "government"....
0.300
actapplicablechildchildrencodeconcerningdevelopmentdifferentenforcementexpandedfamilyfederalforcefundinghousinglawmakesnationalorganizedpeople
SHARED TOKENS (28): "act", "applicable", "child", "children", "code", "concerning", "development", "different", "enforcement", "expanded", "family", "federal", "force", "funding", "housing", "law", "makes", "national", "organized", "people"....
0.300
actadaagainstbusinesschangescostscouncilfinalhouseidentitylaterlawnationalprotectionpublicrecommendedrequirementsrequiresrights
SHARED TOKENS (19): "act", "ada", "against", "business", "changes", "costs", "council", "final", "house", "identity", "later", "law", "national", "protection", "public", "recommended", "requirements", "requires", "rights".
0.300
administrationassessmentcentraldevelopeddevelopmentdifferenteducationalequivalentfamilyhealthhumanidahoincreaseintegrationknowledgemastermedicalmedicinemodelpractice
SHARED TOKENS (31): "administration", "assessment", "central", "developed", "development", "different", "educational", "equivalent", "family", "health", "human", "idaho", "increase", "integration", "knowledge", "master", "medical", "medicine", "model", "practice"....
0.300
accountabilityactivitiesagenciesbecomeboardcommunitycreatedirectdutiesemployedenforcemententityfinancialformformsfunctionsgovernancegovernmentgroupshealthcare
SHARED TOKENS (42): "accountability", "activities", "agencies", "become", "board", "community", "create", "direct", "duties", "employed", "enforcement", "entity", "financial", "form", "forms", "functions", "governance", "government", "groups", "healthcare"....
0.300
alcoholbuiltcommunitydevelopeddrugsestablishedgroupsinternetmedicalmodelorganizationpeoplepersonprofessionalseekingsupporttrainedtraining
SHARED TOKENS (18): "alcohol", "built", "community", "developed", "drugs", "established", "groups", "internet", "medical", "model", "organization", "people", "person", "professional", "seeking", "support", "trained", "training".
0.300
accountabilityactadministersadministrationadministrativeagencycarecenterscertificationchildrendepartmentfacilitiesfederalgovgovernmentshealthhealthcarehumaninsurancemedicaid
SHARED TOKENS (28): "accountability", "act", "administers", "administration", "administrative", "agency", "care", "centers", "certification", "children", "department", "facilities", "federal", "gov", "governments", "health", "healthcare", "human", "insurance", "medicaid"....
0.300
affectsagencyagreementapproximatelyauthoritycomponentcontractsdirectgovernmentgovernmentslocalorganizationorganizationsoutcomespracticesprivateprocessprocurementproducepublic
SHARED TOKENS (26): "affects", "agency", "agreement", "approximately", "authority", "component", "contracts", "direct", "government", "governments", "local", "organization", "organizations", "outcomes", "practices", "private", "process", "procurement", "produce", "public"....
0.300
accessaffectboardcarecostcostsdevelopedhealthhealthcareinformationinstitutionsinvestigateknowledgelifemedicalmultidisciplinaryorganizationorganizationalpeopleperformance
SHARED TOKENS (34): "access", "affect", "board", "care", "cost", "costs", "developed", "health", "healthcare", "information", "institutions", "investigate", "knowledge", "life", "medical", "multidisciplinary", "organization", "organizational", "people", "performance"....
0.300
Use of force ↗ Q971119 KW CROSS HIGH
anothercodecompliancecontextcriminaldeathemployedenforcementforcelawlegalofficerspersonpersonnelpolicepolicingpositionpracticalpreventionquestions
SHARED TOKENS (25): "another", "code", "compliance", "context", "criminal", "death", "employed", "enforcement", "force", "law", "legal", "officers", "person", "personnel", "police", "policing", "position", "practical", "prevention", "questions"....
0.300
actionsaroundauthoritybecomecasecasescourtcourtsdutiesenforcementfinancialforcegovernmentgrantsincreasinglyinvolvingitselflawlegalofficial
SHARED TOKENS (31): "actions", "around", "authority", "become", "case", "cases", "court", "courts", "duties", "enforcement", "financial", "force", "government", "grants", "increasingly", "involving", "itself", "law", "legal", "official"....
0.300
actadministrationappropriationsauthorizedcommunityeducationfederalfundinggrantshealthincreaseintendedlawmajornetworksorganizationspreventionprocessprogramsprovisions
SHARED TOKENS (22): "act", "administration", "appropriations", "authorized", "community", "education", "federal", "funding", "grants", "health", "increase", "intended", "law", "major", "networks", "organizations", "prevention", "process", "programs", "provisions"....
0.300
businesscaredefinesdepartmentfacilityhealthhumanindividualinsurancemedicalorganizationpersonprofessionalproviderproviderstreatment
SHARED TOKENS (16): "business", "care", "defines", "department", "facility", "health", "human", "individual", "insurance", "medical", "organization", "person", "professional", "provider", "providers", "treatment".
0.300
adoptedbeyondchangingcommunitydemonstratingdevelopeddevelopmentdifferentevenexplicitlyhealthlifemeaningmodeloriginatingpeoplepersonpoliciespotentialpractical
SHARED TOKENS (32): "adopted", "beyond", "changing", "community", "demonstrating", "developed", "development", "different", "even", "explicitly", "health", "life", "meaning", "model", "originating", "people", "person", "policies", "potential", "practical"....
0.300
Private equity ↗ KW CROSS HIGH
activebusinesscapitalchangescontroldescribeddevelopmentexpansionfinancialgeneralmanagementoperationalownershipprivateproductspublicratherrolespecializedstrategy
SHARED TOKENS (20): "active", "business", "capital", "changes", "control", "described", "development", "expansion", "financial", "general", "management", "operational", "ownership", "private", "products", "public", "rather", "role", "specialized", "strategy".
0.300
administrationaffectalcoholcasescauseconditionsdescribedevelopeddifferentdrugdrugsevenformincreasedlegalmedicalpersonprescriptionratherrole
SHARED TOKENS (22): "administration", "affect", "alcohol", "cases", "cause", "conditions", "describe", "developed", "different", "drug", "drugs", "even", "form", "increased", "legal", "medical", "person", "prescription", "rather", "role"....
0.300
Identity theft ↗ Q471880 KW CROSS HIGH
accessaccountabilityactionsanotheraroundarticlebenefitschiefcomputercreditdatadocumentsevenfinancialfullgovernmentidentifyingidentityindividualinformation
SHARED TOKENS (42): "access", "accountability", "actions", "another", "around", "article", "benefits", "chief", "computer", "credit", "data", "documents", "even", "financial", "full", "government", "identifying", "identity", "individual", "information"....
0.300
behaviorcontroldemanddisciplinedrugsevaluationfederalfoodfundinghealthinvolvingknowledgelegalmedicalpeopleprivatepublicrelatedresearchtreatment
SHARED TOKENS (20): "behavior", "control", "demand", "discipline", "drugs", "evaluation", "federal", "food", "funding", "health", "involving", "knowledge", "legal", "medical", "people", "private", "public", "related", "research", "treatment".
0.300
actappointedbecomebodiescommissioneddutiesenforcementformfrequentlyincreasinglylawmembersmodernofficersorderspeoplepersonnelpolicepracticepresent
SHARED TOKENS (26): "act", "appointed", "become", "bodies", "commissioned", "duties", "enforcement", "form", "frequently", "increasingly", "law", "members", "modern", "officers", "orders", "people", "personnel", "police", "practice", "present"....
0.300
agenciesagencydutiesemploymentenforcementforceformsgovernmentlawlegalofficersorganizedpolicepowersresourcesrightsthem
SHARED TOKENS (17): "agencies", "agency", "duties", "employment", "enforcement", "force", "forms", "government", "law", "legal", "officers", "organized", "police", "powers", "resources", "rights", "them".
0.300
accesscarecenterconditionscontrolleddailyeasternfacilitiesfacilityhealthhealthcareinterventionsmakesoutsidepeoplepracticeprogramprogramsrelationshipsresidential
SHARED TOKENS (28): "access", "care", "center", "conditions", "controlled", "daily", "eastern", "facilities", "facility", "health", "healthcare", "interventions", "makes", "outside", "people", "practice", "program", "programs", "relationships", "residential"....
0.300
accountabilitybusinesscommunityentityhospitalsinstitutionlocalmeaningmissionoperatedoperatesoperationsorganizationorganizationspersonprivateprogrampublicratherrevenue
SHARED TOKENS (24): "accountability", "business", "community", "entity", "hospitals", "institution", "local", "meaning", "mission", "operated", "operates", "operations", "organization", "organizations", "person", "private", "program", "public", "rather", "revenue"....
0.300
accuracyagenciesanalysisbodiescontrolcourtdifferentdrugsevidencegoverningidentificationidentifylayerlegalmaterialsoperatingpreserveproceduresproducereporting
SHARED TOKENS (24): "accuracy", "agencies", "analysis", "bodies", "control", "court", "different", "drugs", "evidence", "governing", "identification", "identify", "layer", "legal", "materials", "operating", "preserve", "procedures", "produce", "reporting"....
0.300
actadministrationagencyappointedauthoritycontrolcurrentdepartmentdirectlydrugdrugsenforcingfederalfoodhealthhumanmedicalprescriptionprimaryproducts
SHARED TOKENS (28): "act", "administration", "agency", "appointed", "authority", "control", "current", "department", "directly", "drug", "drugs", "enforcing", "federal", "food", "health", "human", "medical", "prescription", "primary", "products"....
0.300
Data sharing ↗ Q5227350 KW CROSS HIGH
accessagenciesagreementarchivearchivedcodecommunicationcommunityconfidentialityconstitutedatadevelopmentestablishedfoundationalfullfundinggoverninggovernmentshistoryidentified
SHARED TOKENS (48): "access", "agencies", "agreement", "archive", "archived", "code", "communication", "community", "confidentiality", "constitute", "data", "development", "established", "foundational", "full", "funding", "governing", "governments", "history", "identified"....
0.300
Boise River ↗ Q891080 EXACT TITLE
approximatelyboiseidahoportionwestern
SHARED TOKENS (5): "approximately", "boise", "idaho", "portion", "western". | EXACT TITLE in police_law_enforcement: "Boise River".
0.300
amonganotherchildconstitutecontrolledcriminaldifferentdrugdrugseducationindividualintendedinvolvingjusticelegalmedicalpersonprofessionalprogramprograms
SHARED TOKENS (22): "among", "another", "child", "constitute", "controlled", "criminal", "different", "drug", "drugs", "education", "individual", "intended", "involving", "justice", "legal", "medical", "person", "professional", "program", "programs"....
0.300
actionsactivealcoholassistancecontrolcostdistinctexperiencegoverninghealthcareinstitutionskeeplatermembersopenorganizationsprimaryprogrampublicrates
SHARED TOKENS (23): "actions", "active", "alcohol", "assistance", "control", "cost", "distinct", "experience", "governing", "healthcare", "institutions", "keep", "later", "members", "open", "organizations", "primary", "program", "public", "rates"....
0.300
activitiesaddressapplycasecausecourtcriminaldecisionsdescribeestablishedevidencefederalgovernmentgovernmentshistorylaterlawlegallocalmeans
SHARED TOKENS (28): "activities", "address", "apply", "case", "cause", "court", "criminal", "decisions", "describe", "established", "evidence", "federal", "government", "governments", "history", "later", "law", "legal", "local", "means"....
0.300
administrationagenciesalcoholbuildingcontainscriminaldepartmentdirectlydomesticdrugenforcementenvironmentequivalentfederalfunctionsgeneralgovernmentgrantjudicialjustice
SHARED TOKENS (30): "administration", "agencies", "alcohol", "building", "contains", "criminal", "department", "directly", "domestic", "drug", "enforcement", "environment", "equivalent", "federal", "functions", "general", "government", "grant", "judicial", "justice"....
0.300
acquireactivitieschangescommunicationcommunitiescommunitydecisionsdifferentlyeducationformgroupshealthindividualinfluenceinformationinvolvingknowledgelifemedicinenational
SHARED TOKENS (31): "acquire", "activities", "changes", "communication", "communities", "community", "decisions", "differently", "education", "form", "groups", "health", "individual", "influence", "information", "involving", "knowledge", "life", "medicine", "national"....
0.300
againstanotherapplycasecontainscourtcriminalcustodyfederalgovernmentgovernmentsindividuallawlifelocalmeanspeoplepersonpolicepowers
SHARED TOKENS (31): "against", "another", "apply", "case", "contains", "court", "criminal", "custody", "federal", "government", "governments", "individual", "law", "life", "local", "means", "people", "person", "police", "powers"....
0.300
Psychiatry ↗ Q7867 KW CROSS HIGH
approachesassessmentassociationbehaviorcaseclassificationcommunityconditionscontrolemploymentexaminationshealthhistoricalhistoryindividualinfluencemattersmedicalmedicinenational
SHARED TOKENS (35): "approaches", "assessment", "association", "behavior", "case", "classification", "community", "conditions", "control", "employment", "examinations", "health", "historical", "history", "individual", "influence", "matters", "medical", "medicine", "national"....
🫐 BERRY47 edges
0.280
appointedchiefdepartmentsenforcementjailslawofficersoperatingorderspoliceprotectionpublicsecuritysheriffs
SHARED TOKENS (14): "appointed", "chief", "departments", "enforcement", "jails", "law", "officers", "operating", "orders", "police", "protection", "public", "security", "sheriffs".
0.280
applydrugfederalgovernmenthealthindividualknowledgemissionnationalpublicresearchsocialstudywhose
SHARED TOKENS (14): "apply", "drug", "federal", "government", "health", "individual", "knowledge", "mission", "national", "public", "research", "social", "study", "whose".
0.280
accessdevelopmentdocumentsgoverninggovernmentincreasinglyinformationinstitutionsmaintainsopenoversightpracticepublicpublicly
SHARED TOKENS (14): "access", "development", "documents", "governing", "government", "increasingly", "information", "institutions", "maintains", "open", "oversight", "practice", "public", "publicly".
0.260
Hydrocodone ↗ Q411441 KW CROSS HIGH
amongcontrolleddevelopeddrugequivalentformitselfmedicalproductionrecommendedrequiresidework
SHARED TOKENS (13): "among", "controlled", "developed", "drug", "equivalent", "form", "itself", "medical", "production", "recommended", "require", "side", "work".
0.260
conditionsdrugenvironmentfacilitieshousehousingpeopleprogramprogramssafeservestructuredsupportive
SHARED TOKENS (13): "conditions", "drug", "environment", "facilities", "house", "housing", "people", "program", "programs", "safe", "serve", "structured", "supportive".
0.260
activitiesalcoholcommunitiescommunitydifferentdrugincreasinglypathpracticalreputationresidentialtreatmentunits
SHARED TOKENS (13): "activities", "alcohol", "communities", "community", "different", "drug", "increasingly", "path", "practical", "reputation", "residential", "treatment", "units".
0.260
becomeboardcontrolcontrolledcostscoveragedevelopedexpandedhumaninfrastructurepolicingsurveillancesystem
SHARED TOKENS (13): "become", "board", "control", "controlled", "costs", "coverage", "developed", "expanded", "human", "infrastructure", "policing", "surveillance", "system".
0.260
controlpopulationwork
SHARED TOKENS (3): "control", "population", "work". | EXACT TITLE in police_law_enforcement: "Animal control".
0.260
Campus police ↗ Q5028727 KW CROSS HIGH
agencycampuscollegeemployedofficerspeoplepoliceprivatepublicsafetysecurityuniversitywork
SHARED TOKENS (13): "agency", "campus", "college", "employed", "officers", "people", "police", "private", "public", "safety", "security", "university", "work".
0.260
Support group ↗ Q3117735 KW CROSS HIGH
advocacycommunityestablishingforminformationmembersnetworkspeoplepublicrelevantsocialsupportwork
SHARED TOKENS (13): "advocacy", "community", "establishing", "form", "information", "members", "networks", "people", "public", "relevant", "social", "support", "work".
0.260
addressingchildchildrencriminalevenfrequentlyinvolvingmaterialspossessproductionstatutesstatutorythem
SHARED TOKENS (13): "addressing", "child", "children", "criminal", "even", "frequently", "involving", "materials", "possess", "production", "statutes", "statutory", "them".
0.240
alcoholdrughomelessnessincreaseditselfmakingpeoplepersonprimaryratessinglesubstances
SHARED TOKENS (12): "alcohol", "drug", "homelessness", "increased", "itself", "making", "people", "person", "primary", "rates", "single", "substances".
0.240
administrationbuildingcostdeathdepartmentdirectlyhealthhumanoutsidereducereportstreatment
SHARED TOKENS (12): "administration", "building", "cost", "death", "department", "directly", "health", "human", "outside", "reduce", "reports", "treatment".
0.240
analysiscomparisoncourtevidenceexamininglegalnationalprocessrecordspecialistssubjecttechnology
SHARED TOKENS (12): "analysis", "comparison", "court", "evidence", "examining", "legal", "national", "process", "record", "specialists", "subject", "technology".
0.220
carecoordinationhealthmedicalpracticepractitionerpreventionprovidertrainedtrainingtreatment
SHARED TOKENS (11): "care", "coordination", "health", "medical", "practice", "practitioner", "prevention", "provider", "trained", "training", "treatment".
0.220
becomedescribesdevelopeddrugsitselfmajormodelorganizationpeopleproblemuses
SHARED TOKENS (11): "become", "describes", "developed", "drugs", "itself", "major", "model", "organization", "people", "problem", "uses".
0.220
crisisintervention
SHARED TOKENS (2): "crisis", "intervention". | EXACT TITLE in police_law_enforcement: "Crisis intervention". | EXACT TITLE in substance_use_recovery: "Crisis intervention".
0.220
Star, Idaho ↗ KW CROSS HIGH
adaboisecanyondistricthouseidahometropolitanpopulationschoolschoolstoday
SHARED TOKENS (11): "ada", "boise", "canyon", "district", "house", "idaho", "metropolitan", "population", "school", "schools", "today".
0.220
Police radio ↗ Q187707 KW CROSS HIGH
agenciesanothercommunicationenforcementlawmodernofficerspoliceprivatesystemsystems
SHARED TOKENS (11): "agencies", "another", "communication", "enforcement", "law", "modern", "officers", "police", "private", "system", "systems".
0.220
Oxycodone ↗ Q407535 KW CROSS HIGH
amongdrugequivalentformgenerichealthlaterorganizationproductssidetreatment
SHARED TOKENS (11): "among", "drug", "equivalent", "form", "generic", "health", "later", "organization", "products", "side", "treatment".
0.200
criminalincarcerationjusticepolicepolicingpreventionrightsstatedsystemsystems
SHARED TOKENS (10): "criminal", "incarceration", "justice", "police", "policing", "prevention", "rights", "stated", "system", "systems".
0.200
adaboisecanyoncountiesidahometropolitanregiontreasurevalleywashington
SHARED TOKENS (10): "ada", "boise", "canyon", "counties", "idaho", "metropolitan", "region", "treasure", "valley", "washington".
0.200
Prison officer ↗ Q311396 KW CROSS HIGH
correctionalcorrectionscustodyenforcementlawofficerofficialregulationsafetysupervision
SHARED TOKENS (10): "correctional", "corrections", "custody", "enforcement", "law", "officer", "official", "regulation", "safety", "supervision".
0.200
Recidivism ↗ Q1420643 KW CROSS HIGH
actbehaviorcriminalfrequentlyindividualmedicinemodelpersonrecurringtrained
SHARED TOKENS (10): "act", "behavior", "criminal", "frequently", "individual", "medicine", "model", "person", "recurring", "trained".
0.200
EXACT TITLE in substance_use_recovery: "Rehabilitation".
0.200
agenciesarticleenforcementidahojusticelawlocalofficerspoliceresidents
SHARED TOKENS (10): "agencies", "article", "enforcement", "idaho", "justice", "law", "local", "officers", "police", "residents".
0.200
becomecontactsdistinctfamilyinfluenceinformationprimaryprocessreferralreferrals
SHARED TOKENS (10): "become", "contacts", "distinct", "family", "influence", "information", "primary", "process", "referral", "referrals".
0.200
actionsamongcapacityconnectiondutiesevidenceofficersofficialpolicesurveillance
SHARED TOKENS (10): "actions", "among", "capacity", "connection", "duties", "evidence", "officers", "official", "police", "surveillance".
0.200
County police ↗ Q5177941 KW CROSS HIGH
agencyenforcementhistoricallylawnationalpolicepossessprimarysheriffsunified
SHARED TOKENS (10): "agency", "enforcement", "historically", "law", "national", "police", "possess", "primary", "sheriffs", "unified".
0.200
behaviorequivalentevaluationidentifyindividualmanagementperformancepersonregulaterelationship
SHARED TOKENS (10): "behavior", "equivalent", "evaluation", "identify", "individual", "management", "performance", "person", "regulate", "relationship".
0.180
drugdrugsfinanciallocalmarketratesreduceremainsreport
SHARED TOKENS (9): "drug", "drugs", "financial", "local", "market", "rates", "reduce", "remains", "report".
0.180
casecriminaldistinctfederallawproceduresrulessourcesstatutes
SHARED TOKENS (9): "case", "criminal", "distinct", "federal", "law", "procedures", "rules", "sources", "statutes".
0.180
Cannabis ↗ Q79817 KW CROSS HIGH
drugfamilyhistoryoriginatingprincipalproduceproductsrecognizedsingle
SHARED TOKENS (9): "drug", "family", "history", "originating", "principal", "produce", "products", "recognized", "single".
0.160
adaboisegovernmentidahometropolitanmunicipalpopulationseparate
SHARED TOKENS (8): "ada", "boise", "government", "idaho", "metropolitan", "municipal", "population", "separate".
0.160
agencyappointedcertificationeducationalpersonprofessionalpublictask
SHARED TOKENS (8): "agency", "appointed", "certification", "educational", "person", "professional", "public", "task".
0.140
causedrugdrugsleadpathwaysprescriptionrapid
SHARED TOKENS (7): "cause", "drug", "drugs", "lead", "pathways", "prescription", "rapid".
0.140
costdrugexchangeprogramreducerisksocial
SHARED TOKENS (7): "cost", "drug", "exchange", "program", "reduce", "risk", "social".
0.140
Drug overdose ↗ Q3505252 KW CROSS HIGH
casesdeathdrughealthpotentialrecommendedrisk
SHARED TOKENS (7): "cases", "death", "drug", "health", "potential", "recommended", "risk".
0.140
alcoholdrugdrugsearlieremploymentindividualpattern
SHARED TOKENS (7): "alcohol", "drug", "drugs", "earlier", "employment", "individual", "pattern".
0.140
activitychangesdrugengagementforminvolvingsubstances
SHARED TOKENS (7): "activity", "changes", "drug", "engagement", "form", "involving", "substances".
0.140
canyonconnectingeagleidahomeridiannampavalley
SHARED TOKENS (7): "canyon", "connecting", "eagle", "idaho", "meridian", "nampa", "valley".
0.120
Water police ↗ Q197617 KW CROSS HIGH
enforcementlaworganizationpoliceportionspecialty
SHARED TOKENS (6): "enforcement", "law", "organization", "police", "portion", "specialty".
0.120
carehospitalmedicinemodernrequireswhose
SHARED TOKENS (6): "care", "hospital", "medicine", "modern", "requires", "whose".
0.100
Kuna, Idaho ↗ Q1515177 KW CROSS HIGH
adaboiseidahometropolitanpopulation
SHARED TOKENS (5): "ada", "boise", "idaho", "metropolitan", "population".
0.100
businessentityprivatepublicsecurity
SHARED TOKENS (5): "business", "entity", "private", "public", "security".
0.100
Eagle, Idaho ↗ Q1516870 KW CROSS HIGH
adaboiseeagleidahopopulation
SHARED TOKENS (5): "ada", "boise", "eagle", "idaho", "population".
0.100
boiseidahomajormetropolitanserves
SHARED TOKENS (5): "boise", "idaho", "major", "metropolitan", "serves".
◈ Frequently Asked Questions
Police Law Enforcement × Substance Use Recovery — Treasure Valley
HAIKU · HIGH GATE
How do Idaho State Police coordinate with substance use recovery programs in the Treasure Valley?
Idaho State Police enforce drug laws across the Boise metropolitan area while coordinating with local recovery services to divert individuals from incarceration. The Drug Enforcement Administration works alongside Idaho State Police to investigate trafficking while probation and parole officers in Ada County link offenders to treatment resources in Boise and Nampa.
What role do courts in Boise play in connecting individuals arrested for drug offenses to recovery services?
The Idaho Supreme Court establishes sentencing guidelines that allow judges in Boise to mandate treatment as part of probation rather than imprisonment alone. Ada County courts regularly sentence individuals to supportive housing programs and substance use recovery services throughout the Treasure Valley as conditions of supervised release.
How do Boise and Nampa police departments address the overlap between homelessness and substance use?
Police in Boise and Nampa coordinate with Emergency Medical Services to respond to overdoses and connect individuals experiencing homelessness to supportive housing with integrated recovery programs. Idaho State Police and local law enforcement refer individuals to treatment rather than arrest when possible, reducing cycling through the criminal justice system.
What partnerships exist between Idaho law enforcement and Boise State University regarding substance use prevention and recovery?
Boise State University conducts research on drug enforcement effectiveness and recovery outcomes in the Boise metropolitan area, informing Idaho State Police and local department policies. University partnerships with probation and parole agencies in Ada County help develop evidence-based reentry programs for individuals with substance use disorders.
◈ Provenance Chain · refinery-treasurevalley-v1.0.0
Police Law Enforcement × Substance Use Recovery 20 QID bridges 261 edges 7,022 ext links 2026-07-17 22:50:11 UTC 8d4fd2dd7b105197
Police Law Enforcement corridor ↗ Substance Use Recovery corridor ↗ Substance Use Recovery × Police Law Enforcement ↗ boisestandard.org/standard ↗
Parent Corridors
Police Law Enforcement × All Other Verticals